Genome-Wide Analysis of DNA Methylation in Human Amnion
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Looking for Missing Proteins in the Proteome Of
Looking for Missing Proteins in the Proteome of Human Spermatozoa: An Update Yves Vandenbrouck, Lydie Lane, Christine Carapito, Paula Duek, Karine Rondel, Christophe Bruley, Charlotte Macron, Anne Gonzalez de Peredo, Yohann Coute, Karima Chaoui, et al. To cite this version: Yves Vandenbrouck, Lydie Lane, Christine Carapito, Paula Duek, Karine Rondel, et al.. Looking for Missing Proteins in the Proteome of Human Spermatozoa: An Update. Journal of Proteome Research, American Chemical Society, 2016, 15 (11), pp.3998-4019. 10.1021/acs.jproteome.6b00400. hal-02191502 HAL Id: hal-02191502 https://hal.archives-ouvertes.fr/hal-02191502 Submitted on 19 Mar 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Journal of Proteome Research 1 2 3 Looking for missing proteins in the proteome of human spermatozoa: an 4 update 5 6 Yves Vandenbrouck1,2,3,#,§, Lydie Lane4,5,#, Christine Carapito6, Paula Duek5, Karine Rondel7, 7 Christophe Bruley1,2,3, Charlotte Macron6, Anne Gonzalez de Peredo8, Yohann Couté1,2,3, 8 Karima Chaoui8, Emmanuelle Com7, Alain Gateau5, AnneMarie Hesse1,2,3, Marlene 9 Marcellin8, Loren Méar7, Emmanuelle MoutonBarbosa8, Thibault Robin9, Odile Burlet- 10 Schiltz8, Sarah Cianferani6, Myriam Ferro1,2,3, Thomas Fréour10,11, Cecilia Lindskog12,Jérôme 11 1,2,3 7,§ 12 Garin , Charles Pineau . -
Novel Gene Discovery in Primary Ciliary Dyskinesia
Novel Gene Discovery in Primary Ciliary Dyskinesia Mahmoud Raafat Fassad Genetics and Genomic Medicine Programme Great Ormond Street Institute of Child Health University College London A thesis submitted in conformity with the requirements for the degree of Doctor of Philosophy University College London 1 Declaration I, Mahmoud Raafat Fassad, confirm that the work presented in this thesis is my own. Where information has been derived from other sources, I confirm that this has been indicated in the thesis. 2 Abstract Primary Ciliary Dyskinesia (PCD) is one of the ‘ciliopathies’, genetic disorders affecting either cilia structure or function. PCD is a rare recessive disease caused by defective motile cilia. Affected individuals manifest with neonatal respiratory distress, chronic wet cough, upper respiratory tract problems, progressive lung disease resulting in bronchiectasis, laterality problems including heart defects and adult infertility. Early diagnosis and management are essential for better respiratory disease prognosis. PCD is a highly genetically heterogeneous disorder with causal mutations identified in 36 genes that account for the disease in about 70% of PCD cases, suggesting that additional genes remain to be discovered. Targeted next generation sequencing was used for genetic screening of a cohort of patients with confirmed or suggestive PCD diagnosis. The use of multi-gene panel sequencing yielded a high diagnostic output (> 70%) with mutations identified in known PCD genes. Over half of these mutations were novel alleles, expanding the mutation spectrum in PCD genes. The inclusion of patients from various ethnic backgrounds revealed a striking impact of ethnicity on the composition of disease alleles uncovering a significant genetic stratification of PCD in different populations. -
Comparative Population Genomics Reveals Genetic Basis Underlying Body Size of Domestic Chickens
542 j Journal of Molecular Cell Biology (2016), 8(6), 542–552 doi:10.1093/jmcb/mjw044 Published online October 15, 2016 Article Comparative population genomics reveals genetic basis underlying body size of domestic chickens Ming-Shan Wang1,2, Yong-Xia Huo1,3, Yan Li4, Newton O. Otecko1,2, Ling-Yan Su2,5, Hai-Bo Xu1,2, Shi-Fang Wu1,2, Min-Sheng Peng1,2, He-Qun Liu1,2, Lin Zeng1,2, David M. Irwin1,6,7, Yong-Gang Yao2,5, Dong-Dong Wu1,2,*, and Ya-Ping Zhang1,2,4,* 1 State Key Laboratory of Genetic Resources and Evolution, Yunnan Laboratory of Molecular Biology of Domestic Animals, Kunming Institute of Zoology, Downloaded from Chinese Academy of Sciences, Kunming 650223, China 2 Kunming College of Life Science, University of Chinese Academy of Sciences, Kunming 650204, China 3 College of Life Science, Anhui University, Hefei 230601, China 4 Laboratory for Conservation and Utilization of Bio-Resource, Yunnan University, Kunming 650091, China 5 Key Laboratory of Animal Models and Human Disease Mechanisms of the Chinese Academy of Sciences & Yunnan Province, Kunming Institute of Zoology, Kunming 650223, China http://jmcb.oxfordjournals.org/ 6 Department of Laboratory Medicine and Pathobiology, University of Toronto, Toronto, Ontario M5S 1A8, Canada 7 Banting and Best Diabetes Centre, University of Toronto, Toronto, Ontario M5G 2C4, Canada * Correspondence to: Dong-Dong Wu, E-mail: [email protected]; Ya-Ping Zhang, E-mail: [email protected] Body size is the most important economic trait for animal production and breeding. Several hundreds of loci have been reported to be associated with growth trait and body weight in chickens. -
Development of a Bioinformatics Framework for Identification And
ORIGINAL RESEARCH published: 31 March 2020 doi: 10.3389/fimmu.2020.00380 Development of a Bioinformatics Framework for Identification and Validation of Genomic Biomarkers and Key Immunopathology Processes and Controllers in Infectious and Non-infectious Severe Edited by: Hyundoo Hwang, Inflammatory Response Syndrome BBB Inc., South Korea 1,2† 3† 4 2 Reviewed by: Dong Ling Tong , Karen E. Kempsell , Tamas Szakmany * and Graham Ball Katie Louise Flanagan, 1 RMIT University, Australia Artificial Intelligence Laboratory, Faculty of Engineering and Computing, First City University College, Petaling Jaya, 2 3 Sharvan Sehrawat, Malaysia, School of Science and Technology, Nottingham Trent University, Nottingham, United Kingdom, Public Health 4 Indian Institute of Science Education England, National Infection Service, Porton Down, Salisbury, United Kingdom, Department of Anaesthesia Intensive Care and Research Mohali, India and Pain Medicine, Division of Population Medicine, Cardiff University, Cardiff, United Kingdom Tao Zeng, Shanghai Research Center for Brain Sepsis is defined as dysregulated host response caused by systemic infection, leading Science and Brain-Inspired Intelligence, China to organ failure. It is a life-threatening condition, often requiring admission to an intensive *Correspondence: care unit (ICU). The causative agents and processes involved are multifactorial but are Tamas Szakmany characterized by an overarching inflammatory response, sharing elements in common [email protected] with severe inflammatory response syndrome (SIRS) of non-infectious origin. Sepsis †These authors have contributed presents with a range of pathophysiological and genetic features which make clinical equally to this work differentiation from SIRS very challenging. This may reflect a poor understanding of Specialty section: the key gene inter-activities and/or pathway associations underlying these disease This article was submitted to processes. -
PRODUCT SPECIFICATION Anti-C11orf1 Product Datasheet
Anti-C11orf1 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-C11orf1 Product Number HPA038410 Gene Description chromosome 11 open reading frame 1 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREPHWFP GHQPELDPPRYKCTEKSTYMNSYSKP Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:200 - 1:500 - Retrieval method: HIER pH6 WB (Western Blot) - Working concentration: 0.04-0.4 µg/ml ICC-IF (Immunofluorescence) - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA038410 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. -
Engineered Type 1 Regulatory T Cells Designed for Clinical Use Kill Primary
ARTICLE Acute Myeloid Leukemia Engineered type 1 regulatory T cells designed Ferrata Storti Foundation for clinical use kill primary pediatric acute myeloid leukemia cells Brandon Cieniewicz,1* Molly Javier Uyeda,1,2* Ping (Pauline) Chen,1 Ece Canan Sayitoglu,1 Jeffrey Mao-Hwa Liu,1 Grazia Andolfi,3 Katharine Greenthal,1 Alice Bertaina,1,4 Silvia Gregori,3 Rosa Bacchetta,1,4 Norman James Lacayo,1 Alma-Martina Cepika1,4# and Maria Grazia Roncarolo1,2,4# Haematologica 2021 Volume 106(10):2588-2597 1Department of Pediatrics, Division of Stem Cell Transplantation and Regenerative Medicine, Stanford School of Medicine, Stanford, CA, USA; 2Stanford Institute for Stem Cell Biology and Regenerative Medicine, Stanford School of Medicine, Stanford, CA, USA; 3San Raffaele Telethon Institute for Gene Therapy, Milan, Italy and 4Center for Definitive and Curative Medicine, Stanford School of Medicine, Stanford, CA, USA *BC and MJU contributed equally as co-first authors #AMC and MGR contributed equally as co-senior authors ABSTRACT ype 1 regulatory (Tr1) T cells induced by enforced expression of interleukin-10 (LV-10) are being developed as a novel treatment for Tchemotherapy-resistant myeloid leukemias. In vivo, LV-10 cells do not cause graft-versus-host disease while mediating graft-versus-leukemia effect against adult acute myeloid leukemia (AML). Since pediatric AML (pAML) and adult AML are different on a genetic and epigenetic level, we investigate herein whether LV-10 cells also efficiently kill pAML cells. We show that the majority of primary pAML are killed by LV-10 cells, with different levels of sensitivity to killing. Transcriptionally, pAML sensitive to LV-10 killing expressed a myeloid maturation signature. -
Biomedical Robots. Application to Translational Medicine
Biomedical robots. Application to translational medicine. Enrique J. deAndrés-Galiana Supervisors: Prof. Juan Luis Fernández-Martínez & Prof. Oscar Luaces This dissertation is submitted under the PhD program of Mathematics and Statistics May 2016 RESUMEN DEL CONTENIDO DE TESIS DOCTORAL 1.- Título de la Tesis Español/Otro Idioma: Inglés: Diseño de robots biomédicos. Aplicaciones en Biomedical robots. Application to translational medicina traslacional. medicine. 2.- Autor Nombre: Enrique Juan de Andrés Galiana DNI/Pasaporte/NIE: Programa de Doctorado: Matemáticas y Estadística. Órgano responsable: Departamento de Matemáticas. RESUMEN (en español) Esta tesis trata sobre el análisis y diseño de robots biomédicos y su aplicación a la medicina traslacional. Se define un robot biomédico como el conjunto de técnicas provenientes de la matemática aplicada, estadística y ciencias de la computación capaces de analizar datos biomédicos de alta dimensionalidad, aprender dinámicamente de dichos datos, extraer nuevo BIS - conocimiento e hipótesis de trabajo, y finalmente realizar predicciones con su incertidumbre asociada, cara a la toma de decisiones biomédicas. Se diseñan y analizan diferentes algorit- 010 - mos de aprendizaje, de reducción de la dimensión y selección de atributos, así como técnicas de optimización global, técnicas de agrupamiento no supervisado, clasificación y análisis de VOA incertidumbre. Dichas metodologías se aplican a datos a pie de hospital y de expresión génica - en predicción de fenotipos para optimización del diagnóstico, pronóstico, tratamiento y análisis de toxicidades. MAT - Se muestra que es posible establecer de modo sencillo el poder discriminatorio de las variables FOR pronóstico, y que dichos problemas de clasificación se aproximan a un comportamiento linealmente separable cuando se reduce la dimensión al conjunto de variables principales que definen el alfabeto del problema biomédico y están por tanto relacionadas con su génesis. -
(12) United States Patent (10) Patent No.: US 8,148,129 B2 Frankel Et Al
US008148129B2 (12) United States Patent (10) Patent No.: US 8,148,129 B2 Frankel et al. (45) Date of Patent: Apr. 3, 2012 (54) GENERATION OF POTENT DOMINANT 6,824,978 B1 1 1/2004 Cox, III et al. NEGATIVE TRANSCRIPTIONAL 6,933,113 B2 8, 2005 Case et al. 6,979,539 B2 12/2005 Cox, III et al. INHIBITORS 7,013,219 B2 3/2006 Case et al. 7,070,934 B2 7/2006 Cox, III et al. (75) Inventors: Alan Frankel, Mill Valley, CA (US); 7,163,824 B2 1/2007 Cox, III et al. Robert Nakamura, San Francisco, CA 7,220,719 B2 5/2007 Case et al. (US); Chandreyee Das, Brookline, MA 7,235,354 B2 6/2007 Case et al. 7,262,054 B2 8/2007 Jamieson et al. (US); Ivan D’Orso, San Francisco, CA 7,273,923 B2 9/2007 Jamieson et al. (US); Jocelyn Grunwell, San Mateo, 2003, OO82552 A1* 5, 2003 Wolffe et al. ..................... 435/6 CA (US) (73) Assignee: The Regents of the University of OTHER PUBLICATIONS California, Oakland, CA (US) Cramer et al., Coupling of Transcription with Alternative Splicing: RNA Pol II Promoters Modulate SF2. ASF and 9G8 Effects on an (*) Notice: Subject to any disclaimer, the term of this Exonic Splicing Enhancer, Molecular Cell, 1999, 4:251-258.* patent is extended or adjusted under 35 Cama-Carvalho et al., Nucleocytoplasmic shuttling of heterodimeric U.S.C. 154(b) by 806 days. splicing factor U2AF, JBC. Published on Dec. 15, 2000 as Manu script M008759200.* (21) Appl. No.: 11/765,592 Rosonina et al., Gene Expression: The Close Coupling of Transcrip tion and Splicing, Current Biology, vol. -
(12) Patent Application Publication (10) Pub. No.: US 2013/0274315 A1 Birrer Et Al
US 201302743 15A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2013/0274315 A1 Birrer et al. (43) Pub. Date: Oct. 17, 2013 (54) PRO-ANGIOGENC GENES IN OVARAN (60) Provisional application No. 60/901,455, filed on Feb. TUMORENDOTHELIAL CELL, SOLATES 14, 2007. (71) Applicants: The University of Texas MD Anderson Publication Classification Cancer Center, Houston, TX (US); The Government of the U.S.A as (51) Int. Cl. represented by the Secretary of the CI2O I/68 (2006.01) Department of He, Rockville, MD (US) (52) U.S. Cl. CPC .................................... CI2O I/6886 (2013.01) (72) Inventors: Michael J. Birrer, Mt. Airy, MD (US); USPC ............... 514/44A: 435/6.12: 506/9: 435/7.1 Tomas A. Bonome, Washington, DC (US); Anil Sood, Pearland, TX (US); (57) ABSTRACT Chunhua Lu, Missouri City, TX (US) A gene profiling signature for ovarian tumor endothelial cells is disclosed herein. The gene signature can be used to diag nosis or prognosis an ovarian tumor, identify agents to treat an (21) Appl. No.: 13/863,219 ovariantumor, to predict the metastatic potential of an ovarian tumor and to determine the effectiveness of ovarian tumor (22) Filed: Apr. 15, 2013 treatments. Thus, methods are provided for identifying agents that can be used to treat ovarian cancer, for determining the effectiveness of an ovarian tumor treatment, or to diagnose or Related U.S. Application Data prognose an ovarian tumor. Methods of treatment are also (60) Division of application No. 12/541,729, filed on Aug. disclosed which include administering a composition that 14, 2009, now Pat. -
PRODUCT SPECIFICATION Anti-C11orf1 Product Datasheet
Anti-C11orf1 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-C11orf1 Product Number HPA057519 Gene Description chromosome 11 open reading frame 1 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKF FQYGWRCTTNENTYSNRTLMGNWNQ Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended ICC-IF (Immunofluorescence) Applications - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA057519 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price. -
Identification of Biomarkers, Pathways and Potential Therapeutic Targets for Heart Failure Using Bioinformatics Analysis
bioRxiv preprint doi: https://doi.org/10.1101/2021.08.05.455244; this version posted August 6, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Identification of biomarkers, pathways and potential therapeutic targets for heart failure using bioinformatics analysis Basavaraj Vastrad1, Chanabasayya Vastrad*2 1. Department of Biochemistry, Basaveshwar College of Pharmacy, Gadag, Karnataka 582103, India. 2. Biostatistics and Bioinformatics, Chanabasava Nilaya, Bharthinagar, Dharwad 580001, Karnataka, India. * Chanabasayya Vastrad [email protected] Ph: +919480073398 Chanabasava Nilaya, Bharthinagar, Dharwad 580001 , Karanataka, India bioRxiv preprint doi: https://doi.org/10.1101/2021.08.05.455244; this version posted August 6, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Heart failure (HF) is a complex cardiovascular diseases associated with high mortality. To discover key molecular changes in HF, we analyzed next-generation sequencing (NGS) data of HF. In this investigation, differentially expressed genes (DEGs) were analyzed using limma in R package from GSE161472 of the Gene Expression Omnibus (GEO). Then, gene enrichment analysis, protein-protein interaction (PPI) network, miRNA-hub gene regulatory network and TF-hub gene regulatory network construction, and topological analysis were performed on the DEGs by the Gene Ontology (GO), REACTOME pathway, STRING, HiPPIE, miRNet, NetworkAnalyst and Cytoscape. Finally, we performed receiver operating characteristic curve (ROC) analysis of hub genes. A total of 930 DEGs 9464 up regulated genes and 466 down regulated genes) were identified in HF.