CRISPR-Cas Genome Surgery in Ophthalmology
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Telomere Biology and Aging
1 CHAPTER 1: Telomeres in Aging: Birds Susan E. Swanberg and Mary E. Delany Department of Animal Science University of California Davis, CA 95616 Handbook of Models for the Study of Human Aging (In press 2005) 2 I. Abstract This chapter describes the use of avian species (the domestic chicken Gallus domesticus in particular) as model organisms for research in telomere biology and aging. Presented here are key concepts of avian telomere biology including characteristics of the model: the karyotype, telomere arrays, telomere shortening as a measure of the senescence phenotype or organismal aging, and telomerase activity in avian systems including chicken embryonic stem cells, chicken embryo fibroblasts, the gastrula embryo and DT40 cells. Key methods used to measure telomere shortening, telomerase activity, and to conduct expression profiling of selected genes involved in telomere length maintenance are noted as are methods for conducting gain- and loss-of-function studies in the chicken embryo. Tables containing references on general topics related to avian telomere biology and poultry husbandry as well as specific information regarding chicken orthologs of genes implicated in telomere maintenance pathways are provided. Internet resources for investigators of avian telomere biology are listed. 3 II. Glossary Telomere-The chromosome end which in vertebrates is composed of many copies of the hexanucleotide repeat 5' TTAGGG 3' along with associated DNA binding proteins. Replicative senescence-After a finite and typically species and tissue-specific number of divisions, cells are no longer able to proliferate. Cell morphology changes such as increased cell size, increase in the size of the nucleus and nucleoli, increased vacuolation, and expression of senescence markers are typically observed in senescent cells. -
Clinical Features of Autosomal Dominant Retinitis Pigmentosa Associated with a Rhodopsin Mutation
Clinical Features of adRP—Haoyu Chen et al 411 Original Article Clinical Features of Autosomal Dominant Retinitis Pigmentosa Associated with a Rhodopsin Mutation 1,2 3 3 3 3,4 Haoyu Chen, MS, Yali Chen, PhD, Rachael Horn, MD, Zhenglin Yang, MD, Changguan Wang, MD, 3 3 Matthew J Turner, MSPH, Kang Zhang, MD, PhD Abstract Introduction: Retinitis pigmentosa (RP) describes a group of inherited disorders characterised by progressive retinal dysfunction, cell loss and atrophy of retinal tissue. RP demonstrates considerable clinical and genetic heterogeneity, with wide variations in disease severity, progres- sion, and gene involvement. We studied a large family with RP to determine the pattern of inheritance and identify the disease-causing mutation, and then to describe the phenotypic presentation of this family. Materials and Methods: Ophthalmic examination was performed on 46 family members to identify affected individuals and to characterise the disease phenotype. Family pedigree was obtained. Some family members also had fundus photographs, fluorescein angiography, and/or optical coherence tomography (OCT) analysis performed. Genetic linkage was performed using short tandem repeat (STR) polymorphic markers encompassing the known loci for autosomal dominant RP. Finally, DNA sequencing was performed to identify the mutation present in this family. Results: Clinical features included nyctalopia, constriction of visual fields and eventual loss of central vision. Sequence analysis revealed a G-to-T nucleotide change in the Rhodopsin gene, predicting a Gly-51-Val substitution. Conclusions: This large multi-generation family demonstrates the phenotypic variability of a previously identified autosomal dominant mutation of the Rhodopsin gene. Ann Acad Med Singapore 2006;35:411-5 Key words: Hereditary eye diseases, Retinal degeneration, Retinopathy, Rod cone dystrophies Introduction photoreceptor cells. -
Genes and Mutations Causing Autosomal Dominant Retinitis Pigmentosa
Downloaded from http://perspectivesinmedicine.cshlp.org/ on September 24, 2021 - Published by Cold Spring Harbor Laboratory Press Genes and Mutations Causing Autosomal Dominant Retinitis Pigmentosa Stephen P. Daiger, Sara J. Bowne, and Lori S. Sullivan Human Genetics Center, School of Public Health, The University of Texas Health Science Center, Houston, Texas 77030 Correspondence: [email protected] Retinitis pigmentosa (RP) has a prevalence of approximately one in 4000; 25%–30% of these cases are autosomal dominant retinitis pigmentosa (adRP). Like other forms of inherited retinal disease, adRP is exceptionally heterogeneous. Mutations in more than 25 genes are known to cause adRP,more than 1000 mutations have been reported in these genes, clinical findings are highly variable, and there is considerable overlap with other types of inherited disease. Currently, it is possible to detect disease-causing mutations in 50%–75% of adRP families in select populations. Genetic diagnosis of adRP has advantages over other forms of RP because segregation of disease in families is a useful tool for identifying and confirming potentially pathogenic variants, but there are disadvantages too. In addition to identifying the cause of disease in the remaining 25% of adRP families, a central challenge is reconciling clinical diagnosis, family history, and molecular findings in patients and families. etinitis pigmentosa (RP) is an inherited dys- grams (ERGs), changes in structure imaged by Rtrophic or degenerative disease of the retina optical coherence tomography (OCT), and sub- with a prevalence of roughly one in 4000 (Haim jective changes in visual function (Fishman et al. 2002; Daiger et al. 2007). -
Supplementary Figure 1. Network Map Associated with Upregulated Canonical Pathways Shows Interferon Alpha As a Key Regulator
Supplementary Figure 1. Network map associated with upregulated canonical pathways shows interferon alpha as a key regulator. IPA core analysis determined interferon-alpha as an upstream regulator in the significantly upregulated genes from RNAseq data from nasopharyngeal swabs of COVID-19 patients (GSE152075). Network map was generated in IPA, overlaid with the Coronavirus Replication Pathway. Supplementary Figure 2. Network map associated with Cell Cycle, Cellular Assembly and Organization, DNA Replication, Recombination, and Repair shows relationships among significant canonical pathways. Significant pathways were identified from pathway analysis of RNAseq from PBMCs of COVID-19 patients. Coronavirus Pathogenesis Pathway was also overlaid on the network map. The orange and blue colors in indicate predicted activation or predicted inhibition, respectively. Supplementary Figure 3. Significant biological processes affected in brochoalveolar lung fluid of severe COVID-19 patients. Network map was generated by IPA core analysis of differentially expressed genes for severe vs mild COVID-19 patients in bronchoalveolar lung fluid (BALF) from scRNA-seq profile of GSE145926. Orange color represents predicted activation. Red boxes highlight important cytokines involved. Supplementary Figure 4. 10X Genomics Human Immunology Panel filtered differentially expressed genes in each immune subset (NK cells, T cells, B cells, and Macrophages) of severe versus mild COVID-19 patients. Three genes (HLA-DQA2, IFIT1, and MX1) were found significantly and consistently differentially expressed. Gene expression is shown per the disease severity (mild, severe, recovered) is shown on the top row and expression across immune cell subsets are shown on the bottom row. Supplementary Figure 5. Network map shows interactions between differentially expressed genes in severe versus mild COVID-19 patients. -
Rp9 (NM 018739) Mouse Tagged ORF Clone – MG218146 | Origene
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MG218146 Rp9 (NM_018739) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Rp9 (NM_018739) Mouse Tagged ORF Clone Tag: TurboGFP Symbol: Rp9 Synonyms: PAP-1; Rp9h Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MG218146 representing NM_018739 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCGTCCGGGGCCGGGTCTCGGCGGCCGCGGGAGCCGCCGGAGCACGAGCTGCAGCGGCGGCGGGAGC AGAAACGGCGGCGGCACGACGCGCAGCAGCTGCAGCAGCTCAAGCACCTGGAGTCCTTTTATGAGAAACC TCCTCCTGGGTTTATAAAGGAGGACGAGACGAAGCCAGAAGACTGTATACCAGATGTGCCCGGCAATGAA CATGCCAGGGAGTTTCTGGCTCACGCTCCGACTAAAGGACTGTGGATGCCCCTGGGGAGAGAGGTCAAAG TTATGCAATGTTGGCGTTGCAAACGGTATGGCCATCGAACAGGCGACAAAGAATGCCCTTTCTTTATCAA AGGCAACCAGAAGTTAGAACAGTTCCGAGTCGCACATGAAGATCCTATGTACGACATCATTCGCGAGAAT AAAAGACATGAAAAGGATGTAAGGATCCAGCAGTTAAAGCAGTTACTGGAGGACTCCACCTCAGATGACG ACGGGAGCAGCTCCAGCTCCTCGGGGGACAGAGAGAAGCGCAAGAAAAGGAAGAAAAAAGAAAAGCACAA GAAACGCAAGAAGGAGAAGAAAAAGAAGAAGAAACGGAAGCACAAGGCTTCCAAGTCCAGTGAGAGCTCT GACTCAGAG ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >MG218146 representing NM_018739 Red=Cloning site Green=Tags(s) MSSGAGSRRPREPPEHELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGFIKEDETKPEDCIPDVPGNE HAREFLAHAPTKGLWMPLGREVKVMQCWRCKRYGHRTGDKECPFFIKGNQKLEQFRVAHEDPMYDIIREN -
Targeted RP9 Ablation and Mutagenesis in Mouse Photoreceptor Cells by CRISPR-Cas9
www.nature.com/scientificreports OPEN Targeted RP9 ablation and mutagenesis in mouse photoreceptor cells by CRISPR-Cas9 Received: 24 November 2016 Ji-Neng Lv1,2,*, Gao-Hui Zhou1,2,*, Xuejiao Chen1,2,*, Hui Chen1,2, Kun-Chao Wu1,2, Lue Xiang1,2, Accepted: 17 January 2017 Xin-Lan Lei1,2, Xiao Zhang1,2, Rong-Han Wu1,2 & Zi-Bing Jin1,2 Published: 20 February 2017 Precursor messenger RNA (Pre-mRNA) splicing is an essential biological process in eukaryotic cells. Genetic mutations in many spliceosome genes confer human eye diseases. Mutations in the pre- mRNA splicing factor, RP9 (also known as PAP1), predispose autosomal dominant retinitis pigmentosa (adRP) with an early onset and severe vision loss. However, underlying molecular mechanisms of the RP9 mutation causing photoreceptor degeneration remains fully unknown. Here, we utilize the CRISPR/Cas9 system to generate both the Rp9 gene knockout (KO) and point mutation knock in (KI) (Rp9, c.A386T, P.H129L) which is analogous to the reported one in the retinitis pigmentosa patients (RP9, c.A410T, P.H137L) in 661 W retinal photoreceptor cells in vitro. We found that proliferation and migration were significantly decreased in the mutated cells. Gene expression profiling by RNA- Seq demonstrated that RP associated genes, Fscn2 and Bbs2, were down-regulated in the mutated cells. Furthermore, pre-mRNA splicing of the Fscn2 gene was markedly affected. Our findings reveal a functional relationship between the ubiquitously expressing RP9 and the disease-specific gene, thereafter provide a new insight of disease mechanism in RP9-related retinitis pigmentosa. Retinitis pigmentosa (RP [MIM 268000]) is a group of retinal degenerative disorders with high heritability and heterogeneity, affecting approximately 1 in 4,000 in dividuals1,2 and it is becoming the leading cause of irre- versible midway blindness worldwide. -
A Collection of 1814 Human Chromosome 7-Specific Stss
Downloaded from genome.cshlp.org on October 10, 2021 - Published by Cold Spring Harbor Laboratory Press LEHER A Collection of 1814 Human Chromosome 7-Specific STSs Gerard G. Bouffard, 1 Leslie M. lyer, 1 Jacquelyn R. Idol, ~ Valerie V. Braden, ~ Aimee F. Cunningharn, ~ Lauren A. Weintraub, ~ Rose M. Mohr-Tidwell, 2 Dale C. Peluso, 2 Robert S. Fulton, 2 Mary P. Leckie, 2 and Eric D. Green 1'3 1Genome Technology Branch, National Center for Human Genome Research, National Institutes of Health, Bethesda, Maryland 20892; 2Department of Genetics, Washington University School of Medicine, St. Louis, Missouri 63110 An established goal of the ongoing Human Genome Project is the development and mapping of sequence-tagged sites (STSs} every 100 kb, on average, across all human chromosomes. En route to constructing such a physical map of human chromosome 7, we have generated 1814 chromosome 7-specific STSs. The corresponding PCR assays were designed by the use of DNA sequence determined in our laboratory (79%) or generated elsewhere (21%) and were demonstrated to be suitable for screening yeast artificial chromosome (YAC) libraries. This collection provides the requisite landmarks for constructing a physical map of chromosome 7 at <100-kb average spacing of STSs. The relevant information about these STSs is available electronically in the STS Division of GenBank (dbSTS} and the Genome Database {GDB) as well as in a summary table available at http:llwww.cshl.orglgr or http://www.nchgr.nih.gov / DIR / GTB/CHR7. A central activity of the Human Genome Project is ment of STSs from human DNA. In addition to nu- the construction of highly annotated physical maps merous reports of establishing small numbers of of all human chromosomes. -
Review Pre-Mrna Splicing and Retinitis Pigmentosa
Molecular Vision 2006; 12:1259-71 <http://www.molvis.org/molvis/v12/a143/> ©2006 Molecular Vision Received 1 August 2005 | Accepted 14 June 2006 | Published 26 October 2006 Review Pre-mRNA splicing and retinitis pigmentosa Daniel Mordes,1,2,3 Xiaoyan Luo,1,2,3 Amar Kar,1,2,3 David Kuo,1,2,3 Lili Xu,1,2,3 Kazuo Fushimi,1,2,3 Guowu Yu,1,2,3 Paul Sternberg, Jr,4 Jane Y. Wu1,2,3,4 Departments of 1Pediatrics, and 2Cell and Developmental Biology, and 3Pharmacology, John F. Kennedy Center for Research on Human Development; 4Department of Ophthalmology and Visual Sciences, Vanderbilt University Medical Center, Nashville, TN Retinitis pigmentosa (RP) is a group of genetically and clinically heterogeneous retinal diseases and a common cause of blindness. Among the 12 autosomal dominant RP (adRP) genes identified, four encode ubiquitously expressed proteins involved in pre-mRNA splicing, demonstrating the important role that pre-mRNA splicing plays in the pathogenesis of retinal degeneration. This review focuses on recent progress in identifying adRP mutations in genes encoding pre-mRNA splicing factors and the potential underlying molecular mechanisms. A major cause of blindness is retinal degeneration. One proteins essential for pre-mRNA splicing, pre-mRNA process- of the most common forms of retinal degeneration is retinitis ing factors (PRPF), including PRPF31 (also named PRP31; pigmentosa (RP), affecting 1 in 4000 people worldwide and for RP11) [10], PRPF8 (also named PRP8 or PRPC8; for RP13) leaving more than 1.5 million people visually handicapped. [11] and PRPF3 (also named HPRP3; for RP18) [12]. -
Gnomad Lof Supplement
1 gnomAD supplement gnomAD supplement 1 Data processing 4 Alignment and read processing 4 Variant Calling 4 Coverage information 5 Data processing 5 Sample QC 7 Hard filters 7 Supplementary Table 1 | Sample counts before and after hard and release filters 8 Supplementary Table 2 | Counts by data type and hard filter 9 Platform imputation for exomes 9 Supplementary Table 3 | Exome platform assignments 10 Supplementary Table 4 | Confusion matrix for exome samples with Known platform labels 11 Relatedness filters 11 Supplementary Table 5 | Pair counts by degree of relatedness 12 Supplementary Table 6 | Sample counts by relatedness status 13 Population and subpopulation inference 13 Supplementary Figure 1 | Continental ancestry principal components. 14 Supplementary Table 7 | Population and subpopulation counts 16 Population- and platform-specific filters 16 Supplementary Table 8 | Summary of outliers per population and platform grouping 17 Finalizing samples in the gnomAD v2.1 release 18 Supplementary Table 9 | Sample counts by filtering stage 18 Supplementary Table 10 | Sample counts for genomes and exomes in gnomAD subsets 19 Variant QC 20 Hard filters 20 Random Forest model 20 Features 21 Supplementary Table 11 | Features used in final random forest model 21 Training 22 Supplementary Table 12 | Random forest training examples 22 Evaluation and threshold selection 22 Final variant counts 24 Supplementary Table 13 | Variant counts by filtering status 25 Comparison of whole-exome and whole-genome coverage in coding regions 25 Variant annotation 30 Frequency and context annotation 30 2 Functional annotation 31 Supplementary Table 14 | Variants observed by category in 125,748 exomes 32 Supplementary Figure 5 | Percent observed by methylation. -
Swiss Rna Workshop
Presentation overview 2 Talks: Last First Group Page Nr. Tanackovic Goranka Rivolta 5 Chabot Benoit Chabot 6 Meyer Kathrin Schümperli 7 Clèry Antoine Allain 8 Chari Ashwin Fischer 9 Beyrouthy Nissrine Stutz 10 Luke Brian Lingner 11 Gerber André P. Gerber 12 Hentze Matthias W. Hentze 13 Grosshans Helge Grosshans 14 Hausser Jean Zavolan 15 Chandrasekar Vijay Dreyer 16 Nicholson Pamela Mühlemann 17 San Paolo Salvatore Keller 18 Aeby Eric Schneider 19 Ochsenreiter Torsten Ochsenreiter 20 SWISS RNA WORKSHOP Posters: January 30, 2009, Nr. Last First Group Page Nr. 9:15-18:20h 1 Lenzken Silvia C Barabino 21 2 Vivarelli Silvia Barabino 22 3 Graef Christine Baumann 23 4 Kowalska Elzbieta Brown 24 5 Scheckel Claudia Ciosk 25 6 Wright Jane Ciosk 26 7 Halbach Andre Dichtl 27 Universität Bern, UniS, Schanzeneckstr. 1, Hörsaal A003 8 Scola Simonetta Dichtl 28 9 Kanitz Alexander Gerber 29 Organizers: Angela Krämer, Oliver Mühlemann 10 Schenk Luca Gerber 30 and Daniel Schümperli 11 Scherrer Tanja Gerber 31 12 Hertel Klemens Hertel 32 13 Karow Anne R. Klostermeier 33 14 Panza Andrea B. Lingner 34 15 Mendes Camila T. Lottaz 35 16 Sánchez Freire Verónica Monastyrskaya 36 17 Stalder Lukas Mühlemann 37 18 Pauli Sandra Nagamine 38 19 Leidel Sebastian Peter 39 20 Ramundo Silvia Rochaix 40 21 Ruepp Marc-David Schümperli 41 22 Dieppois Guennaëlle Stutz 42 23 Tutucci Evelina Stutz 43 Sponsored by: 24 Meili David Thoeny 44 25 Swetloff Adam Patrick Vassalli 45 26 Bandi Nora Vassella 46 Morning program 3 Afternoon program 4 Opening remarks (9:15) Lunch and poster session (12:40-14:10) Angela Krämer, Department of Cell Biology, University of Geneva Daniel Schümperli, Institute of Cell Biology, University of Bern MicroRNAs and RNA binding proteins - Splicing and disease (9:25-10:40) control of translation and mRNA stability (14:10-16:05) Analysis of pre-mRNA splicing in cell lines derived from patients with retinitis Stress-dependent coordination of transcriptome and translatome in yeast pigmentosa and dominant mutations in pre-mRNA splicing factor genes PRPF31, André P. -
Genome Editing As a Treatment for the Most Prevalent Causative Genes of Autosomal Dominant Retinitis Pigmentosa
International Journal of Molecular Sciences Review Genome Editing as a Treatment for the Most Prevalent Causative Genes of Autosomal Dominant Retinitis Pigmentosa Michalitsa Diakatou 1,2, Gaël Manes 1,2 , Beatrice Bocquet 1,2,3, Isabelle Meunier 1,2,3 and Vasiliki Kalatzis 1,2,* 1 Inserm U1051, Institute for Neurosciences of Montpellier, 80 Avenue Augustin Fliche, 34091 Montpellier, France; [email protected] (M.D.); [email protected] (G.M.); [email protected] (B.B.); [email protected] (I.M.) 2 University of Montpellier, 34095 Montpellier, France 3 National Reference Centre for Inherited Sensory Diseases, CHU, 34295 Montpellier, France * Correspondence: [email protected]; Tel.: +33-(0)4-9963-6076; Fax: +33-(0)4-9963-6020 Received: 25 April 2019; Accepted: 22 May 2019; Published: 23 May 2019 Abstract: Inherited retinal dystrophies (IRDs) are a clinically and genetically heterogeneous group of diseases with more than 250 causative genes. The most common form is retinitis pigmentosa. IRDs lead to vision impairment for which there is no universal cure. Encouragingly, a first gene supplementation therapy has been approved for an autosomal recessive IRD. However, for autosomal dominant IRDs, gene supplementation therapy is not always pertinent because haploinsufficiency is not the only cause. Disease-causing mechanisms are often gain-of-function or dominant-negative, which usually require alternative therapeutic approaches. In such cases, genome-editing technology has raised hopes for treatment. Genome editing could be used to (i) invalidate both alleles, followed by supplementation of the wild type gene, (ii) specifically invalidate the mutant allele, with or without gene supplementation, or (iii) to correct the mutant allele. -
MOL #82305 TITLE PAGE Title: Induced CYP3A4 Expression In
Downloaded from molpharm.aspetjournals.org at ASPET Journals on September 28, 2021 1 This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted. The final version may differ from this version. This article has not been copyedited and formatted.