DOCSLIB.ORG

A Two-Subunit Type I DNA Topoisomerase (Reverse Gyrase) from an Extreme Hyperthermophile

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
A Two-Subunit Type I DNA Topoisomerase (Reverse Gyrase) from an Extreme Hyperthermophile Proc. Natl. Acad. Sci. USA Vol. 93, pp. 106-110, January 1996 Biochemistry A two-subunit type I DNA topoisomerase (reverse gyrase) from an extreme hyperthermophile REGIS KRAH*, SERGEI A. KOZYAVKIN*t, ALEXEI I. SLESAREVt, AND MARTIN GELLERT*§ *Laboratory of Molecular Biology, National Institute of Diabetes and Digestive and Kidney Diseases, National Institutes of Health, Bethesda, MD 20892; and tMolecular Biology Institute and Department of Biology, University of California, Los Angeles, CA 90024 Contributed by Martin Gellert, September 6, 1995 ABSTRACT A recently described reverse gyrase from the helicases (15-17). These helicases are nucleic acid-dependent hyperthermophilic methanogen Methanopyrus kandleri is the ATPases, as is reverse gyrase (18, 19). It was proposed that the only known example of a heterodimeric type I topoisomerase. helicase-like ATPase domain uses ATP to translocate along The enzyme is made up of a 42-kDa subunit which covalently the DNA, generating a transient wave of positive and negative interacts with DNA (RgyA) and a 138-kDa subunit which supercoiling (15, 20, 21), while the topoisomerase domain binds ATP (RgyB). We have now cloned and sequenced the selectively removes negative supercoils, producing a super- genes for both subunits of this enzyme. Surprisingly, the coiled molecule. It is important to note that helicase activity universally conserved type I topoisomerase domain [Lima, has not yet been demonstrated for reverse gyrase and that ATP C. D., Wang, J. C. & Mondragon, A. (1994) Nature (London) hydrolysis may also be more directly linked to the mechanism 367, 138-146] which has been found as a contiguous polypep- of DNA strand passage. tide in the prokaryotes and eukaryotes is shared between the Recently, a reverse gyrase was described from the hyper- protomers. The subdomain with the active-site tyrosine is thermophilic methanogen Methanopyrus kandleri (18). Unlike entirely within RgyA, whereas the subdomain implicated in other type 1-5' topoisomerases, this enzyme was found to be a noncovalent binding of the cleaved DNA strand is contained heterodimer composed of a smaller subunit with an apparent entirely in RgyB. The appearance of this unique structure in molecular mass of 50 kDa (RgyA) that formed a covalent a highly conserved enzyme family supports the hypothesis that complex with DNA, and a larger subunit with an apparent the methanogens branched from other prokaryotes and eu- molecular weight of 150 kDa (RgyB) that was involved in the karyotes very early in evolution. hydrolysis ofATP. To further study this protein, we cloned and sequenced the genes encoding the subunits of this enzyme.1 A DNA topoisomerases are found in all organisms. They are remarkable feature of the sequence is that the domain which required for replication, decatenation, and unknotting of DNA characterizes all type I-5' topoisomerases, and is found as a in cells (1-3), and by controlling the torsional stress of DNA single polypeptide chain in all other enzymes of this class, is they can also affect the efficiency of gene expression and here divided between the two protomers. various recombination processes. All topoisomerases can be classified into three general subgroups that are distinguished MATERIALS AND METHODS by common biochemical properties and similarity in primary structure. These are the type 1-5' topoisomerases, the type I-3' Amino-Terminal Sequencing of Proteins and Development topoisomerases, and the type II topoisomerases. of DNA Probes. Microsequencing of the amino termini of Escherichia coli topoisomerase I, the first topoisomerase RgyA and RgyB was performed on an Applied Biosystems discovered (4), is the prototype of the type 1-5' topoisomer- 471A protein sequencer. Five picomoles ofM. kandleri reverse ases. Enzymes of this class have been found in eubacteria, gyrase (18) was separated into the A and B subunits by archaea, and eukaryotes (4-9). They share a number of SDS/PAGE. The proteins were blotted to Immobilon_psq common properties: they change the linking number of DNA transfer membrane (Millipore), and subjected to 20 cycles of by steps of 1, require a single-stranded region in the DNA Edman degradation (22). The amino-terminal amino acid substrate, are active only in the presence of a divalent metal sequence of RgyA was determined to be MNATLRIRNRP- cation, and form a covalent bond to DNA through a 5' VAE. Determination of the amino-terminal sequence of RgyB phosphoryl group during the cleavage reaction. required the comparison of two separate sequencing reactions, In the mid 1980s, a novel type I-5' topoisomerase, reverse and the sequence was found to be VLXRAXXMVPKGF (X gyrase, was isolated from extremely hyperthermophilic ar- indicates unreadable positions). The valine in the first position chaea (6, 7, 10, 11). This enzyme was able to positively indicates that the amino terminus was modified by proteolytic supercoil DNA in the presence ofATP or dATP. Although the cleavage. The observed signal for each cycle during the physiological role of this enzyme remains obscure, positive microsequencing was much weaker than expected, suggesting supercoiling would help to stabilize the DNA duplex against that the amino terminus in a significant fraction of the protein denaturation at the extreme temperatures at which these molecules is blocked. A blocked amino terminus has also been organisms grow (12, 13). Reverse gyrase has been found in all found in reverse gyrase from S. acidocaldarius (15). major branches of hyperthermophilic archaea as well as in PCR amplification with degenerate oligonucleotide primers hyperthermophilic eubacteria and is thus considered a molec- was used to generate DNA probes for rgyA and rgyB. Knowing ular marker for hyperthermophilic prokaryotes (12, 14). that the amino acid sequence of S. acidocaldarius RgyS had The cloning and sequencing of a reverse gyrase from Sulfolobus acidocaldarius (RgyS) revealed a monomeric pro- Abbreviation: ORF, open reading frame. tein which fused the universally conserved type 1-5' topo- tPresent address: Third Wave Technologies, Madison, WI 53711-5399. isomerase domain to a domain reminiscent of nucleic acid §To whom reprint requests should be addressed at: National Institutes of Health, National Institute of Diabetes and Digestive and Kidney Diseases, Laboratory of Molecular Biology, Building 5, Room 241, The publication costs of this article were defrayed in part by page charge 9000 Rockville Pike, Bethesda, MD 20892-0540. payment. This article must therefore be hereby marked "advertisement" in 1The sequences reported in this paper have been deposited in the accordance with 18 U.S.C. §1734 solely to indicate this fact. GenBank database (accession nos. U41058 and U41059). 106 Downloaded by guest on September 30, 2021 Biochemistry: Krah et al. Proc. Natl. Acad. Sci. USA 93 (1996) 107 revealed a protein that fused a helicase-like ATPase domain to RESULTS AND DISCUSSION the type 1-5' topoisomerase domain (15), we used alignments of helicases and topoisomerases with RgyS to locate conserved Cloning and Sequence Analysis of rgyB. Sequence analysis amino acid sequences and direct the design of these primers. revealed an open reading frame (ORF) encoding a protein of For rgyB, a probe complementary to the amino terminus 1221 aa, with a predicted molecular mass of 138 kDa. This is (probe 1) and a second probe (probe 2) based on highly in good agreement with the molecular mass of 150 kDa conserved motifs found in the type 1-5' DNA topoisomerases determined by SDS/PAGE (18). The coding sequence of the were developed. For probe 1, a series of degenerate PCR ORF agrees completely with the protein microsequencing primers based on the amino acid sequence MVPKG taken data: there is an ATG codon for methionine directly 5' of the from the amino terminus of RgyB were paired with a series of codon for the first valine. Strong similarity with S. acidocal- darius RgyS near aa 52 of degenerate PCR primers based on the sequence flanking and begins RgyB (Fig. 1) and includes a conserved zinc near including a conserved motif, the DEAH box of nucleic acid tetracysteine finger motif the amino termini of both enzymes. helicases (16, 17) (see Fig. 1). The second probe for rgyB was RgyB has the series of amino acid motifs found in the nucleic developed by using PCR primers based on the highly con- acid helicases which have also been identified in RgyS (Fig. 1) served motifs TEGEKI and VQTPVL found in the type I-5' (16, 17). Throughout the ATPase domain, RgyB and RgyS are DNA topoisomerases (see Fig. 2A). PCR yielded amplification 30% identical and 57% similar. Protein motifs common to products from both sets of that were cloned and primer pairs helicases are overlined and underlined in Fig. 1, and within and The usefulness of 1 for was sequenced. probe rgyB confirmed near these regions RgyB and RgyS share the greatest identity by the presence of a phenylalanine codon adjacent to the 5' (64%). However, between these regions RgyB has 14 inser- primer, in agreement with the sequence analysis of the amino terminus. Adjacent to the 3' primer, amino acid sequences with similarity to RgyS were found (15). For probe 2, amino acid 1 MVLKRAADMVPKGFRDLVEPILDDCADLEELADRVVETEMEPDEVRRRDVG 51 rgyB sequences conserved in type I-5' topoisomerases were found. 52 NTDSNEPVAIFGSSCVLCGGDCSSVRLTSRIGICERCLPVDTE..TLREV 99 rgyB Probe 1 was used to screen 5000 plaques from an amplified M. ..1: 1..1: 1111.1 11 :1 1111 .:: kandleri A library. The DNA from 6 plaques that hybridized to 2 QSLSDIPPSIYLFSCPNCGRSISTYRLL . LGSVCNICLEEDKEYKNIGDL 50 rgyS this probe was purified and probed with probe 2. All 6 A clones 100 LKEARKRHGYVGEALLMFILVERYSPDRVEEFFRRYVWPELFTEIVDRVF 149 rgyB were found to hybridize to probe 2 and were found to share 51 IKDIEKQGN .......... LIKLKDIQRVLDDYESFVS ..........VF 80 rgyS common restriction fragments that hybridized to both probes. 150 DRATGFRLYSAQRVWTRRLVKGCSFSILAPTGTGKTSWGSLVAAVFGHAG 199 rgyB For rgyA, a single probe was developed on the basis of 81 RRLLGFPPFGPQKSWIYRLLSGESFAIIAPPGLGKTTFGLISSIYLYLRG 130 rgyS sequence taken from the amino terminus (MNATLRI) and 200 the sequence of conserved motifs near the active-site tyrosine RRVYYLVPTTTLVRQVENR...
Load more

Recommended publications
  • A Korarchaeal Genome Reveals Insights Into the Evolution of the Archaea
    A korarchaeal genome reveals insights into the evolution of the Archaea James G. Elkinsa,b, Mircea Podarc, David E. Grahamd, Kira S. Makarovae, Yuri Wolfe, Lennart Randauf, Brian P. Hedlundg, Ce´ line Brochier-Armaneth, Victor Kunini, Iain Andersoni, Alla Lapidusi, Eugene Goltsmani, Kerrie Barryi, Eugene V. Koonine, Phil Hugenholtzi, Nikos Kyrpidesi, Gerhard Wannerj, Paul Richardsoni, Martin Kellerc, and Karl O. Stettera,k,l aLehrstuhl fu¨r Mikrobiologie und Archaeenzentrum, Universita¨t Regensburg, D-93053 Regensburg, Germany; cBiosciences Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831; dDepartment of Chemistry and Biochemistry, University of Texas, Austin, TX 78712; eNational Center for Biotechnology Information, National Library of Medicine, National Institutes of Health, Bethesda, MD 20894; fDepartment of Molecular Biophysics and Biochemistry, Yale University, New Haven, CT 06520; gSchool of Life Sciences, University of Nevada, Las Vegas, NV 89154; hLaboratoire de Chimie Bacte´rienne, Unite´ Propre de Recherche 9043, Centre National de la Recherche Scientifique, Universite´de Provence Aix-Marseille I, 13331 Marseille Cedex 3, France; iU.S. Department of Energy Joint Genome Institute, Walnut Creek, CA 94598; jInstitute of Botany, Ludwig Maximilians University of Munich, D-80638 Munich, Germany; and kInstitute of Geophysics and Planetary Physics, University of California, Los Angeles, CA 90095 Communicated by Carl R. Woese, University of Illinois at Urbana–Champaign, Urbana, IL, April 2, 2008 (received for review January 7, 2008) The candidate division Korarchaeota comprises a group of uncul- and sediment samples from Obsidian Pool as an inoculum. The tivated microorganisms that, by their small subunit rRNA phylog- cultivation system supported the stable growth of a mixed commu- eny, may have diverged early from the major archaeal phyla nity of hyperthermophilic bacteria and archaea including an or- Crenarchaeota and Euryarchaeota.
    [Show full text]
  • The Influence of Cell Cycle Regulation on Chemotherapy
    International Journal of Molecular Sciences Review The Influence of Cell Cycle Regulation on Chemotherapy Ying Sun 1, Yang Liu 1, Xiaoli Ma 2 and Hao Hu 1,* 1 Institute of Biomedical Materials and Engineering, College of Materials Science and Engineering, Qingdao University, Qingdao 266071, China; [email protected] (Y.S.); [email protected] (Y.L.) 2 Qingdao Institute of Measurement Technology, Qingdao 266000, China; [email protected] * Correspondence: [email protected] Abstract: Cell cycle regulation is orchestrated by a complex network of interactions between proteins, enzymes, cytokines, and cell cycle signaling pathways, and is vital for cell proliferation, growth, and repair. The occurrence, development, and metastasis of tumors are closely related to the cell cycle. Cell cycle regulation can be synergistic with chemotherapy in two aspects: inhibition or promotion. The sensitivity of tumor cells to chemotherapeutic drugs can be improved with the cooperation of cell cycle regulation strategies. This review presented the mechanism of the commonly used chemotherapeutic drugs and the effect of the cell cycle on tumorigenesis and development, and the interaction between chemotherapy and cell cycle regulation in cancer treatment was briefly introduced. The current collaborative strategies of chemotherapy and cell cycle regulation are discussed in detail. Finally, we outline the challenges and perspectives about the improvement of combination strategies for cancer therapy. Keywords: chemotherapy; cell cycle regulation; drug delivery systems; combination chemotherapy; cancer therapy Citation: Sun, Y.; Liu, Y.; Ma, X.; Hu, H. The Influence of Cell Cycle Regulation on Chemotherapy. Int. J. 1. Introduction Mol. Sci. 2021, 22, 6923. https:// Chemotherapy is currently one of the main methods of tumor treatment [1].
    [Show full text]
  • Title Genomic Analysis of the Marine Hyperthermophilic Archaeon
    Genomic analysis of the marine hyperthermophilic archaeon Title Aeropyrum( Dissertation_全文 ) Author(s) Daifuku, Takashi Citation 京都大学 Issue Date 2015-03-23 URL https://doi.org/10.14989/doctor.k19034 学位規則第9条第2項により要約公開; 許諾条件により本文 Right は2019-08-01に公開 Type Thesis or Dissertation Textversion ETD Kyoto University 1. General introduction Chapter 1 General introduction Gene repertoires and genome organizations differ between closely related microbial organisms depending on the ecological characteristics of each habitat (Cohan and Koeppel 2008). The cyanobacterial Prochlorococcus spp. account for a significant fraction of primary production in the ocean (Goericke and Welschmeyer 1993) and show physiological features relevant to the different ecological niches within a stratified oceanic water column (Moore et al. 1998; West et al. 2001). The whole-genomic comparisons of the Prochlorococcus spp. strains show gross signatures according to this niche differentiation (Rocap et al. 2003). Alpha-proteobacterium Pelagibacter ubique which belongs to the SAR11 clade in the phylogenetic tree based on the 16S rRNA gene is the most abundant microorganism in the ocean (Morris et al. 2002). The genomes of the SAR11 isolates are highly conserved in the core genes that are common to all strains (Medini et al. 2005) and show synteny (the conservation of DNA sequence and gene order) (Bentley and Parkhill 2004). However, variations exist among genes for phosphorus metabolism, glycolysis, and C1 metabolism, suggesting that adaptive specialization in nutrient resource utilization is important for niche partitioning (Grote et al. 2012). This adaptation at the genomic level was also observed in archaea. The members of the genus Pyrococcus are anaerobic and hyperthermophilic archaea (Fiala and Stetter 1 1.
    [Show full text]
  • DNA Topoisomerase I and DNA Gyrase As Targets for TB Therapy, Drug Discov Today (2016), J.Drudis.2016.11.006
    Drug Discovery Today Volume 00, Number 00 November 2016 REVIEWS GENE TO SCREEN DNA topoisomerase I and DNA gyrase as targets for TB therapy Reviews 1,2 1 3 Valakunja Nagaraja , Adwait A. Godbole , Sara R. Henderson and 3 Anthony Maxwell 1 Department of Microbiology and Cell Biology, Indian Institute of Science, Bangalore 560 012, India 2 Jawaharlal Nehru Centre for Advanced Scientific Research, Bangalore 560064, India 3 Department of Biological Chemistry, John Innes Centre, Norwich Research Park, Norwich NR4 7UH, UK Tuberculosis (TB) is the deadliest bacterial disease in the world. New therapeutic agents are urgently needed to replace existing drugs for which resistance is a significant problem. DNA topoisomerases are well-validated targets for antimicrobial and anticancer chemotherapies. Although bacterial topoisomerase I has yet to be exploited as a target for clinical antibiotics, DNA gyrase has been extensively targeted, including the highly clinically successful fluoroquinolones, which have been utilized in TB therapy. Here, we review the exploitation of topoisomerases as antibacterial targets and summarize progress in developing new agents to target DNA topoisomerase I and DNA gyrase from Mycobacterium tuberculosis. Introduction provides for a certain degree of overlap in their functions. For Although the information content of DNA is essentially indepen- instance, in Escherichia coli, there are four topoisomerases: two dent of how the DNA is knotted or twisted, the access to this type I [topoisomerase (topo) I and topo III] and two type II (DNA information depends on the topology of the DNA. DNA topoi- gyrase and topo IV). In vitro, all four enzymes are capable of DNA somerases are ubiquitous enzymes that maintain the topological relaxation, whereas, in vivo, their roles tend to be more special- homeostasis within the cell during these DNA transaction pro- ized, for example, gyrase introduces negative supercoils, whereas cesses [1–3].
    [Show full text]
  • High Expression of TOP2A Gene Predicted Poor Prognosis of Hepatocellular Carcinoma After Radical Hepatectomy
    992 Original Article High expression of TOP2A gene predicted poor prognosis of hepatocellular carcinoma after radical hepatectomy Hongyu Cai1,2, Xinhua Zhu3, Fei Qian4, Bingfeng Shao2, Yuan Zhou2, Yixin Zhang2, Zhong Chen1,4 1Department of General Surgery, The First Affiliated Hospital of Soochow University, Soochow 215006, China; 2Department of Hepatobiliary Surgery, Nantong Tumor Hospital, Nantong 226361, China; 3Department of Pathological, Affiliated Tumor Hospital of Nantong University, Nantong 226006, China; 4Department of Hepatobiliary Surgery, Affiliated Hospital of Nantong University, Nantong 226001, China Contributions: (I) Conception and design: Z Chen, H Cai; (II) Administrative support: Y Zhang, Y Zhou; (III) Provision of study materials or patients: B Shao; (IV) Collection and assembly of data: H Cai, X Zhu, F Qian; (V) Data analysis and interpretation: H Cai, X Zhu; (VI) Manuscript writing: All authors; (VII) Final approval of manuscript: All authors. Correspondence to: Zhong Chen. Department of General Surgery, The First Affiliated Hospital of Soochow University, Soochow 215006, China. Email: [email protected]. Background: Topoisomerase (DNA) II alpha (TOP2A) is the up-regulated gene of the chromosome aggregation pathway. This gene encodes DNA topoisomerase, which can control and change the topological state of DNA during transcription and replication, participate in chromosome agglutination, separation, and relieve stress from kinking. Abnormally high expression of TOP2A is often associated with active cell proliferation. In studies of breast cancer, endometrial cancer, and adrenal cancer, it was found that high expression of TOP2A suggested a poor prognosis. Methods: A total of 15 pairs of fresh hepatocellular carcinoma (HCC) specimens and adjacent tissues were assembled, and the difference of TOP2A mRNA and protein expression level between tumor and adjacent tissues was detected by RT-PCR and Western blotting analysis, respectively.
    [Show full text]
  • The Thermal Limits to Life on Earth
    International Journal of Astrobiology 13 (2): 141–154 (2014) doi:10.1017/S1473550413000438 © Cambridge University Press 2014. The online version of this article is published within an Open Access environment subject to the conditions of the Creative Commons Attribution licence http://creativecommons.org/licenses/by/3.0/. The thermal limits to life on Earth Andrew Clarke1,2 1British Antarctic Survey, Cambridge, UK 2School of Environmental Sciences, University of East Anglia, Norwich, UK e-mail: [email protected] Abstract: Living organisms on Earth are characterized by three necessary features: a set of internal instructions encoded in DNA (software), a suite of proteins and associated macromolecules providing a boundary and internal structure (hardware), and a flux of energy. In addition, they replicate themselves through reproduction, a process that renders evolutionary change inevitable in a resource-limited world. Temperature has a profound effect on all of these features, and yet life is sufficiently adaptable to be found almost everywhere water is liquid. The thermal limits to survival are well documented for many types of organisms, but the thermal limits to completion of the life cycle are much more difficult to establish, especially for organisms that inhabit thermally variable environments. Current data suggest that the thermal limits to completion of the life cycle differ between the three major domains of life, bacteria, archaea and eukaryotes. At the very highest temperatures only archaea are found with the current high-temperature limit for growth being 122 °C. Bacteria can grow up to 100 °C, but no eukaryote appears to be able to complete its life cycle above *60 °C and most not above 40 °C.
    [Show full text]
  • Tackling the Methanopyrus Kandleri Paradox Céline Brochier*, Patrick Forterre† and Simonetta Gribaldo†
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by PubMed Central Open Access Research2004BrochieretVolume al. 5, Issue 3, Article R17 Archaeal phylogeny based on proteins of the transcription and comment translation machineries: tackling the Methanopyrus kandleri paradox Céline Brochier*, Patrick Forterre† and Simonetta Gribaldo† Addresses: *Equipe Phylogénomique, Université Aix-Marseille I, Centre Saint-Charles, 13331 Marseille Cedex 3, France. †Institut de Génétique et Microbiologie, CNRS UMR 8621, Université Paris-Sud, 91405 Orsay, France. reviews Correspondence: Céline Brochier. E-mail: [email protected] Published: 26 February 2004 Received: 14 November 2003 Revised: 5 January 2004 Genome Biology 2004, 5:R17 Accepted: 21 January 2004 The electronic version of this article is the complete one and can be found online at http://genomebiology.com/2004/5/3/R17 reports © 2004 Brochier et al.; licensee BioMed Central Ltd. This is an Open Access article: verbatim copying and redistribution of this article are permitted in all media for any purpose, provided this notice is preserved along with the article's original URL. ArchaealPhylogeneticsequencedusingrespectively). two phylogeny concatenated genomes, analysis based it of is datasetsthe now on Archaea proteinspossible consisting has ofto been thetest of transcription alternative mainly14 proteins established approach involv and translationed byes in 16S bytranscription rRNAusing machineries: largesequence andsequence 53comparison.tackling ribosomal datasets. the Methanopyrus Withproteins We theanalyzed accumulation(3,275 archaealkandleri and 6,377 of phyparadox comp positions,logenyletely Abstract deposited research Background: Phylogenetic analysis of the Archaea has been mainly established by 16S rRNA sequence comparison. With the accumulation of completely sequenced genomes, it is now possible to test alternative approaches by using large sequence datasets.
    [Show full text]
  • Extremophiles
    Extremophiles These microbes thrive under conditions that would kill other creatures. The molecules that enable extremophiles to prosper are becoming useful to industry by Michael T. Madigan and Barry L. Marrs DEEP-SEA VENT HEAT-LOVING MICROBES (THERMOPHILES AND HYPERTHERMOPHILES) SEA ICE COLD-LOVING MICROBES (PSYCHROPHILES) Methanopyrus kandleri Polaromonas vacuolata thereby increasing efficiency and reduc- magine diving into a refreshingly ing costs. They can also form the basis of cool swimming pool. Now, think entirely new enzyme-based processes. I instead of plowing into water that tially serve in an array of applications. Perhaps 20 research groups in the U.S., is boiling or near freezing. Or consider Of particular interest are the enzymes Japan, Germany and elsewhere are now jumping into vinegar, household am- (biological catalysts) that help extremo- actively searching for extremophiles and monia or concentrated brine. The leap philes to function in brutal circumstanc- their enzymes. Although only a few ex- would be disastrous for a person. Yet es. Like synthetic catalysts, enzymes, tremozymes have made their way into many microorganisms make their home which are proteins, speed up chemical use thus far, others are sure to follow. As in such forbidding environments. These reactions without being altered them- is true of standard enzymes, transform- microbes are called extremophiles be- selves. Last year the biomedical field and ing a newly isolated extremozyme into cause they thrive under conditions that, other industries worldwide spent more a viable product for industry can take from the human vantage, are clearly ex- than $2.5 billion on enzymes for appli- several years.
    [Show full text]
  • DNA Double-Strand Break Formation and Signalling in Response to Transcription-Blocking Topoisomerase I Complexes Agnese Cristini
    DNA double-strand break formation and signalling in response to transcription-blocking topoisomerase I complexes Agnese Cristini To cite this version: Agnese Cristini. DNA double-strand break formation and signalling in response to transcription- blocking topoisomerase I complexes. Cancer. Université Paul Sabatier - Toulouse III, 2015. English. NNT : 2015TOU30276. tel-01878572 HAL Id: tel-01878572 https://tel.archives-ouvertes.fr/tel-01878572 Submitted on 21 Sep 2018 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. 5)µ4& &OWVFEFMPCUFOUJPOEV %0$503"5%&-6/*7&34*5²%&506-064& %ÏMJWSÏQBS Université Toulouse 3 Paul Sabatier (UT3 Paul Sabatier) 1SÏTFOUÏFFUTPVUFOVFQBS Agnese CRISTINI -F Vendredi 13 Novembre 5Jtre : DNA double-strand break formation and signalling in response to transcription-blocking topoisomerase I complexes ED BSB : Biotechnologies, Cancérologie 6OJUÏEFSFDIFSDIF UMR 1037 - CRCT - Equipe 3 "Rho GTPase in tumor progression" %JSFDUFVS T EFʾÒTF Dr. Olivier SORDET 3BQQPSUFVST Dr. Laurent CORCOS, Dr. Philippe PASERO, Dr. Philippe POURQUIER "VUSF T NFNCSF T EVKVSZ Dr. Patrick CALSOU (Examinateur) Pr. Gilles FAVRE (Président du jury) Ai miei genitori… …Grazie Merci aux Dr. Laurent Corcos, Dr. Philippe Pasero et Dr. Philippe Pourquier d’avoir accepté d’évaluer mon travail de thèse et d’avoir été présent pour ma soutenance.
    [Show full text]
  • 4 Metabolic and Taxonomic Diversification in Continental Magmatic Hydrothermal Systems
    Maximiliano J. Amenabar, Matthew R. Urschel, and Eric S. Boyd 4 Metabolic and taxonomic diversification in continental magmatic hydrothermal systems 4.1 Introduction Hydrothermal systems integrate geological processes from the deep crust to the Earth’s surface yielding an extensive array of spring types with an extraordinary diversity of geochemical compositions. Such geochemical diversity selects for unique metabolic properties expressed through novel enzymes and functional characteristics that are tailored to the specific conditions of their local environment. This dynamic interaction between geochemical variation and biology has played out over evolu- tionary time to engender tightly coupled and efficient biogeochemical cycles. The timescales by which these evolutionary events took place, however, are typically in- accessible for direct observation. This inaccessibility impedes experimentation aimed at understanding the causative principles of linked biological and geological change unless alternative approaches are used. A successful approach that is commonly used in geological studies involves comparative analysis of spatial variations to test ideas about temporal changes that occur over inaccessible (i.e. geological) timescales. The same approach can be used to examine the links between biology and environment with the aim of reconstructing the sequence of evolutionary events that resulted in the diversity of organisms that inhabit modern day hydrothermal environments and the mechanisms by which this sequence of events occurred. By combining molecu- lar biological and geochemical analyses with robust phylogenetic frameworks using approaches commonly referred to as phylogenetic ecology [1, 2], it is now possible to take advantage of variation within the present – the distribution of biodiversity and metabolic strategies across geochemical gradients – to recognize the extent of diversity and the reasons that it exists.
    [Show full text]
  • Physical Biology of the Cell
    Physical Biology of the Cell Rob Phillips Jané Kondev Julie Theriot illustrated by Nigel Orme Garland Science Chapter 2 What and Where: Construction Plans for Cells and Organisms “Although not everyone is mindful of it all cell biologists have two cells of in- terest: the one they are studying and Escherichia coli.” - F. Neidhardt Chapter Overview: In Which We Consider the Size of Cells and the Nature of Their Contents Cells come in a dazzling variety of shapes and sizes. Even so, their molecular inventories share many common features, reflecting the underlying biochemical unity of life. In this chapter, we introduce the bacterium Escherichia coli (we will abbreviate this cell type as E. coli throughout the book) as our biological standard ruler. This cell serves as the basis for a first examination of the in- ventory of cells and will permit us to get a sense of the size of cells and the nature of their contents. Indeed, using simple estimates, we will take stock of the genome size, numbers of lipids and proteins and the ribosome content of bacteria. With the understanding revealed by E. coli in hand, we then take a powers-of-ten journey down and up from the scale of individual cells. Our downward journey will examine organelles within cells, macromolecular assem- blies ranging from ribosomes to viruses and then the macromolecules that are the engines of cellular life. Our upward journey from the scale of individual cells will examine a second class of biological structures, namely those resulting from different forms of multicellularity, this time with an emphasis on how cells act together in contexts ranging from bacterial biofilms to the networks of neurons in the brain.
    [Show full text]
  • Phylogenomic Analysis of Proteins That Are Distinctive of Archaea and Its Main Subgroups and the Origin of Methanogenesis Beile Gao and Radhey S Gupta*
    BMC Genomics BioMed Central Research article Open Access Phylogenomic analysis of proteins that are distinctive of Archaea and its main subgroups and the origin of methanogenesis Beile Gao and Radhey S Gupta* Address: Department of Biochemistry and Biomedical Science, McMaster University, Hamilton, L8N3Z5, Canada Email: Beile Gao - [email protected]; Radhey S Gupta* - [email protected] * Corresponding author Published: 29 March 2007 Received: 26 July 2006 Accepted: 29 March 2007 BMC Genomics 2007, 8:86 doi:10.1186/1471-2164-8-86 This article is available from: http://www.biomedcentral.com/1471-2164/8/86 © 2007 Gao and Gupta; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: The Archaea are highly diverse in terms of their physiology, metabolism and ecology. Presently, very few molecular characteristics are known that are uniquely shared by either all archaea or the different main groups within archaea. The evolutionary relationships among different groups within the Euryarchaeota branch are also not clearly understood. Results: We have carried out comprehensive analyses on each open reading frame (ORFs) in the genomes of 11 archaea (3 Crenarchaeota – Aeropyrum pernix, Pyrobaculum aerophilum and Sulfolobus acidocaldarius; 8 Euryarchaeota – Pyrococcus abyssi, Methanococcus maripaludis, Methanopyrus kandleri, Methanococcoides burtonii, Halobacterium sp. NCR-1, Haloquadratum walsbyi, Thermoplasma acidophilum and Picrophilus torridus) to search for proteins that are unique to either all Archaea or for its main subgroups.
    [Show full text]