DOCSLIB.ORG

(12) United States Patent (10) Patent No.: US 6,699,654 B1 Mcleod Et Al

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
(12) United States Patent (10) Patent No.: US 6,699,654 B1 Mcleod Et Al USOO6699654B1 (12) United States Patent (10) Patent No.: US 6,699,654 B1 McLeod et al. (45) Date of Patent: Mar. 2, 2004 (54) ANTIMICROBIAL AGENTS DIAGNOSTIC (51) Int. Cl." ........................... C12O 1/68; G01N 33/53 REAGENTS, AND WACCINES BASED ON (52) U.S. Cl. ................................. 435/4; 435/6; 435/7.1 UNIQUE APICOMPLEXAN PARASITE (58) Field of Search .................................. 435/4, 6, 7.1 COMPONENTS Primary Examiner Sean McGarry (76) Inventors: Rima L. W. McLeod, 5729 Kimbark, (74) Attorney, Agent, or Firm-Alice O. Martin; Barnes & Chicago, IL (US) 60637; Craig W. Thornburg Roberts, 17 Kirklee Circus, Kirklee, Glasgow, G12 OTW Scotland (GB); (57) ABSTRACT Fiona Roberts, 17 Kirklee Circus, This invention relates uses of components of plant-like Kirklee, Glasgow, G12 OTW Scotland metabolic pathways not including psbA or PPi phosphof (GB); Jennifer J. Johnson, 13 Penny ructokinase and not generally operative in animals or Ct., Bolingbrook, IL (US) 60440; encoded by the plastid DNA, to develop compositions that Laurens Mets, 814 Sheridan Rd., interfere with Apicomplexan growth and Survival. Compo Wilmette, IL (US) 60091 nents of the pathways include enzymes, transit peptides and nucleotide Sequences encoding the enzymes and peptides, or (*) Notice: Subject to any disclaimer, the term of this promoters of these nucleotide Sequences to which patent is extended or adjusted under 35 antibodies, antisense molecules and other inhibitors are U.S.C. 154(b) by 0 days. directed. Diagnostic and therapeutic reagents and vaccines are developed based on the components and their inhibitors. (21) Appl. No.: 09/103,331 (22) Filed: Jun. 23, 1998 9 Claims, 16 Drawing Sheets U.S. Patent Mar. 2, 2004 Sheet 1 of 16 US 6,699,654 B1 2 FLASD Giullamate 4 RNAGlu Giutamate - RNAGlu Glycine . Succinyl CoA COg Glutamate 1-Semialdehyde CoA GSA am no. transferasc At - Porphobilinogen (Plants, Algae and Bacteria) (Mannals Protoporphyrin X HEME -71 via/ /fs GOOOO -- - SCOOO 4OOOO 3OOOO 2OOOO OOOO Gabaculine (mM) U.S. Patent Mar. 2, 2004 Sheet 2 of 16 US 6,699,654 B1 54000 8000 -O- Mediurn 42000 - "" ....... Gabaculine 36000 30000 24000 8000 2000 6000 Days Post infection PtCS FA Y ACS ACETY COA re- 2 A -1N We P N MALATE OXAOACEATE CoA. Sh CoA.S + Yr 1. GLYOXYATE CRATE SOCRATE C1 AC OS (SUCCtrl ATE) U.S. Patent Mar. 2, 2004 Sheet 3 of 16 US 6,699,654 B1 4OOOO . 3OOOO i. 2OOOO OOOO Nitochondri On RR Cytochiotic b Cytochfornc ef Oehydrogenase Cytochromc c oxidase ther the Succinale Oehydrogenase y I7-y mAid H. At SUCCIf Ata FUMARATE CRC ACC CYCE MARX could also be in 1ho plasid --- U.S. Patent Mar. 2, 2004 Sheet 4 of 16 US 6,699,654 B1 70000 GOOOO 50000 40000 30000 2OOOO OOOO THE SHKMATE pAHWAY posphoenolpy fit WATE t gray trios. 4. Pics. Phi Are credo t SHKATE SKAEkou.S.E(EPsF) gets Costa Of p- -2. SY-ASE Nz. 2/. A CHORSATE 6. Yoo Yi EThe Y Yo RoPTE Rt Hor Hospha E .A. a. ooe NZOATE ..okyor oxYBEZOATE -1 -- fotate C-ry of Oa als fied JCASE O ET TER f:YOROFOCATE U3, U(OE U.S. Patent Mar. 2, 2004 Sheet S of 16 US 6,699,654 B1 CPM --- n a e co C s o s o C C) d D g C RH-SEESSEESS - P M S. Mcdium E.SE SESSEE No R - J. ~2. A3 U.S. Patent Mar. 2, 2004 Sheet 6 of 16 US 6,699,654 B1 2.2. 62d co OO 3CO tood thrup (relrwto) 2%. 42 120 u so O s 5 60 AO A. O-5 10-4 10-3 10-2 10-1 100 101 PABA or FA (uM) U.S. Patent Mar. 2, 2004 Sheet 7 of 16 US 6,699,654 B1 ufco 4 3 2. PLASTD 2 s la e.scAf Henle Synthesis Patil'? - sk?: Shikiniate Pathway Kisse GLAA Seanese SKA.OST: elena ) SY AS2 SAMCSSE GABACULINE C wiAMNK s moduce CSA. EROEach SYASE 8-O-Witc. CEAN Ris Auxis-a-AOMAC AMOACOS scos, ATE n-AMOBENZOATE YASE POPOLOGE YfoxY -- DYoore it 3-DIYonoxY(Elizon PHOSPA 4 Y(XY2O: OO offs FOLAre Ori' (ii. AAS CPAREANC f 3.Craft -a. YOOXO, ties Yode Alternative Generation Of Energy TRAMBANE --- SPACE (Goautott)----- - SNN: I? Y -- Cytochroric in a Tritta cities Cytocifolie y AO succring rut. A? Alf ARX 4 CYCLES )f M S- M TO CHOND RON SUCCNAE Glyoxylate Cycle NA SOCTRAELYASE CONCAC M tory GLYCXYATE CTRATE CoA.S. MAAEk OXALOACETAEA COASE { NN- -/ SACTY CoA-a- FATY ACOS ---POS U.S. Patent Mar. 2, 2004 Sheet 8 of 16 US 6,699,654 B1 s - E - - - - - - - - SHAM (1g/ml) - 8-hydroxyquinoline NPMG Gabaculine E. O.2% etoh added (ig/ml) (ug/ml) (g/ml) U.S. Patent Mar. 2, 2004 Sheet 9 of 16 US 6,699,654 B1 32OOO -- Mediurn -- 28000 - - - - ... ... GabaCuline 24000 ----O---- P/S / 2OOOO M-1 7 6000 - -- ufc2. -- g 12000 - 8OOO 4OOO g. O't!-------............. -O O T- - 5 6 7 S Days Post infection OO -- CO-RO SO MG 3. FYIR/PMG c 60 r-y S. vf?2.r 5 of 40 SS 2O O O 2 4 6 8 O 12 4 16 DAYS POS INFECTION U.S. Patent Mar. 2, 2004 Sheet 12 of 16 US 6,699,654 B1 fa. 7O (7) T. gondii MSSYGAALRI Synechocystis . -- - - - - - -a - - - - - - - - - - - - - - - - - - - - - - - 1 1- - - MGNTFGSLFRIT 2 S. lycopersicura MASS4LTKOFLGAPFSS FGSGQQPSKLCSSNLRFPTE:RSOPKRLEIOAAGNTFGNYFRVT O . ar. r. r or - w w a ser ---a w- (- www or r r a ur or - a u a 1- - - - - - - - - - - we a MSTFGHYFRVT ... crassa H. influenza - - - - - - - - - - - - - - - - - - - - - MAGNTIGOLFRVF 3. S. cerevisae . - - - - - as a ex a- a - a - w - - - - - -s-- - - - - - as all as an as - a- or -- a-- a-- a--- we - MSTFGKLFRVT T. gondii TFGESGSAWGCIDGLPPRLPLSWEEVOPOLNRRRPGQGPLSTQRREKDRVNLSGVEd Syechocystis TFGESHGGGVGVIIDGCPPRLEISPEEICVDLDRRRPGOSKITTPRKEADOCEILSGWFE 72 S. lycopersicum TFGESHGGGWGCIDGCPPRLPLSESDMCWELDRRRPGOSRITTPRKETDTCKSSGTA 20 N. crassa TYGESHCKSVGCIVDGVPPGMELTEDDIQPQ-TRRRPGQSAITTPRDEKDRVIIOSGTEF H. influenza IFGESHGIALGCIVDGVPPNLELSEKDIOPDLDRRKPGTSRYTTPRREDDEVOILSGVFE 3 S. cerevisae TYgESHCKSVGCIVDGVPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEKDRVEIQSGTEF T. gondii GYTLGTPA-LV.NEDRRPODYH- -AAWPRPGHGDFTYHAKYHIHAKSGGGRSSARET 129 Syne chocystis GKTLGTPIAILVRNKDARSODYN -- EMAWKYRPSHADATYEAKYGIRNOGGGRSSARET 130 ... lycopersicum, GLTTGSPIKVEVPNTDQRGJDYS- - EMSI.AYRPSHADATYDFKYGVRSVQGGGSRSSARET 8 aSs a GvTLGTPIGMLVMNEDQPPKDYGNKT-1DIY PRPSHADWTYLEKYGVKASSGGGRSSARET 3. influenza GKTTGTSIGM 1 INGOORSQDYG-- DIKORFRGHADFTYQQKYGIRDYRGGGRSSARET 3. ... cerevisae gKTLGTPIAMMIKNEDQRPHDYS--DMDKFPRPSHADFTYSEKYGIKASSGGGRASARET 29 T. gondii LARWAAGAVWEKLG(4YGTSFTAWCQVGDWSWPRSLRRKEROPPTRODVDRLGVWRV 89 Synechocystis IGRWAAGAIAKKLAOFNGWEIWAYWKSIOOIEA - - - - - - - - - - - - - - - - - - - - - - - - - - 6 4. S. lycoper sic util IGRWAAGAVAKKLKLYSGTEILAWSOVWWLP- - - - - - - - - - - - - - - - - - - - - - - - - 23 is classa IGRVAGAIAEKY LKPRYGVEIWAFVSSVGSEHLFPPTAEHPSPST - - - - - - - - - - - - - - 7 ... influenza AMRWAAGAACKYLREHFGEWRGFLSOIGIKAP- - - - - - - - - - - - - - - - - - - - - - - - 67 S. cere visa e IGRVAsgi, IAEKFAQNSNVEIVAFVTOIGEIKMNR - - - - - - - - - - - - - - - - - - - - - - - - 65 T. gondii SpgTTFLDANRLYDERGEELVEEEDKNRRRLFGVDNTPGETWETRCPCPSTFWRM 249 Syne chocystis - - - - - -w TVSNTVTLEOVES - - - - - - - - - - - - - - - - - - - - - - - - - IWRCPDEECAE-i 92 S. lycopersicum - - - - a EDLVDtNOWLEOESN - - - - - - - - - - - - - - - - - - - - - - - - - WRCPNPEYAEK, 243 N. crassa - - - NEF.K.WSTRETWOSFL - - - - - - - - - - - - - - - - - - - - - - - - PWRCPOENKR 20 H. influenza . m . QKVGQIoteKWNSN- - - - - - - - - - - - - - - - - - - - - - - - - PFFCOESRVEKF 94 S. cerevisa e DSFDPEFQHLLNTITREKVDSMG - - - - - - - - - - - - - - - - - - - - - - - - PIRCEDASVAGL 2. T. gondii AWKIOTRSLGDSIGGCISGAIWRPLGGEPCFDKWEAELAKAM-1SLPATKCFEIGOGF 9 Synechocystis IERIDQVLROKDSIGGVWECAIRNAPKGLGEPWFDKLEADLJAKAME4SLPATKGFEFGSGF 2S2 S. lycopersicut IGADWRWRGOSWGGVWTCIWRNWRGLGTPWFDKLEAELAKACMSLPATKGFEFGSGF 303 ... crassa EDLI TKFRDSDSIGGTWCVIRWPSGGEPAFDKLEAMLAE-SIAKGFEWGSGF 20 H. in fuerza CEL REKKEGOS GAKLWAE:WWGGEWFORADAA-GINAWKGWE GOCSF 25.4 S. cerevisae 2 sl O. F. G. O. (2) - - - U.S. Patent Mar. 2, 2004 Sheet 13 of 16 US 6,699,654 B1 To FG 1 O ( ) . T. gondii ASWTLRGSEHNDRFIPFERASCSFSESAASTIKHERDGCSAFTLSRERASDGRTTSRHEE 369 Syne chocyst is AGTLLTGSQHNDEYYLDEAGER- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 27 S S. lycopers cut AGTFMTGSEHNDEFFIDEHDOIR- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 326 ... Crassa (SGCEWPGSHNDPFWSAENTEIPPSWAAS GAARGI. - - - - - - - - - - - - - - - - - - - - - - - 3 O 6 i. influenza AWWEORGSEHRDEMTPNGFESN- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 27 7 S. cerevisa e QGVSVPSSKHNDPFYFEKETNR - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - 283 T. gondii EVERGRERIORDTLHVTGVDOONG SEDSVRYTSKSEASI TRLSGNAASGGAPVCRIPLG 429 Syne chocystis S. lycopersicum N. crassa H. influenza S. cerev is ae T. gondii EGWRIRCGSNNAGGTLAGITSGENIFFRVAFKPWSSIGLECIETADFA-GE-1OLAVKGRE 488 Synechocystis . TRTNRSGGWOGGESNGEP2-1RAFKPTATIGOEOTWSNI-GEETTLAAKGRH 32 S. lycopersicum - - - - - - TKTNRSGGIOGGISNGEI IN-RWAFKPTSTIARKOHTVSRD - KHETELIARGRI 379 ... crassa PRPKLTTKTNFSGGIQGGISNGAPIYFRVGFKPAATIGQEQTTATYDGTSEGVLAAKGRH 366 H. influenza ... - - - - - - - AGGILGGISSGOp. IATIALKPTSSITIPGRSINLN-GEAVEVVTKGRH 325 S. cerevisae - - - - LRTKTNNSGGVOGGISNGENIYFSVPFKSVATISQEQKTATYD-GEEGILAAKGRH 33B T. gondii DipCVLPRAPPLWESMAALVIGDLCLRQRAREGPHPLLVLQHSGCPSC - - - - - - - - - - - - S35 Syne chocystis DipCVLPRAWMVEAMAALVLCDHLLRFQAQCKTI - - - - - - - - - - - - - - - - - - - - - - - - - - 362 S. lycopersicum DPCVVPRAWPMVEA-IVALVI,VDQLMTOYAQCi-LFPVNLTLOEPLOPSTTKSA- - - - - - - - 43. N. crassa DpSwVPRAVPEVEAMAALVIMDAVLAHEARVTAKSLLPPLKQTINSGKDTVGNGVSENVQ 426 H. influenza DpCVGIRAWPIAEAMVAIVLLDHLLRFKAOCK- - - - - - - - - - - - - - - - - - - - - - - - - - - - 3S) S. cerevisa e ppAvT PRAIPIVEA4TALVLARALLIOKARDFSRSVV):- - - - - - - - - - - - - - - - - - - - - - 36 T. gondii
Load more

Recommended publications
  • ( 12 ) United States Patent
    US010167477B2 (12 ) United States Patent ( 10 ) Patent No. : US 10 , 167, 477 B2 Pharkya (45 ) Date of Patent : Jan . 1 , 2019 ( 54 ) MICROORGANISMS AND METHODS FOR 5 , 143, 834 A 9 / 1992 Glassner et al . 5 , 168 ,055 A 12 / 1992 Datta et al. THE PRODUCTION OF ANILINE 5 , 168 ,056 A 12 / 1992 Frost .. .. 435 / 472 5 , 173 ,429 A 12/ 1992 Gaddy et al. (71 ) Applicant: Genomatica , Inc. , San Diego , CA (US ) 5 , 182 , 199 A 1 / 1993 Hartley 5 , 192 ,673 A 3 / 1993 Jain et al . (72 ) Inventor : Priti Pharkya, San Diego , CA (US ) 5 , 403 , 721 A 4 / 1995 Ward , Jr . et al. 5 ,413 , 922 A 5 / 1995 Matsuyama et al. 5 ,416 , 020 A 5 / 1995 Severson et al . (73 ) Assignee : GENOMATICA , INC . , San Diego, CA 5 ,457 , 040 A 10 / 1995 Jarry et al . (US ) 5 ,478 , 952 A 12 / 1995 Schwartz 5 ,487 ,987 A 1 / 1996 Frost et al. ( * ) Notice : Subject to any disclaimer, the term of this 5 , 504 ,004 A 4 / 1996 Guettler et al. patent is extended or adjusted under 35 5 , 521 ,075 A 5 / 1996 Guettler et al . U . S . C . 154 ( b ) by 0 days. 5 ,573 , 931 A 11/ 1996 Guettler et al. 5 ,616 , 496 A 4 / 1997 Frost et al. 5 ,686 ,276 A 11 / 1997 Lafend et al . ( 21 ) Appl. No. : 15 /914 , 308 5 ,700 , 934 A 12 / 1997 Wolters et al. 5 ,770 ,435 A 6 / 1998 Donnelly et al . (22 ) Filed : Mar. 7 , 2018 5 , 807 , 722 A 9 / 1998 Gaddy et al .
    [Show full text]
  • Nucleophile Specificity in Anthranilate Synthase, Aminodeoxychorismate Synthase, Isochorismate Synthase, and Salicylate Synthase Kristin T
    Biochemistry 2010, 49, 2851–2859 2851 DOI: 10.1021/bi100021x Nucleophile Specificity in Anthranilate Synthase, Aminodeoxychorismate Synthase, Isochorismate Synthase, and Salicylate Synthase Kristin T. Ziebart and Michael D. Toney* Department of Chemistry, University of California, Davis, California 95616 Received January 7, 2010; Revised Manuscript Received February 15, 2010 ABSTRACT: Anthranilate synthase (AS), aminodeoxychorismate synthase (ADCS), isochorismate synthase (IS), and salicylate synthase (SS) are structurally homologous chorismate-utilizing enzymes that carry out the first committed step in the formation of tryptophan, folate, and the siderophores enterobactin and mycobactin, respectively. Each enzyme catalyzes a nucleophilic substitution reaction, but IS and SS are uniquely able to employ water as a nucleophile. Lys147 has been proposed to be the catalytic base that activates water for nucleophilic attack in IS and SS reactions; in AS and ADCS, glutamine occupies the analogous position. To probe the role of Lys147 as a catalytic base, the K147Q IS, K147Q SS, Q147K AS, and Q147K ADCS mutants were prepared and enzyme reactions were analyzed by high-performance liquid chromatography. Q147K AS employs water as a nucleophile to a small extent, and the cognate activities of K147Q IS and K147Q SS were reduced ∼25- and ∼50-fold, respectively. Therefore, Lys147 is not solely responsible for activation of water as a nucleophile. Additional factors that contribute to water activation are proposed. A change in substrate preference for K147Q SS pyruvate lyase activity indicates Lys147 partially controls SS reaction specificity. Finally, we demonstrate that AS, ADCS, IS, and SS do not possess choris- mate mutase promiscuous activity, contrary to several previous reports.
    [Show full text]
  • Supplementary Informations SI2. Supplementary Table 1
    Supplementary Informations SI2. Supplementary Table 1. M9, soil, and rhizosphere media composition. LB in Compound Name Exchange Reaction LB in soil LBin M9 rhizosphere H2O EX_cpd00001_e0 -15 -15 -10 O2 EX_cpd00007_e0 -15 -15 -10 Phosphate EX_cpd00009_e0 -15 -15 -10 CO2 EX_cpd00011_e0 -15 -15 0 Ammonia EX_cpd00013_e0 -7.5 -7.5 -10 L-glutamate EX_cpd00023_e0 0 -0.0283302 0 D-glucose EX_cpd00027_e0 -0.61972444 -0.04098397 0 Mn2 EX_cpd00030_e0 -15 -15 -10 Glycine EX_cpd00033_e0 -0.0068175 -0.00693094 0 Zn2 EX_cpd00034_e0 -15 -15 -10 L-alanine EX_cpd00035_e0 -0.02780553 -0.00823049 0 Succinate EX_cpd00036_e0 -0.0056245 -0.12240603 0 L-lysine EX_cpd00039_e0 0 -10 0 L-aspartate EX_cpd00041_e0 0 -0.03205557 0 Sulfate EX_cpd00048_e0 -15 -15 -10 L-arginine EX_cpd00051_e0 -0.0068175 -0.00948672 0 L-serine EX_cpd00054_e0 0 -0.01004986 0 Cu2+ EX_cpd00058_e0 -15 -15 -10 Ca2+ EX_cpd00063_e0 -15 -100 -10 L-ornithine EX_cpd00064_e0 -0.0068175 -0.00831712 0 H+ EX_cpd00067_e0 -15 -15 -10 L-tyrosine EX_cpd00069_e0 -0.0068175 -0.00233919 0 Sucrose EX_cpd00076_e0 0 -0.02049199 0 L-cysteine EX_cpd00084_e0 -0.0068175 0 0 Cl- EX_cpd00099_e0 -15 -15 -10 Glycerol EX_cpd00100_e0 0 0 -10 Biotin EX_cpd00104_e0 -15 -15 0 D-ribose EX_cpd00105_e0 -0.01862144 0 0 L-leucine EX_cpd00107_e0 -0.03596182 -0.00303228 0 D-galactose EX_cpd00108_e0 -0.25290619 -0.18317325 0 L-histidine EX_cpd00119_e0 -0.0068175 -0.00506825 0 L-proline EX_cpd00129_e0 -0.01102953 0 0 L-malate EX_cpd00130_e0 -0.03649016 -0.79413596 0 D-mannose EX_cpd00138_e0 -0.2540567 -0.05436649 0 Co2 EX_cpd00149_e0
    [Show full text]
  • Biosynthesis and Physiology of Coenzyme Q in Bacteria. Laurent Aussel, Fabien Pierrel, Laurent Loiseau, Murielle Lombard, Marc Fontecave, Frédéric Barras
    Biosynthesis and physiology of coenzyme Q in bacteria. Laurent Aussel, Fabien Pierrel, Laurent Loiseau, Murielle Lombard, Marc Fontecave, Frédéric Barras To cite this version: Laurent Aussel, Fabien Pierrel, Laurent Loiseau, Murielle Lombard, Marc Fontecave, et al.. Biosyn- thesis and physiology of coenzyme Q in bacteria.. Biochimica biophysica acta (BBA) - Bioenergetics, Elsevier, 2014, 1837 (7), pp.1004-1011. 10.1016/j.bbabio.2014.01.015. hal-01077983 HAL Id: hal-01077983 https://hal.archives-ouvertes.fr/hal-01077983 Submitted on 2 Jan 2017 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Biochimica et Biophysica Acta 1837 (2014) 1004–1011 Contents lists available at ScienceDirect Biochimica et Biophysica Acta journal homepage: www.elsevier.com/locate/bbabio Review Biosynthesis and physiology of coenzyme Q in bacteria☆ Laurent Aussel a,FabienPierrelb, Laurent Loiseau a,MurielleLombardc, Marc Fontecave c, Frédéric Barras a,⁎ a Laboratoire de Chimie Bactérienne, UMR 7283 Aix-Marseille Université - CNRS, Institut de Microbiologie de la Méditerranée, 31 Chemin Joseph Aiguier 13009 Marseille, France b Laboratoire de Chimie et Biologie des Métaux, UMR 5249 CEA - Université Grenoble I - CNRS, 17 Rue des Martyrs, 38054 Grenoble Cedex France c Laboratoire de Chimie des Processus Biologiques, UMR 8229 CNRS, UPMC, Collège de France, 11 Place Marcellin Berthelot, 75231 Paris Cedex 05 France article info abstract Article history: Ubiquinone, also called coenzyme Q, is a lipid subject to oxido-reduction cycles.
    [Show full text]
  • Biosynthesis and Applications of Prenylquinones
    島根大学学術情報リポジトリ SWAN Shimane University Web Archives of kNowledge Title Biosynthesis and Applications of Prenylquinones. Author(s) Makoto Kawamukai Journal Bioscience, Biotechnology, and Biochemistry Volume 82, 2018 - Issue 6: Special Issue: Recent advances in isoprenoid studies Published 19 Feb 2018 URL https://doi.org/10.1080/09168451.2018.1433020 この論文は出版社版でありません。 引用の際には出版社版をご確認のうえご利用ください。 1 Biosynthesis and applications of prenylquinones 2 3 4 Makoto Kawamukai 5 6 7 Department of Life Science and Biotechnology, Faculty of Life and Environmental 8 Science, Shimane University, 1060 Nishikawatsu, Matsue 690-8504, Japan. 9 10 11 Corresponding author: Makoto Kawamukai 12 E-mail: [email protected]. 13 Telephone: 81-852-32-6583 14 Fax: 81-852-32-6092 15 16 17 18 19 Funding 20 This work was supported by a Grant-in-Aid from the Ministry of Education, Culture, 21 Sports, Science, and Technology of Japan (No. 17H03806). 22 23 Disclosure statement 24 The author declares that there is no conflict of interests. 25 1 26 Abbreviations 27 DHFL, dehypoxanthinylfutalosine 28 DHNA, 1,4-dihydroxy-2-naphthoate 29 DMK, demethylmenaquinone 30 DMAPP, dimethylallyl pyrophosphate 31 DXP, 1-deoxy-D-xylulose-5-phosphate 32 FPP, farnesyl pyrophosphate 33 GPP, geranyl pyrophosphate 34 GGPP, geranylgeranyl pyrophosphate 35 HGA, homogentisate 36 IPP, isopentenyl pyrophosphate 37 MEP, 2C-methyl-D-erythritol-4-phosphate 38 MK, menaquinone 39 MVA, mevalonate 40 PDS, prenyl diphosphate synthase 41 PHB, p-hydroxybenzoate 42 PhQ, phylloquinone 43 PQ, plastoquinone 44 RQ, rhodoquinone 45 UQ, ubiquinone 46 2 47 Abstract 48 Prenylquinones are isoprenoid compounds with a characteristic quinone structure and 49 isoprenyl tail that are ubiquitous in almost all living organisms.
    [Show full text]
  • Building Microbial Factories for The
    Contents lists available at ScienceDirect Metabolic Engineering journal homepage: www.elsevier.com/locate/meteng Building microbial factories for the production of aromatic amino acid pathway derivatives: From commodity chemicals to plant-sourced natural products ∗ Mingfeng Caoa,b,1, Meirong Gaoa,b,1, Miguel Suásteguia,b, Yanzhen Meie, Zengyi Shaoa,b,c,d, a Department of Chemical and Biological Engineering, Iowa State University, USA b NSF Engineering Research Center for Biorenewable Chemicals (CBiRC), Iowa State University, USA c Interdepartmental Microbiology Program, Iowa State University, USA d The Ames Laboratory, USA e School of Life Sciences, No.1 Wenyuan Road, Nanjing Normal University, Qixia District, Nanjing, 210023, China ARTICLE INFO ABSTRACT Keywords: The aromatic amino acid biosynthesis pathway, together with its downstream branches, represents one of the Aromatic amino acid biosynthesis most commercially valuable biosynthetic pathways, producing a diverse range of complex molecules with many Shikimate pathway useful bioactive properties. Aromatic compounds are crucial components for major commercial segments, from De novo biosynthesis polymers to foods, nutraceuticals, and pharmaceuticals, and the demand for such products has been projected to Microbial production continue to increase at national and global levels. Compared to direct plant extraction and chemical synthesis, Flavonoids microbial production holds promise not only for much shorter cultivation periods and robustly higher yields, but Stilbenoids Benzylisoquinoline alkaloids also for enabling further derivatization to improve compound efficacy by tailoring new enzymatic steps. This review summarizes the biosynthetic pathways for a large repertoire of commercially valuable products that are derived from the aromatic amino acid biosynthesis pathway, and it highlights both generic strategies and spe- cific solutions to overcome certain unique problems to enhance the productivities of microbial hosts.
    [Show full text]
  • Prenylquinones in Human Parasitic Protozoa: Biosynthesis, Physiological Functions, and Potential As Chemotherapeutic Targets
    molecules Review Prenylquinones in Human Parasitic Protozoa: Biosynthesis, Physiological Functions, and Potential as Chemotherapeutic Targets 1, 1, 1, 1,2 Ignasi B. Verdaguer y, Camila A. Zafra y, Marcell Crispim y, Rodrigo A.C. Sussmann , Emília A. Kimura 1 and Alejandro M. Katzin 1,* 1 Department of Parasitology, Institute of Biomedical Sciences, University of São Paulo, São Paulo 05508000, Brazil; [email protected] (I.B.V.); [email protected] (C.A.Z.); [email protected] (M.C.); [email protected] (R.A.C.S.); [email protected] (E.A.K.) 2 Centro de Formação em Ciências Ambientais, Universidade Federal do Sul da Bahia, Porto Seguro 45810-000 Bahia, Brazil * Correspondence: [email protected]; Tel.: +55-11-3091-7330; Fax: +5511-3091-7417 These authors contributed equally to this work. y Received: 5 August 2019; Accepted: 1 October 2019; Published: 16 October 2019 Abstract: Human parasitic protozoa cause a large number of diseases worldwide and, for some of these diseases, there are no effective treatments to date, and drug resistance has been observed. For these reasons, the discovery of new etiological treatments is necessary. In this sense, parasitic metabolic pathways that are absent in vertebrate hosts would be interesting research candidates for the identification of new drug targets. Most likely due to the protozoa variability, uncertain phylogenetic origin, endosymbiotic events, and evolutionary pressure for adaptation to adverse environments, a surprising variety of prenylquinones can be found within these organisms. These compounds are involved in essential metabolic reactions in organisms, for example, prevention of lipoperoxidation, participation in the mitochondrial respiratory chain or as enzymatic cofactors.
    [Show full text]
  • Comparative Genomic Analysis of The
    de Crécy-Lagard et al. Biology Direct 2012, 7:32 http://www.biology-direct.com/content/7/1/32 RESEARCH Open Access Comparative genomic analysis of the DUF71/ COG2102 family predicts roles in diphthamide biosynthesis and B12 salvage Valérie de Crécy-Lagard1*, Farhad Forouhar2, Céline Brochier-Armanet3, Liang Tong2 and John F Hunt2 Abstract Background: The availability of over 3000 published genome sequences has enabled the use of comparative genomic approaches to drive the biological function discovery process. Classically, one used to link gene with function by genetic or biochemical approaches, a lengthy process that often took years. Phylogenetic distribution profiles, physical clustering, gene fusion, co-expression profiles, structural information and other genomic or post-genomic derived associations can be now used to make very strong functional hypotheses. Here, we illustrate this shift with the analysis of the DUF71/COG2102 family, a subgroup of the PP-loop ATPase family. Results: The DUF71 family contains at least two subfamilies, one of which was predicted to be the missing diphthine-ammonia ligase (EC 6.3.1.14), Dph6. This enzyme catalyzes the last ATP-dependent step in the synthesis of diphthamide, a complex modification of Elongation Factor 2 that can be ADP-ribosylated by bacterial toxins. Dph6 orthologs are found in nearly all sequenced Archaea and Eucarya, as expected from the distribution of the diphthamide modification. The DUF71 family appears to have originated in the Archaea/Eucarya ancestor and to have been subsequently horizontally transferred to Bacteria. Bacterial DUF71 members likely acquired a different function because the diphthamide modification is absent in this Domain of Life.
    [Show full text]
  • Metabolic Engineering and Bio-Electrochemical Synthesis in Pseudomonas Putida KT2440 for the Production of P-Hydroxybenzoate and 2-Ketogluconate
    Metabolic engineering and bio-electrochemical synthesis in Pseudomonas putida KT2440 for the production of p-hydroxybenzoate and 2-ketogluconate Shiqin Yu Master of Science A thesis submitted for the degree of Doctor of Philosophy at The University of Queensland in 2017 School of Chemical Engineering I Abstract Bio-based chemicals have drawn research interests due to the need for sustainable development. Aromatics and the derived compounds are an important class of chemicals that are mostly derived from fossil resources. Microbial bio-production can produce many compounds from renewable feedstocks to reduce the current heavy dependency on fossil resources. The aromatic compound para-hydroxybenzoate (PHBA) is used to make parabens and high-value polymers (liquid crystal polymer). Biologically, this chemical can be derived from the shikimate pathway, the central pathway for the biosynthesis of aromatic amino acids in bacteria, plants and fungi and some protozoa. In recent years, the gram-negative soil bacterium Pseudomonas putida is becoming an interesting chassis for industrial biotechnology. The production of PHBA in recombinant P. putida KT2440 was engineered by overexpressing the chorismate lyase Ubic from Escherichia coli and a feedback resistant 3-Deoxy-D-arabinoheptulosonate 7-phosphate synthase (AroGD146N). Additionally, the pathways competing for the substrate chorismate (trpE and pheA) and the PHBA degradation pathway (pobA) were eliminated. Finally, deletion of the glucose metabolism repressor hexR led to an increase in erythrose-4-phosphate and NADPH supply. This resulted in a maximum titre of 1.73 g L-1 and a carbon yield of 18.1 % (C-mol C-mol-1) in a non-optimized fed-batch fermentation.
    [Show full text]
  • Metabolic Dependency of Chorismate in Plasmodium Falciparum Suggests
    www.nature.com/scientificreports OPEN Metabolic dependency of chorismate in Plasmodium falciparum suggests an alternative Received: 21 May 2019 Accepted: 10 September 2019 source for the ubiquinone Published: xx xx xxxx biosynthesis precursor Ana Lisa Valenciano1, Maria L. Fernández-Murga2, Emilio F. Merino1, Nicole R. Holderman1, Grant J. Butschek1, Karl J. Shafer3, Peter C. Tyler3 & Maria Belen Cassera1 The shikimate pathway, a metabolic pathway absent in humans, is responsible for the production of chorismate, a branch point metabolite. In the malaria parasite, chorismate is postulated to be a direct precursor in the synthesis of p-aminobenzoic acid (folate biosynthesis), p-hydroxybenzoic acid (ubiquinone biosynthesis), menaquinone, and aromatic amino acids. While the potential value of the shikimate pathway as a drug target is debatable, the metabolic dependency of chorismate in P. falciparum remains unclear. Current evidence suggests that the main role of chorismate is folate biosynthesis despite ubiquinone biosynthesis being active and essential in the malaria parasite. Our goal in the present work was to expand our knowledge of the ubiquinone head group biosynthesis and its potential metabolic dependency on chorismate in P. falciparum. We systematically assessed the development of both asexual and sexual stages of P. falciparum in a defned medium in the absence of an exogenous supply of chorismate end-products and present biochemical evidence suggesting that the benzoquinone ring of ubiquinones in this parasite may be synthesized through a yet unidentifed route. Human malaria accounts for more than 400,000 deaths every year, with Plasmodium falciparum being the dead- liest of the species that infects humans1. All Plasmodium species have a complex life cycle that occurs between the human host and the Anopheles mosquito vector.
    [Show full text]
  • Building Microbial Factories for the Production of Aromatic Amino Acid
    Chemical and Biological Engineering Publications Chemical and Biological Engineering 8-10-2019 Building microbial factories for the production of aromatic amino acid pathway derivatives: From commodity chemicals to plant-sourced natural products Mingfeng Cao Iowa State University Meirong Gao Iowa State University, [email protected] Miguel Suastegui Iowa State University See next page for additional authors Follow this and additional works at: https://lib.dr.iastate.edu/cbe_pubs Part of the Biochemical and Biomolecular Engineering Commons, and the Biology and Biomimetic Materials Commons The ompc lete bibliographic information for this item can be found at https://lib.dr.iastate.edu/ cbe_pubs/386. For information on how to cite this item, please visit http://lib.dr.iastate.edu/ howtocite.html. This Article is brought to you for free and open access by the Chemical and Biological Engineering at Iowa State University Digital Repository. It has been accepted for inclusion in Chemical and Biological Engineering Publications by an authorized administrator of Iowa State University Digital Repository. For more information, please contact [email protected]. Building microbial factories for the production of aromatic amino acid pathway derivatives: From commodity chemicals to plant-sourced natural products Abstract The ra omatic amino acid biosynthesis pathway, together with its downstream branches, represents one of the most commercially valuable biosynthetic pathways, producing a diverse range of complex molecules with many useful bioactive properties. Aromatic compounds are crucial components for major commercial segments, from polymers to foods, nutraceuticals, and pharmaceuticals, and the demand for such products has been projected to continue to increase at national and global levels.
    [Show full text]
  • Generated by SRI International Pathway Tools Version 25.0, Authors S
    Authors: Pallavi Subhraveti Ron Caspi Peter Midford Peter D Karp An online version of this diagram is available at BioCyc.org. Biosynthetic pathways are positioned in the left of the cytoplasm, degradative pathways on the right, and reactions not assigned to any pathway are in the far right of the cytoplasm. Transporters and membrane proteins are shown on the membrane. Ingrid Keseler Periplasmic (where appropriate) and extracellular reactions and proteins may also be shown. Pathways are colored according to their cellular function. Gcf_001697945Cyc: Neisseria meningitidis M25476 Cellular Overview Connections between pathways are omitted for legibility. Anamika Kothari phosphate putrescine ammonium spermidine RS00335 TrkA NhaC RS04655 ExbB RS04440 RS03990 RS03595 HtpX RS08650 RS02780 RS02515 PotA FtsE YccS LolD RS06485 RS06395 RS00855 RS05985 YidC RS06405 RS11135 RS05880 RS00885 RS04430 RS01225 RS01595 RS02015 RS05870 RS07640 RS08060 RS08375 RS03165 RS03450 FxsA RS09655 RS09920 RS04565 RS04745 RS00175 RS05150 RS10910 RS09270 putrescine phosphate ammonium spermidine RS11000 RS00870 Fatty Acid and Polyprenyl Metabolic Regulator Lipid Degradation Cofactor, Prosthetic gln Aminoacyl-tRNA Charging glutaminyl-tRNA Biosynthesis Biosynthesis Group, Electron γ a {β-D-Gal-(1->4)-β-D- CMP-N-acetyl- 3-phenyl-2- L-alanyl- -D- a peptidoglycan a [protein]-L- biosynthesis via transamidation oleate β-oxidation Carrier Degradation β a [glutamine- a lipid II Fermentation mixed acid fermentation β -neuraminate tyr glutamyl-meso-2,6- dimer (meso- methionine
    [Show full text]