Tdn Europe • Page 2 of 14 • Thetdn.Com Saturday • 29 May 2021

Total Page:16

File Type:pdf, Size:1020Kb

Tdn Europe • Page 2 of 14 • Thetdn.Com Saturday • 29 May 2021 SATURDAY, 29 MAY 2021 RECORD TRADE AT ARQANA'S IRISH DERBY MEETING FIRST TO WELCOME RACEGOERS PANDEMIC-PROOF BREEZE The Dubai Duty Free Irish Derby meeting on June 26 is expected to be the first racing fixture in the country to welcome up to 1,000 fans, the Taoiseach Micheal Martin confirmed Friday evening. Horse owners are expected to be allowed on course beginning June 7. The Irish Field was first to report the news. "We expect to be in a position to welcome owners back on track with effect from June 7,@ HRI Chief Executive Brian Kavanagh told the publication. AThis would be a brilliant outcome as owners have been incredibly patient during the last 12 months, keeping the industry going and continuing to support racing despite not being able to attend in person.@ The Irish Field reported that HRI has submitted proposals to the government laying out how owners, sponsors and a limited number of racegoers might be accommodated. The Irish Field said that it had been confirmed that horse racing will be part of the government's trials for the return of crowds to sporting Lot 90, a son of Medaglia d=Oro topped the sale | Steve Davies events. Irish Field reports that no indoor facilities will be accessible to owners or fans. By Emma Berry AInitially, everything will be outdoors. But as indoor dining DONCASTER, UK--It takes more than mere pandemic-induced returns more generally then hopefully those type of options will travel restrictions to blunt the ardour of the bloodstock industry. become available,@ Kavanagh told the paper. Cont. p7 A new record for turnover and median set the tone for a robust day of trade in Doncaster and, just as would be expected in normal times, the buyers' list at the Arqana Breeze-Up Sale IN TDN AMERICA TODAY represented many nations, with plenty of help from the Middle THIS SIDE UP: MOURNING TWO EXCEPTIONS, East. LAMENTING THE RULE The familiar duo of Anthony Stroud and David Loder leaned Chris McGrath opines on former region sires who died last nonchalantly on the parade ring rail to make their play for the week–Malibu Moon (A.P. Indy) and Laoban (Uncle Mo). Click or Medaglia d'Oro colt who would become the top lot of the day, tap here to go straight to TDN America. bidding against an unseen rival from inside the ring. TDN EUROPE • PAGE 2 OF 14 • THETDN.COM SATURDAY • 29 MAY 2021 The sale being put back a few weeks has only helped him because he's still immature. He's a beautiful horse who will only improve with time." Bastard added, "I don't got excited, I'm realistic, but it's turning out to be a good sale. But the horses have to go on and win for the owners." ARQANA MAY BREEZE-UP SALE SESSION TOTALS 2021 Strong Trade In Whichever Currency $ Catalogued 164 As the sale was held in England, trade was conducted in $ Number Offered 123 sterling, but the figures have already been converted to euros $ Number Sold 109 $ Not Sold 14 on the Arqana website which shows, incredibly, that in the midst $ Clearance Rate 88.6% of a lengthy world health crisis Arqana has set new records for $ No. ,300k+ 9 both aggregate (i15,219,820/,13,052,500) and median $ High Price ,675,000 (i98,600/,85,000). The clearance rate settled at 88.6% for 109 $ Gross ,13,052,500 $ Average (% change) ,119,748 horses sold from 123 offered at an average price of $ Median (% change) ,85,000 i139,631/,119,748. Reflecting on the day's action, Arqana's executive director Freddy Powell said, "It shows that the catalogue was so strong, Arqana Breeze-Up Sale Cont. from p1 that it has been appreciated worldwide. We've had people Farther away still but connected via telephone, bidding from all over." Singapore-based new player Kuldeep Singh gave his instructions He continued, "All things considered we have to be satisfied. to Arqana's Freddy Powell and is now the proud owner of a It's difficult to compare the figures to last year when we had far Kingman (GB) half-brother to a Classic winner. Other buyers fewer horses, but the figures will be very similar to 2019 and unable to attend placed their bids online. 2018, when we had an aggregate of around i15 million. The These diverse options which were hastened into existence by median is close to i100,000 which is incredible from that the blight of coronavirus have changed the traditional vibe of number of horses. I think it shows the depth of the catalogue. the bloodstock auction, with some of the buzz created by the The vendors have been amazing to adapt again--we had to intense exchange of bids from one side of the auditorium to the change the date and change the venue--and when you have other perhaps now lost for good. But they have enabled trade to horses of that value for things to change all the time is not easy continue, largely unabated if sometimes delayed, to the when you are preparing them for a breeze. That is why we had enormous relief of those whose annual business is conducted to make our decision early. But today has been very satisfying, predominantly within a few hectic weeks of spring. especially the clearance rate, and we have had the highest In a close replay of last year, Arqana upped sticks and moved median ever as well as record aggregate." Cont. p3 to the Goffs UK complex, and once again provided the most expensive breezer of the European season, in lot 90, the son of Darley America stallion Medaglia d'Oro, who brought the day's high price of ,675,000. The colt, a first foal of the five-time winner Shelbysmile (Smart Strike), herself a half-sister to Dubaian group winners Derbaas (Seeking The Gold) and Chiefdom (The Factor), will now be trained in France by Andre Fabre, having been prepared for sale by master pre-trainer Malcolm Bastard. "Malcolm does such a fantastic job," said Stroud. "He really brings his horses on so well. [The colt] had really good vet work so we decided that he was the one we'd have a go on." Bastard was a partner in the horse with Alex Kershaw, who bought him at Fasig-Tipton's October Sale for $175,000. He said, "He is a fantastic horse, he breezed great and he has a superb temperament. There is a lot of improvement to come from him. Arqana=s Freddy Powell | Zuzanna Lupa TDN EUROPE • PAGE 3 OF 14 • THETDN.COM SATURDAY • 29 MAY 2021 Expensive Thrills For Marley And Cullinan For much of the day the colts were well on top in the table but a pair of fillies sold two lots apart brought a dramatic late conclusion to the day's trade. Roger Marley had waxed lyrical on the merits of first-season sire Ribchester (Ire) when quizzed by TDN earlier this year, and his one breezer by the Darley stallion Senior Vice President certainly did not make a fool of him. Sold as lot 147 through the Gary King Church Farm & Horse Park Stud draft Marley runs in association Twitter: @garykingTDN with his Irish partner John Cullinan, the daughter of Cheap [email protected] Thrills (GB) (Bertolini) gave her vendors quite a few expensive + 1.732.320.0975 thrills when knocked down at ,590,000 following a ding-dong battle between Richard Brown of Blandford Bloodstock and Alex International Editor Elliot and Paul Shanahan bidding outside the ring. Tucked away Kelsey Riley Twitter: @kelseynrileyTDN in his office, Brown prevailed and was delighted to have [email protected] succeeded on the horse he declared to be the best filly he has seen at the breeze-ups all season. European Editor He said, "She did a phenomenal breeze and she has a great Emma Berry stride on her. She's a very attractive filly and it's a proper Twitter: @collingsberry family--it's Chris Wright's good family." [email protected] Brown added, "I'm a massive fan of Ribchester--there's a huge word about him. This was more than I thought I would have to Associate International Editor Heather Anderson give but time will tell if we're right or not. I can't say who her Twitter: @HLAndersonTDN new owner is but they agreed with me." Indeed, the filly had been bought from Wright's Stratford Place Marketing Manager Stud for just ,45,000 at last year's Goffs UK Premier Yearling Alayna Cullen Sale. With a terrific pinhooking result and six juveniles sold for Twitter: @AlaynaCullen an average of ,215,833, it was a good day of trade for Cullinan [email protected] and Marley. The latter said, "I couldn't have seen that coming in a month of Sundays but she has been very popular and is so Contributing Editors straightforward. She has an amazing action and covers so much Alan Carasso Christina Bossinakis ground. I loved her from the minute she came over from Ireland." Cont. p4 Cafe Racing Sean Cronin Tom Frary [email protected] Irish Correspondent Daithi Harvey Regular Columnists Chris McGrath | John Berry | Kevin Blake Amy Lynam | Melissa Steele Lot 147, a filly by Ribchester made ,590,000 | Arqana TDN EUROPE • PAGE 4 OF 14 • THETDN.COM SATURDAY • 29 MAY 2021 Arqana Breeze-Up Sale Cont. was among the leading lights of the Tattersalls December Foal Lot 37, a Distorted Humor half-brother to Grade II winner Sale of 2019 when bought by David Cox of Baroda Stud.
Recommended publications
  • Group & Listed
    The World's THURSDAY, 25TH JUNE 2020 Yearling Sale SEPTEMBERSALE BEGINS SUNDAY 13 EBN SEPTEMBER.KEENELAND.COM EUROPEAN BLOODSTOCK NEWS FOR MORE INFORMATION: TEL: +44 (0) 1638 666512 • FAX: +44 (0) 1638 666516 • [email protected] • WWW.BLOODSTOCKNEWS.EU TODAY’S HEADLINES TATTERSALLS EBN Sales Talk Click here to is brought to contact IRT, or you by IRT visit www.irt.com BUSY DAY FOR DUAL BREEZE-UP SALE The revised Tattersalls Craven and Ascot Breeze-Up Sales take Lot 3 at the Tattersalls Craven Breeze-Up Sale is a colt by Tamarkuz, consigned by Mocklershill. He is out of the Listed place in Newmarket today, with the Craven lots starting St Hugh's Stakes-placed Abby Road (Danehill), from the proceedings in the sales ring at 11:00am and the Ascot horses to family of top US sire Unbridled's Song. © Tattersalls follow from 3:00pm. Commenting early this month, Tattersalls Chairman Edmond Mahony said: “As well as giving buyers an extended period in which to view the horses prior to the sale, Tattersalls will be reintroducing IN TODAY’S ISSUE... live internet bidding as well as telephone bidding on the day of the sale. First winners for Buratino and The Last Lion p5 “On a practical level, in line with prevailing Government guidelines, Relatively Speaking p10 the sale will be restricted to those attending in a professional capacity. Full health protocols will need to be adhered to by all those Yesterday's Racing Review p14 attending the sale and we will be circulating full details to vendors Stakes Fields p20 and purchasers alike.
    [Show full text]
  • Belle Postiere (FR)
    equineline.com Product 40P 09/08/16 15:41:39 EDT Belle Postiere (FR) Dark Bay or Brown Filly; Mar 10, 2013 Arctic Tern, 73 ch Bering (GB), 83 ch Beaune (FR), 74 ch =American Post (GB), 01 Sadler's Wells, 81 b Belle Postiere (FR) br =Wells Fargo (GB), 96 b =Cruising Height (IRE), 87 b Foaled in France Rainbow Quest, 81 b =Spectrum (IRE), 92 b =River Dancer (IRE), 83 b =Melancolie (GB), 02 b Housebuster, 87 dk b/ Wenge, 95 dk b/ Hooriah, 86 ch By AMERICAN POST (GB) (2001). Classic winner of $854,487 USA in England and France, Gainsborough Poule d'Essai des Poulains-French Two Thousand Guineas [G1], etc. Sire of 9 crops of racing age, 371 foals, 299 starters, 21 stakes winners, 1 champion, 171 winners of 529 races and earning $13,588,134 USA, including Quarterback (Champion twice in Scandinavia, to 4, 2016, $216,560 USA, Chess Racing Scandinavian Open Championship [G3], etc.), Validor (to 10, 2016, $381,413 USA, Grand Prix de la Region Alsace, etc.), Robin of Navan ($345,239 USA, Criterium de Saint-Cloud [G1], etc.), American Devil ($303,371 USA, Prix du Palais-Royal [G3], etc.), Jetfire ($276,463 USA, Prix Max Sicard), Kourkam ($215,103 USA, Commercial Club Albury Gold Cup, etc.), Meneas (to 6, 2016, $206,805 USA, Criterium du Fonds Europeen de l'Elevage). 1st dam =MELANCOLIE (GB), by =Spectrum (IRE). Winner at 4 in FR , $13,811 (USA). Dam of 6 foals, 5 to race, 2 winners-- =Lasting Melancholy (FR) (f. by Orpen). 2 wins at 3 in FR , $50,696 (USA).
    [Show full text]
  • 71 Consigned by Eaton Sales, Agent Dark Bay Or Brown Filly
    Hip No. Barn 8-9 71 Consigned by Eaton Sales, Agent Dark Bay or Brown Filly Nearctic Northern Dancer . { Natalma Danzig . Admiral’s Voyage { Pas de Nom . { *Petitioner Dark Bay/Br. Filly . Raise a Native January 14, 2003 Mr. Prospector . { Gold Digger {Vantive . Seattle Slew (1995) { Embellished . { Courtly Dee By DANZIG (1977), winner. Leading sire 5 times. Sire of 21 crops, 178 black type winners, 608 winners, $55,214,072, 11 champions, in- cluding Dance Smartly [G1] ($3,263,835), Chief’s Crown [G1] ($2,191,- 168), Langfuhr [G1] ($698,574), Dayjur [G1], Pas de Reponse [G1], Polonia [G1], Blue Duster [G1], and Lure ($2,515,289), Pine Bluff. 1st dam VANTIVE, by Mr. Prospector. Winner at 3 in France. Dam of 2 foals of racing age, which has not started. 2nd dam EMBELLISHED, by Seattle Slew. Winner at 3, $13,340. Dam of 11 winners, incl.-- SEATTLE DAWN (f. by *Grey Dawn II). 7 wins at 3 and 4, $276,250, Dela- ware H. [G2], Snow Goose H. [G3], etc. Dam of 3 foals-- GOLD SUNRISE (f. by Forty Niner). 3 wins at 2, $199,676, Golden Rod S. [G3], 2nd Pocahontas S. [L] (CD, $22,640), 3rd Alcibiades S. [G2]. Premium Thunder (c. by Easy Goer). 4 wins in 8 starts in Japan, 2nd Mainichi Broadcast Kyoto Yonsaitokubetsu. Te n Te (g. by Easy Goer). 8 wins, $67,479, 2nd T. V. Lark S. TRUCKEE (c. by Danzig). 6 wins, $221,538, Governor’s H. [L], etc. Sire. ISLAND OF SILVER (f. by Forty Niner). 4 wins at 3 in England, Upavon S., etc.; winner at 3 in U.A.E; winner at 4, $32,640 in N.A.
    [Show full text]
  • Henny Hughes ! $ Meadow Flyer " $ # 2011 $ * $ Running Stag Running Bobcats $ " !
    ADMIRE MOON $ # * # Forty Niner * $ " b. $ End Sweep ! $ Broom Dance " $ # 2003 $ * $ Sunday Silence My Katies $ " ! * ! Katies First JRA Horse of the Year, JRA Best Older Horse, 9 wins in JRA, winner in UAE, Japan C -G1 (T2400m), Takarazuka Kinen -G1 (T2200m). sire of FINE NEEDLE (Sprinters S -G1, Takamatsunomiya Kinen -G1), SEIUN KOSEI (Takamatsunomiya Kinen -G1, Hakodate Sprint S -G3), HAKUSAN MOON (Centaur S -G2, Ibis Summer Dash -G3), LEO ACTIVE (Keio Hai Nisai S -G2, Keisei Hai Autumn Handicap -G3). *ALDEBARAN(USA) $ # # Raise a Native $ " b. $ Mr. Prospector ! $ Gold Digger " $ # 1998 $ $ Private Account Chimes of Freedom $ " ! ! Aviance 8 wins in USA・GB, Metropolitan H -G1 (D8.0F), Forego H -G1 (D7.0 F), San Carlos H -G1 (D7.0F), Tom Fool H -G2 (D7.0F). sire of MAIN SEQUENCE (Breeders' Cup Turf -G1, Joe Hirsch Turf Classic -G1), EYE OF TAURUS (Athenia S -G3, Valley View S -G3), DANCE DIRECTOR (Silk Road S -G3 (twice), 2nd Hanshin C -G2 (twice)), ARCADIA'S ANGLE (P.Paul De Moussac -G3, P.De Pontarme -L). *ASIA EXPRESS(USA) $ # * # Hennessy * $ " ch. $ Henny Hughes ! $ Meadow Flyer " $ # 2011 $ * $ Running Stag Running Bobcats $ " ! ! Backatem JRA Best 2-Year-Old Colt, 4 wins in JRA, Asahi Hai Futurity S -G1 (T 1600m), Leopard S -G3 (D1800m), 2nd Fuji TV Sho Spring S -G2.first crop now 3yos. sire of SOLO UNIT (Edelweiss Sho -LR, Monbetsu Lily C), STEEL GREAT (2nd Morioka Shiretoko Sho, Monbetsu Eikan Sho), MEDIEVAL (3rd Kantsubaki Sho). his sire won Vosburgh S -G1,sireof BEHOLDER (Breeders' Cup Distaff -G1 (twice)). *BAGO(FR) $ # # Blushing Groom $ " dk.b.
    [Show full text]
  • Aqueduct Racetrack Is “The Big Race Place”
    Table of Contents Chapter 1: Welcome to The New York Racing Association ......................................................3 Chapter 2: My NYRA by Richard Migliore ................................................................................6 Chapter 3: At Belmont Park, Nothing Matters but the Horse and the Test at Hand .............7 Chapter 4: The Belmont Stakes: Heartbeat of Racing, Heartbeat of New York ......................9 Chapter 5: Against the Odds, Saratoga Gets a Race Course for the Ages ............................11 Chapter 6: Day in the Life of a Jockey: Bill Hartack - 1964 ....................................................13 Chapter 7: Day in the Life of a Jockey: Taylor Rice - Today ...................................................14 Chapter 8: In The Travers Stakes, There is No “Typical” .........................................................15 Chapter 9: Our Culture: What Makes Us Special ....................................................................18 Chapter 10: Aqueduct Racetrack is “The Big Race Place” .........................................................20 Chapter 11: NYRA Goes to the Movies .......................................................................................22 Chapter 12: Building a Bright Future ..........................................................................................24 Contributors ................................................................................................................26 Chapter 1 Welcome to The New York Racing Association On a
    [Show full text]
  • From Darley Gone West Mr Prospector Secrettame Zamindar (USA) Zaizafon the Minstrel Mofida Danzig Northern Dancer Pas De Nom
    From Darley 1412 1412 Mr Prospector Gone West Secrettame Zamindar (USA) The Minstrel SEMAPHORE (GB) Zaizafon (2005) Mofida Bay Mare Northern Dancer Blue Duster Danzig Pas de Nom (USA) Habitat (1993) Blue Note Balsamique 1st dam BLUE DUSTER (USA): Champion 2yr old filly in Europe in 1995, 5 wins at 2 and 3 and £174,887 inc. Shadwell Stud Cheveley Park S., Gr.1, Princess Margaret S., Gr.3 and Queen Mary S., Gr.3, placed twice viz. 2nd Haydock Park Sprint Cup, Gr.1 and 3rd Duke of York International Factors S., Gr.3; Own sister to ZIETEN (USA); dam of 9 foals; 4 runners; 2 winners: Blue Leader (IRE) (99 g. by Cadeaux Genereux): 5 wins inc. winner at 3. Blue Symphony (GB) (00 f. by Darshaan): winner at 3; dam of 2 winners inc.: FANTASIA (GB) (f. by Sadler's Wells (USA)): 2 wins at 2, 2008 and £83,978 inc. Prestige S., Gr.3, placed viz. 2nd Meon Valley Stud Fillies' Mile S., Gr.1. She also has a yearling filly by Pivotal (GB). 2nd dam BLUE NOTE (FR): 5 wins at 2 and 3 in France and £54,669 inc. Prix Maurice de Gheest, Gr.2, Prix de la Porte Maillot, Gr.3, Prix de L'Obelisque, L. and Criterium d'Evry, L., placed inc. 3rd Prix du Palais Royal, Gr.3, Prix du Petit Couvert, Gr.3, 4th Prix de la Foret, Gr.1; dam of 16 foals; 14 runners; 11 winners inc.: ZIETEN (USA) (c. by Danzig (USA)): 6 wins at 2 to 4 at home and in France and £343,990 inc.
    [Show full text]
  • HORSE in TRAINING, Consigned by Kilbrew Stables, Ireland
    HORSE IN TRAINING, consigned by Kilbrew Stables, Ireland Will Stand at Park Paddocks, Highflyer Paddock AA, Box 722 Danehill (USA) Kodiac (GB) 19 (WITH VAT) Rafha Adaay (IRE) Royal Applause (GB) A BAY COLT (GB) Lady Lucia (IRE) Inventive (GB) Foaled Refuse To Bend Sadler's Wells (USA) April 29th, 2018 Blue Lyric (GB) (IRE) Market Slide (USA) (2007) Daylami (IRE) Powder Blue (GB) Blue Duster (USA) E.B.F. Nominated. 1st Dam BLUE LYRIC (GB), won 2 races at 2 years and placed twice; dam of five winners from 6 runners and 7 foals of racing age viz- Deia Glory (GB) (2016 f. by Kyllachy (GB)), won 1 race at 2 years and £33,241 and placed 5 times including second in Roses Stakes, York, L. and fourth in Westow Stakes, York, L. and Abergwaun Stakes, Tipperary, L. LAPILLI (GB) (2013 g. by Bahamian Bounty (GB)), won 5 races at 3, 6 and 7 years, 2020 and £25,974 and placed 6 times. ODE TO GLORY (GB) (2014 f. by Poet's Voice (GB)), won 1 race at 2 years, placed 6 times. COLOURING (GB) (2017 f. by Showcasing (GB)), won 1 race at 2 years, 2019 and placed 3 times, from only 5 starts. FINE JUDGMENT (GB) (2012 f. by Compton Place (GB)), won 1 race at 3 years, placed once. She also has a 2019 filly by Cityscape (GB). 2nd Dam POWDER BLUE (GB), placed twice at 3 years; dam of five winners from 6 runners and 8 foals of racing age including- BLUE LAUREATE (GB), won 2 races at 2 and 4 years, 2019, £42,355 and placed 9 times.
    [Show full text]
  • Connecticut Daily Campus Ordboq Sewing Storrs Since 1896 *~ M C
    'ncardsj CSL Dfceard^J CONNECTICUT ?3^<^ ST ; \RY O x o 10 mg i 9. Connecticut Daily Campus ORDboq Sewing Storrs Since 1896 *~ M c-.. STORES. CONNECTICUT TUESDAY, MAY 8, 1962 VOL. CXVI, No. 124 ►■3 Summer Registration CCC Totals $6,000: Hi CO To End This Friday P: Advanced registration for Sum- istry -during the eight week per- K iod. Any student engaging in Most Successful Yet mer School will continue until the end of this week. During this this accelerated chemistry pro- BY SUE SOTT onds with totals of $277 and $190 Also: Alpha Epsilon Pi, Theta time all interested students may gram will not be allowed to The 14th annual Campus Com- respectively. Xi, each $3; Alpha Zeta Omega, tr ister for either of the two carry other courses at this time, munity Carnival, which took Other houses pledging to the Kappa Psi, Phi Sigma Kappa, however. Marathon were: Fairfield Hall, Undergraduate or graduate ses- place Monday, April 30, turned Sigma Nu Alpha, Alsop A, Colt sions offered here at Storrs or at Certain selected courses for into a great success despite rain $54; Hollister B, $42; Phi Sigma the Waterbury. Hartford. or pre-medical, pre-dental, and pre- and wind during the parade. Delta, $40; Holcomb, $36; Web- House, Chi Phi, and Wheeler C, Stamford branch. veterinary students are also fea- Large crowds gathered* a* ster House. $26; French B, $23; each $2; Pledging one dollar Advanced registration forms tured along with a two year's spectators and participants on the Hollister A, $23; Tolland Hall, apiece were: Alpiia Gamma Rho, ' are being accepted in the Sum- foreign language study in Span- midway, and nearly all houses on $21; Pi Beta Phi and Morgan Delta Pi.
    [Show full text]
  • Preakness Stakes .Fifty-Three Fillies Have Competed in the Preakness with Start in 1873: Rfive Crossing the Line First The
    THE PREAKNESS Table of Contents (Preakness Section) History . .P-3 All-Time Starters . P-31. Owners . P-41 Trainers . P-45 Jockeys . P-55 Preakness Charts . P-63. Triple Crown . P-91. PREAKNESS HISTORY PREAKNESS FACTS & FIGURES RIDING & SADDLING: WOMEN & THE MIDDLE JEWEL: wo people have ridden and sad- dled Preakness winners . Louis J . RIDERS: Schaefer won the 1929 Preakness Patricia Cooksey 1985 Tajawa 6th T Andrea Seefeldt 1994 Looming 7th aboard Dr . Freeland and in 1939, ten years later saddled Challedon to victory . Rosie Napravnik 2013 Mylute 3rd John Longden duplicated the feat, win- TRAINERS: ning the 1943 Preakness astride Count Judy Johnson 1968 Sir Beau 7th Fleet and saddling Majestic Prince, the Judith Zouck 1980 Samoyed 6th victor in 1969 . Nancy Heil 1990 Fighting Notion 5th Shelly Riley 1992 Casual Lies 3rd AFRICAN-AMERICAN Dean Gaudet 1992 Speakerphone 14th RIDERS: Penny Lewis 1993 Hegar 9th Cynthia Reese 1996 In Contention 6th even African-American riders have Jean Rofe 1998 Silver’s Prospect 10th had Preakness mounts, including Jennifer Pederson 2001 Griffinite 5th two who visited the winners’ circle . S 2003 New York Hero 6th George “Spider” Anderson won the 1889 Preakness aboard Buddhist .Willie Simms 2004 Song of the Sword 9th had two mounts, including a victory in Nancy Alberts 2002 Magic Weisner 2nd the 1898 Preakness with Sly Fox “Pike”. Lisa Lewis 2003 Kissin Saint 10th Barnes was second with Philosophy in Kristin Mulhall 2004 Imperialism 5th 1890, while the third and fourth place Linda Albert 2004 Water Cannon 10th finishers in the 1896 Preakness were Kathy Ritvo 2011 Mucho Macho Man 6th ridden by African-Americans (Alonzo Clayton—3rd with Intermission & Tony Note: Penny Lewis is the mother of Lisa Lewis Hamilton—4th on Cassette) .The final two to ride in the middle jewel are Wayne Barnett (Sparrowvon, 8th in 1985) and MARYLAND MY Kevin Krigger (Goldencents, 5th in 2013) .
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • 1 Million Blue Grass (Grade II)
    $1 million Blue Grass (Grade II) Kentucky Derby Championship Series – Points: 100-40-20-10 96th Running – Saturday, April 4, 2020 (4 weeks before the Kentucky Derby) 3-Year-Olds at 1 1/8 Miles on Dirt at Keeneland Race Course (Lexington, Ky.) Stakes Record – 1:47.29, Skip Away (1996) Track Record – 1:47.75, Noble Bird (2016) Year (Race No.) Winner (Sex) Jockey (Weight) Second Time (Cond.) Sire Gross Purse-Gr. Dis.-Track (Starters) Owner(s) Trainer Third Odds (Margin) Bred (Color) Winner's Share 2019-April 6 (10th) Vekoma* (c) Javier Castellano (123) Win Win Win 1:50.93 (fast) Candy Ride-ARG $1,000,000-Gr. II 1 1/8 Miles-Kee (14) R. A. Hill Stable & Gatsas Stables George Weaver Signalman 1.40-1 (3 ½ lengths) Kentucky (Ch.) $600,000—95 2018-April 7 (10th) Good Magic* (c) Jose Ortiz (123) Flameaway 1:50.18 (fast) Curlin $1,000,000-Gr. II 1 1/8 Miles-Kee (14) e Five Racing Thoroughbreds & Stonestreet Stables Chad Brown Free Drop Billy 1.60-1 (1 ½ lengths) Kentucky (Ch.) $600,000—94 2017-April 8 (10th) Irap (c) Julien Leparoux (123) Practical Joke 1:50.39 (fast) Tiznow $1,000,000-Gr. II 1 1/8 Miles-Kee (7) Reddam Racing LLC Doug O’Neill McCracken* 31.30-1 (¾ length) Kentucky (B.) $600,000—93 2016-April 9 (10th) Brody’s Cause (c) Luis Saez (123) My Man Sam 1:50.20 (fast) Giant’s Causeway $1,000,000-Gr. I 1 1/8 Miles-Kee (14) Albaugh Family Stable Dale Romans Cherry Wine 4.20-1 (1 ¾ lengths) Kentucky (B.) $600,000—92 2015-April 4 (10th) Carpe Diem* (c) John Velazquez (123) Danzig Moon 1:49.77 (fast) Giant’s Causeway $1,000,000-Gr.
    [Show full text]
  • BAY FILLY 153 (Branded Nr Sh
    Big Barn, Barn B Stables 44-72 On Account of ARROWFIELD STUD, Scone (As Agent) Lot 449 BAY FILLY 153 (Branded nr sh. off sh. Foaled 2nd September 2019) 9 Sunday Silence ............by Halo ......................... Heart's Cry ...................... SIRE Irish Dance ................ by Tony Bin ............... JUST A WAY ............. Wild Again ................. by Icecapade............... Sibyl .............................. Charon ...................... by Mo Exception .......... King Kamehameha ...... by Kingmambo .............. DAM Rulership ........................ Air Groove ................. by Tony Bin ............... NANYO VENUS (JPN) Fuji Kiseki (JPN) ......... by Sunday Silence .... 2014 Admire Fukky ................. Tokio Reality .............. by Meadowlake............ JUST A WAY (JPN) (Bay 2009-Stud 2015). 6 wins-1 at 2-1600m to 2000m, Tokyo Yasuda Kinen, Gr.1. Sire of 268 rnrs, 155 wnrs, inc. SW Danon the Kid (Nakayama Hopeful S., Gr.1), Epos, A Will a Way, Lord My Way, Admire Justa, Master Fencer, Velox, SP Love Me Fine, Rainy Day, Zenno Justa, Sing for You and of Teorema, Good Max, Shoryu Haru, Calibore, Gros Horloge, Half Back, Transnational, Adjust the Route, Narita Zakura, A Shin Zone, etc. 1st Dam NANYO VENUS (JPN), by Rulership. 2 wins at 1200m, 1600m in Japan. Half- sister to AMPHITRITE. This is her first foal. 2nd Dam ADMIRE FUKKY, by Fuji Kiseki. 3 wins to 1200m, 2d Niigata Inazuma Tokubetsu. Half-sister to NEOREALISM, REAL IMPACT, I'LL LOVE AGAIN, Realista, Will Power (dam of INDY CHAMP, A WILL A WAY), Fusaichi Linimo (dam of APERTURA). Dam of 7 foals, 6 to race, all winners, inc:- AMPHITRITE (f Lord Kanaloa). 3 wins in succession–2 at 2–at 1200m, Hanshin Marguerite S., L. Shine Red. 3 wins–1 at 2–2000m to 3290m in Japan.
    [Show full text]