1 Structure of Fam20A reveals a pseudokinase featuring unique
2 disulfide pattern and inverted ATP-binding
3
4 Jixin Cui#,1, Qinyu Zhu#,2,3, Hui Zhang2,3, Michael A. Cianfrocco4, Andres E.
5 Leschziner4, Jack E. Dixon*1,4,5, Junyu Xiao*,3
6
7 1. Department of Pharmacology, University of California, San Diego, La Jolla, CA
8 92093, USA
9 2. Academy for Advanced Interdisciplinary Studies, Peking University, Beijing
10 100871, China
11 3. The State Key Laboratory of Protein and Plant Gene Research, School of Life
12 Sciences, Peking-Tsinghua Center for Life Sciences, Peking University, Beijing,
13 100871, China
14 4. Department of Cellular and Molecular Medicine, University of California, San
15 Diego, San Diego, CA 92093, USA
16 5. Department of Chemistry and Biochemistry, University of California San Diego,
17 La Jolla, CA 92093, USA
18
19 # These authors contributed equally to this work
20 *Correspondence and requests for materials should be addressed to J.E.D
21 ([email protected]) and J.X. ([email protected])
1 22 Abstract
23 Mutations in FAM20A cause tooth enamel defects known as Amelogenesis
24 Imperfecta (AI) and renal calcification. We previously showed that Fam20A is a
25 secretory pathway pseudokinase and allosterically activates the physiological casein
26 kinase Fam20C to phosphorylate secreted proteins important for biomineralization
27 (Cui et al., 2015). Here we report the nucleotide-free and ATP-bound structures of
28 Fam20A. Fam20A exhibits a distinct disulfide bond pattern mediated by a unique
29 insertion region. Loss of this insertion due to abnormal mRNA splicing interferes
30 with the structure and function of Fam20A, resulting in AI. Fam20A binds ATP in the
31 absence of divalent cations, and strikingly, ATP is bound in an inverted orientation
32 compared to other kinases. Fam20A forms a dimer in the crystal, and residues in the
33 dimer interface are critical for Fam20C activation. Together, these results provide
34 structural insights into the function of Fam20A and shed light on the mechanism by
35 which Fam20A mutations cause disease.
2 36 Introduction
37 The human kinome contains more than 500 members, which function
38 primarily in the cytoplasm or nucleus to regulate many cellular processes (Manning
39 et al., 2002). Approximately 10% of the kinome are considered pseudokinases due
40 to their lack of certain residues typically required for catalysis. Some of these
41 proteins, however, achieve activity using residues located at unconventional
42 positions and are thus bona fide kinases (Min et al., 2004, Eswaran et al., 2009, Villa
43 et al., 2009, Zhu et al., 2016). Others are completely devoid of catalytic activity but
44 play important scaffolding roles and can serve as allosteric regulators of active
45 kinases (Boudeau et al., 2006, Zeqiraj and van Aalten, 2010, Shaw et al., 2014, Kung
46 and Jura, 2016).
47 Novel kinases specifically residing in the secretory pathway, exemplified by
48 the family of sequence similarity 20 (Fam20) family, have been recently identified to
49 phosphorylate secreted and lumenal proteins and glycans (Tagliabracci et al.,
50 2013a, Tagliabracci et al., 2013b, Sreelatha et al., 2015). As commonly seen with
51 secretory proteins, these kinases are glycosylated and contain disulfide bonds for
52 structural integrity. Fam20C, the best-characterized member of the Fam20 family,
53 has been established as the physiological casein kinase that phosphorylates the vast
54 majority of the secreted phosphoproteome (Tagliabracci et al., 2012, Tagliabracci et
55 al., 2015). Fam20C substrates are involved in a wide spectrum of biological
56 processes, including the formation of bones and teeth (Tagliabracci et al., 2012, Cui
57 et al., 2015). Newborns with loss-of-function FAM20C mutations present with
58 deadly sclerosing osteomalacia with cerebral calcification known as Raine
3 59 syndrome (Simpson et al., 2007, Whyte et al., 2016). Patients with hypomorphic
60 FAM20C mutations can survive but manifest various anomalies, including tooth
61 enamel formation defect referred to as Amelogenesis Imperfecta (AI),
62 hypophosphatemia, and ectopic calcification (Fradin et al., 2011, Rafaelsen et al.,
63 2013, Takeyari et al., 2014, Acevedo et al., 2015, Elalaoui et al., 2016). The crystal
64 structure of the Fam20C ortholog from Caenorhabditis elegans (ceFam20) revealed
65 an atypical kinase architecture and key catalytic residues that are uniquely present
66 in the Fam20 family of kinases (Xiao et al., 2013).
67 Fam20B and Fam20A are two paralogs of Fam20C in vertebrates (Nalbant et
68 al., 2005). Fam20B phosphorylates a xylose residue during the biosynthesis of
69 proteoglycans and plays a key role in regulating glycan elongation (Koike et al.,
70 2009, Wen et al., 2014). Mutations of Fam20A result in AI and ectopic calcification
71 such as nephrocalcinosis, analogous to the defects caused by non-lethal Fam20C
72 mutations (Volodarsky et al., 2015, Cherkaoui Jaouad et al., 2015, Wang et al., 2014,
73 Wang et al., 2013, O'Sullivan et al., 2011, Kantaputra et al., 2014b, Kantaputra et al.,
74 2014a, Jaureguiberry et al., 2012, Cho et al., 2012, Cabral et al., 2013, Kantaputra et
75 al., 2017). We have previously demonstrated that Fam20A lacks an essential residue
76 for catalysis and is therefore the first pseudokinase identified in the secretory
77 pathway (Cui et al., 2015). Fam20A forms a functional complex with Fam20C and
78 allosterically increases Fam20C activity towards secretory substrates, including the
79 enamel matrix proteins, whose phosphorylation is critical for enamel formation (Cui
80 et al., 2015). As compared to other Fam20 family members, Fam20A has a unique
81 and highly conserved insertion in the Gly-rich loop (Xiao et al., 2013). Truncation of
4 82 this insertion due to aberrant RNA splicing causes AI, strongly suggesting its role in
83 maintaining Fam20A function (Cho et al., 2012). Furthermore, Fam20A binds ATP
84 despite being catalytically inactive (Cui et al., 2015), the structural basis and
85 functional impact of which remain elusive.
86 Here we report the nucleotide-free and ATP-bound crystal structures of
87 Fam20A. Although the kinase core of Fam20A is structurally similar to that of
88 ceFam20, Fam20A displays an unusual disulfide pattern dictated by a pair of
89 cysteine residues within the unique insertion region. Strikingly, ATP binds to
90 Fam20A in an unprecedented orientation independent of cations. These results
91 reinforce the conclusion that Fam20A is a pseudokinase in the secretory pathway
92 and facilitate a deeper understanding of AI caused by Fam20A mutations.
93
5 94 Results
95 Fam20A displays a unique disulfide pattern
96 We determined the crystal structure of human Fam20A at 2.5 Å resolution
97 (Figure 1A, Table 1). The kinase core of Fam20A (residues 160-525) is structurally
98 similar to that of ceFam20, and can be superimposed onto ceFam20 with a rmsd
99 (root-mean-square difference) of 2.1 A over 322 aligned Cα atoms. Most secondary
100 structures in the kinase core of Fam20A aligned well with the equivalent structural
101 elements in ceFam20 except for three regions: the Kβ1-Kβ2 loop, the Kβ6-Kβ7 loop,
102 and the Kβ3-Kα3 loop (hereafter we use “K” to denote the secondary structures in
103 the kinase core of the Fam20 proteins, and “N” to denote the secondary structures in
104 their unique N-terminal segments. Figure 1A, 1B; Figure 1-figure supplement 1). An
105 insertion of seventeen residues specifically exists in the Kβ1-Kβ2 loop of Fam20A
106 (Figure 1-figure supplement 1, Figure 1-figure supplement 2). This insertion forms
107 two short α-helices (Kα2A, Kα2B) and forces an upswing of the Kβ1-Kβ2 loop. The
108 Kβ1-Kβ2 loop in turn levers up the Kβ6-Kβ7 loop and induces the formation of a
109 short helix (Kα5A) in this region. The Kβ3-Kα3 loop also swings up to engage with
110 the Kβ6-Kβ7 loop. Gln258Fam20A, which replaces a Glu essential for the catalytic
111 activity of Fam20C (Glu213ceFam20), resides at the C-terminal end of the Kβ3-Kα3
112 loop. As a result of the upswing of this loop, Gln258Fam20A is dislodged from the
113 “active site” of Fam20A (Figure 1A). The N-terminal segment of Fam20A contains
114 two α-helices and adopts a different topology compared to that of ceFam20. A long
115 helix, Nα2, is held alongside the kinase core and is involved in binding to ATP as
116 described below.
6 117 Fam20A displays a distinct disulfide pattern compared to ceFam20. As we
118 previously described, four pairs of disulfide bonds exist in ceFam20 (Xiao et al.,
119 2013). Three of them are also present in Fam20A (Figure 1-figure supplement 1).
120 However, a disulfide bond corresponding to Cys273ceFam20-Cys277ceFam20 in the Kβ6-
121 Kβ7 loop is absent in Fam20A. Instead, Cys209Fam20A and Cys211Fam20A in the Kβ1-
122 Kβ2 loop form two disulfide bonds with Cys319Fam20A and Cys323Fam20A (the two Cys
123 that align with Cys273ceFam20 and Cys277ceFam20), respectively (Figure 1A, Figure 1-
124 figure supplement 1). These two disulfide bonds tether the Kβ1-Kβ2 loop to the
125 Kβ6-Kβ7 loop, imposing a strong restraint on the structural flexibility of this region.
126 Notably, Cys209Fam20A and Cys211Fam20A are within the 17-residue insertion in the
127 Kβ1-Kβ2 loop and are specifically conserved in Fam20A orthologs (Figure 1-figure
128 supplement 2), suggesting that this unique disulfide pattern of Fam20A is
129 evolutionarily conserved.
130 The functional importance of these two Fam20A-specific disulfide bonds is
131 further demonstrated by a patient-derived Fam20A splicing variant. The N-terminal
132 portion of the Kβ1-Kβ2 loop, including Cys209Fam20A and Cys211Fam20A, is encoded by
133 a small exon, exon 3, of the FAM20A gene. In an AI patient with compound
134 heterozygous mutations in FAM20A (Cho et al., 2012), one allele has an A-G
135 transition at the acceptor site of intron 2 (c.590-2A-G), resulting in exon 3 skipping.
136 The expressed Fam20A variant has amino acids 197-214 substituted with a Val
137 (Fam20A-Δexon3, Figure 1C). Since the other allele has a nonsense mutation
138 (R276X) that abrogates the majority of the kinase domain, Fam20A-Δexon3 is the
139 only form of Fam20A present in the patient that gave rise to the disease. To evaluate
7 140 the function of Fam20A-Δexon3, we co-expressed V5-tagged osteopontin (OPN)
141 with Flag-tagged Fam20A-WT or Fam20A-Δexon3 in U2OS cells, metabolically
142 labeled the cells with 32P orthophosphate, and analyzed incorporation of
143 radiolabeled phosphate into the V5-immunoprecipitates. Consistent with our
144 previous observation, ectopic expression of Fam20A-WT significantly enhanced the
145 kinase activity of endogenous Fam20C towards OPN, resulting in a higher level of
146 OPN phosphorylation (Figure 1D) (Cui et al., 2015). In contrast, expression of
147 Fam20A-Δexon3 failed to increase OPN phosphorylation. Compared with Fam20A-
148 WT, Fam20A-Δexon3 was poorly secreted and thus probably misfolded (Figure 1E).
149 Similarly, Fam20A-CC/AA, a Fam20A mutant having both Cys209Fam20A and
150 Cys211Fam20A mutated to Ala, also showed attenuated secretion and diminished
151 ability to enhance OPN phosphorylation (Figure 1F). Thus, the unique disulfide
152 pattern in Fam20A plays an important role in maintaining its structure and function.
153
154 Fam20A binds ATP without cations
155 We have previously demonstrated that both Fam20A and Fam20C could bind
156 ATP by means of thermal stability shift assays (Cui et al., 2015). Consistent with the
157 fact that metal ions such as Mn2+ are required for the kinase activity of Fam20C,
158 Fam20C bound ATP in the presence of Mn2+, whereas ATP alone induced little
159 changes in its melting temperature (Tm) (Figure 2A). In contrast, ATP alone caused
160 dramatic Tm increase of Fam20A, indicating that ATP binding to Fam20A could be
161 cation-independent (Figure 2A).
8 162 To determine the binding affinity of Fam20A/ATP interaction, we measured
163 the ΔTm of Fam20A at different ATP concentrations in the presence or absence of
2+ app 164 Mn , and deduced apparent dissociation constant (Kd ) values. This method has
165 been validated by Murphy et al. to evaluate the affinity of ATP for a number of
166 kinases (Murphy et al., 2014b). Our results show that Fam20A binds ATP with a
app 167 Kd of 3 μM in the absence of cations as compared to 156 μM in the presence of
168 saturating amount of Mn2+ (Figure 2B). This suggests that Fam20A preferably binds
169 ATP without cations.
170 Fam20A also binds other nucleoside triphosphates including GTP, CTP, and
171 UTP in the absence of metal ions, albeit to lesser degrees compared to ATP (Figure
172 2C). In contrast, Fam20C selectively binds Mn2+/ATP. Furthermore, Fam20A prefers
173 binding ATP over ADP (Figure 2D), indicating that the γ-phosphate group of ATP is
174 important for the interaction.
175 The significant Tm increase of Fam20A upon ATP binding suggests that ATP
176 stabilizes Fam20A structure. We wondered whether ATP also stabilizes the
177 Fam20A/Fam20C complex. Recombinantly purified Fam20A and Fam20C were
178 mixed (with Fam20A in slight excess to promote complex formation) and passed
179 through a gel filtration column (Figure 2E). In the absence of ATP, the peak for the
180 Fam20A/Fam20C complex appeared asymmetrical with a “shoulder”. When ATP is
181 present, the peak of the complex became much sharper, suggesting that ATP
182 improved the structural homogeneity of the Fam20A/Fam20C complex.
183 To further assess the effect of ATP on the assembly of the Fam20A/Fam20C
184 complex, we performed single particle electron microscopy on negatively stained
9 185 samples of Fam20A/Fam20C. Two-dimensional (2D) class averages of the complex
186 exhibited a clover-shaped structure that is consistent in size with a
187 Fam20A/Fam20C tetramer (Figure 2F). By comparing 2D class averages for each
188 condition, we observed that addition of ATP rendered the Fam20A/Fam20C
189 particles smaller in size (Figure 2F, Figure 2-figure supplement 1 and Figure 2-
190 figure supplement 2), indicating a more compact and less flexible conformation of
191 the complex. Collectively, these results suggest that ATP binding to Fam20A
192 stabilizes Fam20A as well as the Fam20A/Fam20C complex.
193
194 ATP binds to Fam20A in an inverted orientation
195 To elucidate how Fam20A binds ATP, we soaked ATP into the Fam20A
196 crystals obtained above and determined the complex structure at 2.75 Å resolution
197 (Figure 3A, Table 1). Surprisingly, ATP binds to Fam20A in an unusual orientation in
198 the structure. In an independent experiment, we also co-crystallized Fam20A with
199 ATP and determined the structure at 2.9 Å. The co-crystal structure is almost
200 identical to the soaked one, suggesting that the unexpected ATP-binding mode is not
201 an artifact caused by the soaking experiment.
202 In the Fam20A/ATP structure, the adenine moiety of ATP occupies a similar
203 pocket as that of ADP in the ceFam20/ADP structure; however, the entire nucleotide
204 is inverted in such a way that the ribose is turned “upside down”, and the phosphate
205 groups point to the opposite direction, reaching to the Nα2 helix (Figure 3B, 3C).
206 The adenine ring of ATP is sandwiched by several hydrophobic residues in Fam20A,
207 including Met235 and Phe343 from the top, and Pro279, Leu344, and Leu429 from
10 208 the bottom (Figure 3C). It also forms three hydrogen bonds with the side chain of
209 Ser341 and the main chain atoms of Ala342 and Leu344. The ribose is coordinated
210 by Arg352. The triphosphate group, especially the γ-phosphate, is surrounded by
211 extensive salt-bridge and hydrogen-bond interactions contributed by Tyr125 and
212 Lys129 from the Nα2 helix, as well as Lys233, Ser346, and the main chain amide
213 group of Leu347.
214 To confirm the inverted ATP-binding mode of Fam20A, we performed a
215 series of mutagenesis experiments. We have previously shown that the adenine
216 nucleotide binds to Fam20C in the conventional conformation, and is coordinated by
217 a number of conserved residues, including Lys271Fam20C and Asp478Fam20C (Xiao et
218 al., 2013). Lys271Fam20C is one of the two critical Lys that are involved in binding to
219 the phosphate groups of the adenine nucleotide. Asp478Fam20C aligns with the DFG
220 Asp in canonical kinases and is involved in binding to the metal ions that engage the
221 phosphate groups of ATP. Indeed, neither Fam20C-K271A nor Fam20C-D478A
222 mutant could bind ATP, as shown by the thermal stability shift assay (Figure 3D).
223 This is consistent with our previous result to show that these mutants have greatly
224 diminished kinase activity. In contrast, substitution of the corresponding residues
225 in Fam20A (Lys223Fam20A and Asp430Fam20A, respectively) with Ala has little effect
226 on the ability of Fam20A to bind ATP (Figure 3D). Furthermore, we generated
227 several Fam20A mutants to test the importance of residues involved in ATP-binding,
228 including Fam20A-K129A, Fam20A-K233A, Fam20A-M235W, and Fam20A-S346E.
229 Lys129Fam20A and Lys233Fam20A interact with the phosphate groups of ATP and help
230 maintain the ATP in the inverted orientation (Figure 3C). In addition, substituting
11 231 Met235Fam20A that is positioned near the ATP binding site with a bulkier Trp would
232 interfere with adenine binding. Finally, mutating Ser346Fam20A to a negatively
233 charged Glu would likely repel the phosphate groups of ATP. All four mutants
234 showed attenuated ATP binding as compared to the wildtype protein (Figure 3E).
235 Taken together, these mutation results corroborate our structural analyses,
236 demonstrating that Fam20A binds ATP in a novel, inverted conformation that is
237 fundamentally different from Fam20C and other kinases.
238
239 Dimerization of Fam20A
240 Fam20A dimerizes/oligomerizes in solution in a concentration-dependent
241 manner (Figure 4A). Also, V5-tagged Fam20A, but not Fam20B, co-
242 immunoprecipitated with Flag-tagged Fam20A when co-expressed in U2OS cells,
243 suggesting that Fam20A can form dimers/oligomers in the cell (Figure 4B). In the
244 crystal, Fam20A forms a symmetrical, face-to-face dimer (Figure 4C). Each molecule
245 in the dimer buries a ~2000 Å2 interface, which accounts for 9.5% of its total
246 solvent-accessible surfaces. The dimer is mediated by a number of hydrogen bonds
247 and hydrophobic interactions between the two protomers (Figure 4-figure
248 supplement 1). The Kβ1-Kβ2 loop from the two molecules facing each other, and the
249 two pairs of short helices Kα2A and Kα2B are involved in forming a small four-helix
250 bundle. The Kβ3-Kα3 loop of each protomer docks onto the C-lobe of the other
251 protomer in the dimer (Figure 4C). In particular, Val249, Phe251, and Phe254
252 protrude out of the Kβ3-Kα3 loop to make strong hydrophobic contacts with the
253 other molecule.
12 254 To determine whether the dimer interface seen in the crystal is important for
255 Fam20A function, we substituted Val249, Phe251 and Phe254 with Ala (Fam20A-
256 AAA). As demonstrated by the coimmunoprecipitation experiment, interaction
257 between Flag-tagged Fam20A-AAA and V5-tagged Fam20A-AAA was significantly
258 reduced compared to that between wild-type Fam20A (Figure 4B). Secretion of
259 Fam20A-AAA was not obviously changed, suggesting that the mutations did not
260 dramatically affect protein folding or stability (Figure 4D). Importantly, Fam20A-
261 AAA showed impaired interaction with Fam20C (Figure 4E). Consistently, it failed
262 to enhance Fam20C kinase activity in vitro (Figure 4F, 4G), nor could it increase
263 Fam20C-catalyzed OPN phosphorylation in the cell (Figure 4H). Taken together, our
264 results demonstrate that an intact dimer interface reported here is critical for
265 Fam20A to bind Fam20C and allosterically enhance Fam20C activity.
266
267 Discussion
268 The lumen of the endoplasmic reticulum as well as the Golgi apparatus is
269 oxidative in nature. In order to adapt to this environment, secretory pathway
270 proteins often form disulfide bonds to stabilize their structures. The crystal
271 structure of Fam20A reveals two unique disulfide bonds as compared to Fam20C,
272 which are mediated by a Fam20A-specific, evolutionarily conserved insertion.
273 Remarkably, loss of this insertion due to abnormal mRNA splicing caused AI in a
274 patient. Thus, compared to its close paralog Fam20C, Fam20A appears to have
275 “redesigned” its disulfide pattern to achieve a kinase-independent function.
13 276 It is not uncommon for a pseudokinase to bind ATP. A number of
277 pseudokinase structures have been determined with nucleotide bound, including
278 HER3, STRADα, ILK, RNase L, and the JH2 domains of the JAK kinases
279 (Bandaranayake et al., 2012, Fukuda et al., 2009, Han et al., 2014, Huang et al., 2014,
280 Jura et al., 2009, Min et al., 2015, Shi et al., 2010, Zeqiraj et al., 2009, Littlefield et al.,
281 2014). Among them, STRADα also binds ATP in a cation-independent manner.
282 Notably, like Fam20A, STRADα also utilizes positively charged residues to engage
283 the phosphate groups of ATP (Zeqiraj et al., 2009). This strategy could be used by
284 other pseudokinases that bind nucleotides without cations, such as MLKL (Murphy
285 et al., 2014b, Murphy et al., 2013, Murphy et al., 2014a). The Ca2+/calmodulin-
286 activated Ser-Thr kinase (CASK) also binds ATP without cations, although it appears
287 to possess some catalytic activity and function as an atypical kinase rather than a
288 pseudokinase (Mukherjee et al., 2008). The concentration of free cytoplasmic Mg2+
289 is on the order of 1 mM, and it is generally believed that ATP exists in the cell mostly
290 in a complex with Mg2+. However, these studies suggest that free ATP also plays a
291 role in various biological systems. A recent study has measured the cellular ATP and
292 Mg2+/ATP concentrations using 31P-NMR spectroscopy, and demonstrated that
293 these two forms of ATP are present at ~54 μM and ~400 μM in the cytosol,
294 respectively, and have a constant ratio of 0.135 (Gout et al., 2014). Although the
295 concentrations of Mg2+ (or Mn2+), ATP, and Mg2+/ATP (Mn2+/ATP) in the secretory
296 pathway are less clear, our results show that Fam20A can bind free ATP with a high
app 297 affinity (Kd ≈ 3 μM). Therefore, the divalent cation independent ATP-binding of
298 Fam20A is likely a physiologically relevant phenomenon.
14 299 What is unique about Fam20A is that it binds ATP in an inverted manner,
300 which is first seen for a kinase. With the phosphates pointing away from the kinase
301 domain, the Fam20A/ATP complex is unlikely catalytically competent. Nevertheless,
302 our results show that ATP binding stabilizes Fam20A structure and improves the
303 conformation homogeneity of the Fam20A/Fam20C complex. This is again
304 reminiscent of the pseudokinase STRADα, which requires the binding of ATP to
305 promote the assembly of the LKB1-MO25-STRADα complex and activate the kinase
306 activity of LKB1 (Zeqiraj et al., 2009). Although binding of ATP to Fam20A results in
307 few conformational changes in the crystal structures we reported here, the presence
308 of ATP greatly increases the melting temperature of Fam20A. It is likely that
309 without ATP, the structure of Fam20A is more flexible and less stable. Binding of
310 ATP may help stabilize the conformation of Fam20A by mediating additional
311 interactions between the kinase core and the N-terminal segment.
312 The Fam20A/Fam20C complex appears to be a tetramer that contains two
313 molecules of Fam20A and two molecules of Fam20C (Cui et al., 2015). Here we show
314 that Fam20A forms a dimer in the crystal, and residues in the dimer interface are
315 critical for Fam20A to bind and activate Fam20C. At this stage, it remains unclear
316 whether this Fam20A dimer also exists in the Fam20A/Fam20C tetramer. It is
317 possible that the Fam20A dimer seen here serves as a platform to allow the docking
318 of Fam20C and assembly of the complex. However, we cannot rule out the
319 possibility that the Fam20A dimer in the crystal is not physiological, and the surface
320 mediating Fam20A dimerization is actually used to interact with Fam20C directly. A
321 high-resolution Fam20A/Fam20C complex structure is ultimately needed to
15 322 elucidate how Fam20A interacts with Fam20C and allosterically regulates Fam20C
323 activity.
324 In conclusion, we have solved the crystal structure of Fam20A, a secretory
325 pathway pseudokinase. We have identified a novel mode of ATP binding and a
326 unique disulfide pattern that is indispensable for Fam20A function. Our results
327 expand the diversity of protein kinases and shed light on the molecular pathology of
328 diseases caused by mutations in Fam20A.
329
16 330 Materials and Methods
331 Protein Expression and Purification. DNA fragment encoding Human Fam20A
332 residues 69-529 was cloned into a modified pI-secSUMOstar vector (LifeSensors)
333 containing a tobacco etch virus (TEV) protease cleavage site. Bacmids were
334 generated using the Bac-to-Bac system (Invitrogen). Recombinant baculoviruses
335 were generated and amplified using the Sf21 insect cells (RRID: CVCL_0518),
336 maintained in the SIM SF medium (Sino Biological Inc.). For protein production, Hi5
337 cells (RRID: CVCL_C190) grown in the SIM HF medium (Sino Biological Inc.) were
338 infected at a density of 1.5-2.0 x 106 cells/ml. 48 hours post infection, 2 liters of
339 conditioned medium were collected by centrifugation at 200x g. The medium was
340 concentrated using a Hydrosart Ultrafilter (Sartorius) and exchanged into the
341 binding buffer containing 25 mM Tris-HCl, pH 8.0, 200 mM NaCl. The proteins were
342 then purified using the Ni-NTA resin (GE healthcare). The N-terminal 6xHis-SUMO
343 fusion tag was removed by the TEV protease. Untagged Fam20A was further
344 purified by the anion exchange chromatography using a Resource Q column (GE
345 healthcare), followed by the size-exclusion chromatography using a Superdex 200
346 increase 10/300 GL column (GE healthcare).
347
348 Thermal stability shift assay. For the thermal stability shift assays, proteins were
349 diluted to a final concentration of 2 μM in a buffer containing 20 mM HEPES, pH 7.5,
350 100 mM NaCl. Different concentrations of nucleotides or metal ions were added as
351 indicated. SYPRO Orange dye (Molecular Probes, S6650) was added to a final
352 concentration of 5× to monitor protein denaturation. Thermal scanning (25–85°C at
17 353 0.6°C/min) was performed using a LightCycler 480 System (Roche) with the
354 combination filters of 465 nm (excitation) and 580 nm (emission). Data were
355 analyzed using the software provided by the manufacture.
356
357 Crystallization. Fam20A in 20 mM HEPES, pH 7.5, 100 mM NaCl was concentrated
358 to 7 mg/ml and used for crystallization. The crystals were grown at 20°C using the
359 hanging-drop vapor-diffusion method. The precipitant solution contained 1.7 M
360 ammonium sulfate, 0.1 M HEPES, pH 7.5, and 6% (w/v) PEG 400. The crystals
361 reached full size in 10-14 days, and were then transferred into a cryo-protection
362 solution containing 20% (v/v) glycerol, 1.7 M ammonium sulfate, 0.1 M HEPES, pH
363 7.5, and 6% (w/v) PEG 400 and flash-frozen in liquid nitrogen. To obtain the ATP-
364 bound structure, both co-crystallization and soaking experiments were performed.
365 For co-crystallization, Fam20A protein solution was supplemented with 20 mM ATP
366 before mixed with above precipitant solution and crystallized. For soaking, the apo
367 crystal obtained above was soaked in the cryo-protection solution supplemented
368 with 10 mM ATP for 1 hour before frozen.
369
370 Data Collection and Structure Determination. Diffraction data were collected at
371 Shanghai Synchrotron Radiation Facility beamline BL17U and processed with
372 HKL2000 (HKL Research). The structure of Fam20A was determined by molecular
373 replacement using the ceFam20 structure as the search model in Phaser (McCoy et
374 al., 2007, RRID: SCR_014219). The structural model was then manually built in Coot
375 (Emsley et al., 2010, RRID: SCR_014222) and refined with Phenix (Adams et al.,
18 376 2010, RRID: SCR_014224). Five percent randomly selected reflections were used for
377 cross-validation (Brunger et al., 1998).
378
379 Bioinformatics and structural analysis. Multiple sequence alignment was
380 performed using PROMALS3D (Pei et al., 2008). Structural alignment between
381 Fam20A and ceFam20 was performed using Dali server (Holm and Rosenstrom,
382 2010, RRID: SCR_013433). Interaction between the two protomers in the Fam20A
383 dimer was analyzed using DIMPLOT (Laskowski and Swindells, 2011). Molecular
384 graphics were prepared using PyMol (Schrö dinger, LLC., RRID: SCR_000305).
385
386 Negative stain grid preparation & electron microscopy. FAM20A/20C
387 complexes were mixed with or without ATP and further purified using size
388 exclusion chromatography. After determining the concentration of peak fractions,
389 we diluted the sample in gel filtration buffer to 40 nM and incubated on continuous
390 carbon grids (Electron Microscopy Sciences, CF400-Cu) for 30 seconds. After
391 incubation, the grid was transferred directly onto 5x75 µl droplets of 2% uranyl
392 acetate and then blotted dry.
393 Negative stain grids were imaged on an Tecnai Sphera (FEI Company, Hillsboro, OR)
394 at 200 kV using a US4000 CCD detector (Gatan Inc., Pleaston, CA) with the Leginon
395 automated data collection software (Suloway et al., 2005) over a defocus range of 1
396 – 2.5 µm and a dose of 40 e-/Å2 at a nominal magnification of 62,000X (1.90 Å/pix).
397 93 micrographs were collected from the –ATP grid and 88 micrographs were
19 398 collected from the +ATP grid, representative micrographs are shown in Figure 2-
399 figure supplement 2.
400
401 Single particle image analysis. The Appion processing pipeline was used for
402 particle picking & extraction, as well as CTF estimation (Lander et al., 2009). For
403 each dataset, particles were initially picked using DoG Picker (Voss et al., 2009),
404 extracted at a pixel size of 3.80 Å/pix (64 x 64 pixels), and subjected to 2D
405 classification using Imagic (van Heel et al., 1996). From the resulting class averages,
406 representative class averages were used to re-pick particles using template-based
407 picking with FindEM (Roseman, 2004). The CTF for each micrograph was estimated
408 using CTFFIND4 (Rohou and Grigorieff, 2015). Particles were extracted from phase
409 flipped micrographs and binned to a pixel size of 3.80 Å/pix (64 x 64 pixels). This
410 yielded 6,051 particles for the “ATP-” dataset and 9,116 particles for the “ATP+”
411 dataset. 2D class averages shown in Figure 2-figure supplement 1 were calculated
412 from iterative rounds of 2D classification and alignment using Imagic (van Heel et
413 al., 1996) to finish with approximately 100 particles per 2D average.
414 For the alignment of “ATP-” and “ATP+” class averages in Figure 2F, SPIDER (Frank
415 et al., 1996) was used to find the highest cross correlation score between class
416 averages from each dataset. Following this comparison, the best matching pair were
417 aligned and shown in Figure 2F to illustrate the overall size difference between the
418 two datasets.
419
20 420 Others. In vitro kinase assay, mammalian cell culture, transfection,
421 immunoprecipitation, 32P orthophosphate metabolic labeling, as well as the
422 antibodies used in this study were described previously (Cui et al., 2015). U2OS
423 cells (RRID: CVCL_0042) were originally obtained from and authenticated by the
424 American Type Culture Collection (ATCC). Rabbit anti-V5 polyclonal antibody
425 (Millipore, AB3792; RRID: AB_91591) was used for immunoprecipitation.
426 Monoclonal anti-V5 antibody (Thermo Fisher Scientific, R960-25; RRID:
427 AB_2556564) and anti-FLAG antibody (Sigma, F3165; RRID: AB_259529) were used
428 for Western blotting.
429
430
21 431 Acknowledgments
432 We are grateful to staff members of Shanghai Synchrotron Radiation Facility 433 (beamline BL17U) for assistance in X-ray data collection. We thank Brenden Park 434 and Natalie Chen for their technical support, and Hongwei Guo for the access of the 435 Real-Time PCR machine. We thank Carolyn Worby, Xing Guo, Ping Zhang, and 436 members of the Xiao and Dixon laboratories for insightful discussions and 437 comments regarding the manuscript. 438 439 Funding
440 This work was supported by the National Science Foundation of China (31570735) 441 and the National Key Research & Development Plan (2016YFC0906000) to J.X., the 442 National Institutes of Health Grants (DK018849 and DK018024) as well as funds 443 from the Howard Hughes Medical Institute to J.E.D., and the Human Frontier Science 444 Program fellowship (LT000659/2013-L) to J.C.. M.A.C. is an HHMI Fellow of the 445 Damon Runyon Cancer Research Foundation (DRG 2171-13). 446 The funders had no role in study design, data collection and interpretation, or the 447 decision to submit the work for publication. 448 449
22 450 References
451 Acevedo AC, Poulter JA, Alves PG, de Lima CL, Castro LC, Yamaguti PM, Paula LM, 452 Parry DA, Logan CV, Smith CE, Johnson CA, Inglehearn CF and Mighell AJ. 2015. 453 Variability of systemic and oro-dental phenotype in two families with non-lethal 454 Raine syndrome with FAM20C mutations. BMC Med Genet 16:8. doi: 455 10.1186/s12881-015-0154-5. 456 Adams PD, Afonine PV, Bunkoczi G, Chen VB, Davis IW, Echols N, Headd JJ, Hung LW, 457 Kapral GJ, Grosse-Kunstleve RW, McCoy AJ, Moriarty NW, Oeffner R, Read RJ, 458 Richardson DC, Richardson JS, Terwilliger TC and Zwart PH. 2010. PHENIX: a 459 comprehensive Python-based system for macromolecular structure solution. Acta 460 Crystallogr D Biol Crystallogr 66:213-21. doi: 10.1107/S0907444909052925. 461 Bandaranayake RM, Ungureanu D, Shan Y, Shaw DE, Silvennoinen O and Hubbard 462 SR. 2012. Crystal structures of the JAK2 pseudokinase domain and the pathogenic 463 mutant V617F. Nat Struct Mol Biol 19:754-9. doi: 10.1038/nsmb.2348. 464 Boudeau J, Miranda-Saavedra D, Barton GJ and Alessi DR. 2006. Emerging roles of 465 pseudokinases. Trends in cell biology 16:443-52. doi: 10.1016/j.tcb.2006.07.003. 466 Brunger AT, Adams PD, Clore GM, DeLano WL, Gros P, Grosse-Kunstleve RW, Jiang 467 JS, Kuszewski J, Nilges M, Pannu NS, Read RJ, Rice LM, Simonson T and Warren GL. 468 1998. Crystallography & NMR system: A new software suite for macromolecular 469 structure determination. Acta Crystallogr D Biol Crystallogr 54:905-21. doi: 470 10.1107/S0907444998003254. 471 Cabral RM, Kurban M, Rothman L, Wajid M, Shimomura Y, Petukhova L and 472 Christiano AM. 2013. Autosomal recessive gingival hyperplasia and dental 473 anomalies caused by a 29-base pair duplication in the FAM20A gene. Journal of 474 human genetics 58:566-7. doi: 10.1038/jhg.2013.44. 475 Cherkaoui Jaouad I, El Alloussi M, Chafai El Alaoui S, Laarabi FZ, Lyahyai J and 476 Sefiani A. 2015. Further evidence for causal FAM20A mutations and first case of 477 amelogenesis imperfecta and gingival hyperplasia syndrome in Morocco: a case 478 report. BMC Oral Health 15:14. doi: 10.1186/1472-6831-15-14. 479 Cho SH, Seymen F, Lee KE, Lee SK, Kweon YS, Kim KJ, Jung SE, Song SJ, Yildirim M, 480 Bayram M, Tuna EB, Gencay K and Kim JW. 2012. Novel FAM20A mutations in 481 hypoplastic amelogenesis imperfecta. Human mutation 33:91-4. doi: 482 10.1002/humu.21621. 483 Cui J, Xiao J, Tagliabracci VS, Wen J, Rahdar M and Dixon JE. 2015. A secretory kinase 484 complex regulates extracellular protein phosphorylation. Elife 4:e06120. doi: 485 10.7554/eLife.06120. 486 Elalaoui SC, Al-Sheqaih N, Ratbi I, Urquhart JE, O'Sullivan J, Bhaskar S, Williams SS, 487 Elalloussi M, Lyahyai J, Sbihi L, Cherkaoui Jaouad I, Sbihi A, Newman WG and Sefiani 488 A. 2016. Non lethal Raine syndrome and differential diagnosis. Eur J Med Genet 489 59:577-83. doi: 10.1016/j.ejmg.2016.09.018.
23 490 Emsley P, Lohkamp B, Scott WG and Cowtan K. 2010. Features and development of 491 Coot. Acta Crystallogr D Biol Crystallogr 66:486-501. doi: 492 10.1107/S0907444910007493. 493 Eswaran J, Patnaik D, Filippakopoulos P, Wang F, Stein RL, Murray JW, Higgins JM 494 and Knapp S. 2009. Structure and functional characterization of the atypical human 495 kinase haspin. Proceedings of the National Academy of Sciences of the United States of 496 America 106:20198-203. doi: 10.1073/pnas.0901989106. 497 Fradin M, Stoetzel C, Muller J, Koob M, Christmann D, Debry C, Kohler M, Isnard M, 498 Astruc D, Desprez P, Zorres C, Flori E, Dollfus H and Doray B. 2011. Osteosclerotic 499 bone dysplasia in siblings with a Fam20C mutation. Clinical genetics 80:177-83. doi: 500 10.1111/j.1399-0004.2010.01516.x. 501 Frank J, Radermacher M, Penczek P, Zhu J, Li Y, Ladjadj M and Leith A. 1996. SPIDER 502 and WEB: processing and visualization of images in 3D electron microscopy and 503 related fields. J Struct Biol 116:190-9. doi: 10.1006/jsbi.1996.0030. 504 Fukuda K, Gupta S, Chen K, Wu C and Qin J. 2009. The pseudoactive site of ILK is 505 essential for its binding to alpha-Parvin and localization to focal adhesions. Mol Cell 506 36:819-30. doi: 10.1016/j.molcel.2009.11.028. 507 Gout E, Rebeille F, Douce R and Bligny R. 2014. Interplay of Mg2+, ADP, and ATP in 508 the cytosol and mitochondria: unravelling the role of Mg2+ in cell respiration. Proc 509 Natl Acad Sci U S A 111:E4560-7. doi: 10.1073/pnas.1406251111. 510 Han Y, Donovan J, Rath S, Whitney G, Chitrakar A and Korennykh A. 2014. Structure 511 of human RNase L reveals the basis for regulated RNA decay in the IFN response. 512 Science 343:1244-8. doi: 10.1126/science.1249845. 513 Holm L and Rosenstrom P. 2010. Dali server: conservation mapping in 3D. Nucleic 514 Acids Res 38:W545-9. doi: 10.1093/nar/gkq366. 515 Huang H, Zeqiraj E, Dong B, Jha BK, Duffy NM, Orlicky S, Thevakumaran N, Talukdar 516 M, Pillon MC, Ceccarelli DF, Wan LC, Juang YC, Mao DY, Gaughan C, Brinton MA, 517 Perelygin AA, Kourinov I, Guarne A, Silverman RH and Sicheri F. 2014. Dimeric 518 structure of pseudokinase RNase L bound to 2-5A reveals a basis for interferon- 519 induced antiviral activity. Mol Cell 53:221-34. doi: 10.1016/j.molcel.2013.12.025. 520 Jaureguiberry G, De la Dure-Molla M, Parry D, Quentric M, Himmerkus N, Koike T, 521 Poulter J, Klootwijk E, Robinette SL, Howie AJ, Patel V, Figueres ML, Stanescu HC, 522 Issler N, Nicholson JK, Bockenhauer D, Laing C, Walsh SB, McCredie DA, Povey S, 523 Asselin A, Picard A, Coulomb A, Medlar AJ, Bailleul-Forestier I, Verloes A, Le Caignec 524 C, Roussey G, Guiol J, Isidor B, Logan C, Shore R, Johnson C, Inglehearn C, Al-Bahlani 525 S, Schmittbuhl M, Clauss F, Huckert M, Laugel V, Ginglinger E, Pajarola S, Sparta G, 526 Bartholdi D, Rauch A, Addor MC, Yamaguti PM, Safatle HP, Acevedo AC, Martelli- 527 Junior H, dos Santos Netos PE, Coletta RD, Gruessel S, Sandmann C, Ruehmann D, 528 Langman CB, Scheinman SJ, Ozdemir-Ozenen D, Hart TC, Hart PS, Neugebauer U, 529 Schlatter E, Houillier P, Gahl WA, Vikkula M, Bloch-Zupan A, Bleich M, Kitagawa H, 530 Unwin RJ, Mighell A, Berdal A and Kleta R. 2012. Nephrocalcinosis (enamel renal
24 531 syndrome) caused by autosomal recessive FAM20A mutations. Nephron. Physiology 532 122:1-6. doi: 10.1159/000349989. 533 Jura N, Shan Y, Cao X, Shaw DE and Kuriyan J. 2009. Structural analysis of the 534 catalytically inactive kinase domain of the human EGF receptor 3. Proc Natl Acad Sci 535 U S A 106:21608-13. doi: 10.1073/pnas.0912101106. 536 Kantaputra PN, Bongkochwilawan C, Kaewgahya M, Ohazama A, Kayserili H, Erdem 537 AP, Aktoren O and Guven Y. 2014a. Enamel-renal-gingival syndrome, hypodontia, 538 and a novel FAM20A mutation. American journal of medical genetics. Part A. doi: 539 10.1002/ajmg.a.36579. 540 Kantaputra PN, Bongkochwilawan C, Lubinsky M, Pata S, Kaewgahya M, Tong HJ, 541 Ketudat Cairns JR, Guven Y and Chaisrisookumporn N. 2017. Periodontal disease 542 and FAM20A mutations. Journal of human genetics. doi: 10.1038/jhg.2017.26. 543 Kantaputra PN, Kaewgahya M, Khemaleelakul U, Dejkhamron P, Sutthimethakorn S, 544 Thongboonkerd V and Iamaroon A. 2014b. Enamel-renal-gingival syndrome and 545 FAM20A mutations. American journal of medical genetics. Part A 164A:1-9. doi: 546 10.1002/ajmg.a.36187. 547 Koike T, Izumikawa T, Tamura J and Kitagawa H. 2009. FAM20B is a kinase that 548 phosphorylates xylose in the glycosaminoglycan-protein linkage region. The 549 Biochemical journal 421:157-62. doi: 10.1042/BJ20090474. 550 Kung JE and Jura N. 2016. Structural Basis for the Non-catalytic Functions of Protein 551 Kinases. Structure 24:7-24. doi: 10.1016/j.str.2015.10.020. 552 Lander GC, Stagg SM, Voss NR, Cheng A, Fellmann D, Pulokas J, Yoshioka C, Irving C, 553 Mulder A, Lau PW, Lyumkis D, Potter CS and Carragher B. 2009. Appion: an 554 integrated, database-driven pipeline to facilitate EM image processing. J Struct Biol 555 166:95-102. doi. 556 Laskowski RA and Swindells MB. 2011. LigPlot+: multiple ligand-protein interaction 557 diagrams for drug discovery. J Chem Inf Model 51:2778-86. doi: 558 10.1021/ci200227u. 559 Littlefield P, Moasser MM and Jura N. 2014. An ATP-competitive inhibitor modulates 560 the allosteric function of the HER3 pseudokinase. Chem Biol 21:453-8. doi: 561 10.1016/j.chembiol.2014.02.011. 562 Manning G, Whyte DB, Martinez R, Hunter T and Sudarsanam S. 2002. The protein 563 kinase complement of the human genome. Science 298:1912-34. doi: 564 10.1126/science.1075762. 565 McCoy AJ, Grosse-Kunstleve RW, Adams PD, Winn MD, Storoni LC and Read RJ. 566 2007. Phaser crystallographic software. J Appl Crystallogr 40:658-74. doi: 567 10.1107/S0021889807021206. 568 Min X, Lee BH, Cobb MH and Goldsmith EJ. 2004. Crystal structure of the kinase 569 domain of WNK1, a kinase that causes a hereditary form of hypertension. Structure 570 12:1303-11. doi: 10.1016/j.str.2004.04.014.
25 571 Min X, Ungureanu D, Maxwell S, Hammaren H, Thibault S, Hillert EK, Ayres M, 572 Greenfield B, Eksterowicz J, Gabel C, Walker N, Silvennoinen O and Wang Z. 2015. 573 Structural and Functional Characterization of the JH2 Pseudokinase Domain of JAK 574 Family Tyrosine Kinase 2 (TYK2). J Biol Chem 290:27261-70. doi: 575 10.1074/jbc.M115.672048. 576 Mukherjee K, Sharma M, Urlaub H, Bourenkov GP, Jahn R, Sudhof TC and Wahl MC. 577 2008. CASK Functions as a Mg2+-independent neurexin kinase. Cell 133:328-39. 578 doi: 10.1016/j.cell.2008.02.036. 579 Murphy JM, Czabotar PE, Hildebrand JM, Lucet IS, Zhang JG, Alvarez-Diaz S, Lewis R, 580 Lalaoui N, Metcalf D, Webb AI, Young SN, Varghese LN, Tannahill GM, Hatchell EC, 581 Majewski IJ, Okamoto T, Dobson RC, Hilton DJ, Babon JJ, Nicola NA, Strasser A, Silke J 582 and Alexander WS. 2013. The pseudokinase MLKL mediates necroptosis via a 583 molecular switch mechanism. Immunity 39:443-53. doi: 584 10.1016/j.immuni.2013.06.018. 585 Murphy JM, Lucet IS, Hildebrand JM, Tanzer MC, Young SN, Sharma P, Lessene G, 586 Alexander WS, Babon JJ, Silke J and Czabotar PE. 2014a. Insights into the evolution 587 of divergent nucleotide-binding mechanisms among pseudokinases revealed by 588 crystal structures of human and mouse MLKL. Biochem J 457:369-77. doi: 589 10.1042/BJ20131270. 590 Murphy JM, Zhang Q, Young SN, Reese ML, Bailey FP, Eyers PA, Ungureanu D, 591 Hammaren H, Silvennoinen O, Varghese LN, Chen K, Tripaydonis A, Jura N, Fukuda 592 K, Qin J, Nimchuk Z, Mudgett MB, Elowe S, Gee CL, Liu L, Daly RJ, Manning G, Babon JJ 593 and Lucet IS. 2014b. A robust methodology to subclassify pseudokinases based on 594 their nucleotide-binding properties. The Biochemical journal 457:323-34. doi: 595 10.1042/BJ20131174. 596 Nalbant D, Youn H, Nalbant SI, Sharma S, Cobos E, Beale EG, Du Y and Williams SC. 597 2005. FAM20: an evolutionarily conserved family of secreted proteins expressed in 598 hematopoietic cells. BMC Genomics 6:11. doi: 10.1186/1471-2164-6-11. 599 O'Sullivan J, Bitu CC, Daly SB, Urquhart JE, Barron MJ, Bhaskar SS, Martelli-Junior H, 600 dos Santos Neto PE, Mansilla MA, Murray JC, Coletta RD, Black GC and Dixon MJ. 601 2011. Whole-Exome sequencing identifies FAM20A mutations as a cause of 602 amelogenesis imperfecta and gingival hyperplasia syndrome. American journal of 603 human genetics 88:616-20. doi: 10.1016/j.ajhg.2011.04.005. 604 Pei J, Kim BH and Grishin NV. 2008. PROMALS3D: a tool for multiple protein 605 sequence and structure alignments. Nucleic Acids Res 36:2295-300. doi: 606 10.1093/nar/gkn072. 607 Rafaelsen SH, Raeder H, Fagerheim AK, Knappskog P, Carpenter TO, Johansson S and 608 Bjerknes R. 2013. Exome sequencing reveals FAM20c mutations associated with 609 fibroblast growth factor 23-related hypophosphatemia, dental anomalies, and 610 ectopic calcification. Journal of bone and mineral research : the official journal of the 611 American Society for Bone and Mineral Research 28:1378-85. doi: 612 10.1002/jbmr.1850.
26 613 Rohou A and Grigorieff N. 2015. CTFFIND4: Fast and accurate defocus estimation 614 from electron micrographs. J Struct Biol 192:216-21. doi: 615 10.1016/j.jsb.2015.08.008. 616 Roseman AM. 2004. FindEM--a fast, efficient program for automatic selection of 617 particles from electron micrographs. J Struct Biol 145:91-9. doi. 618 Shaw AS, Kornev AP, Hu J, Ahuja LG and Taylor SS. 2014. Kinases and 619 pseudokinases: lessons from RAF. Molecular and cellular biology 34:1538-46. doi: 620 10.1128/MCB.00057-14. 621 Shi F, Telesco SE, Liu Y, Radhakrishnan R and Lemmon MA. 2010. ErbB3/HER3 622 intracellular domain is competent to bind ATP and catalyze autophosphorylation. 623 Proc Natl Acad Sci U S A 107:7692-7. doi: 10.1073/pnas.1002753107. 624 Simpson MA, Hsu R, Keir LS, Hao J, Sivapalan G, Ernst LM, Zackai EH, Al-Gazali LI, 625 Hulskamp G, Kingston HM, Prescott TE, Ion A, Patton MA, Murday V, George A and 626 Crosby AH. 2007. Mutations in FAM20C are associated with lethal osteosclerotic 627 bone dysplasia (Raine syndrome), highlighting a crucial molecule in bone 628 development. American journal of human genetics 81:906-12. doi: 10.1086/522240. 629 Sreelatha A, Kinch LN and Tagliabracci VS. 2015. The secretory pathway kinases. 630 Biochim Biophys Acta 1854:1687-93. doi: 10.1016/j.bbapap.2015.03.015. 631 Suloway C, Pulokas J, Fellmann D, Cheng A, Guerra F, Quispe J, Stagg S, Potter CS and 632 Carragher B. 2005. Automated molecular microscopy: the new Leginon system. J 633 Struct Biol 151:41-60. doi: 10.1016/j.jsb.2005.03.010. 634 Tagliabracci VS, Engel JL, Wen J, Wiley SE, Worby CA, Kinch LN, Xiao J, Grishin NV 635 and Dixon JE. 2012. Secreted kinase phosphorylates extracellular proteins that 636 regulate biomineralization. Science 336:1150-3. doi: science.1217817 [pii] 637 10.1126/science.1217817. 638 Tagliabracci VS, Pinna LA and Dixon JE. 2013a. Secreted protein kinases. Trends 639 Biochem Sci 38:121-30. doi: 10.1016/j.tibs.2012.11.008. 640 Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen 641 KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ and Dixon JE. 2015. A Single 642 Kinase Generates the Majority of the Secreted Phosphoproteome. Cell 161:1619-32. 643 doi: 10.1016/j.cell.2015.05.028. 644 Tagliabracci VS, Xiao J and Dixon JE. 2013b. Phosphorylation of substrates destined 645 for secretion by the Fam20 kinases. Biochem Soc Trans 41:1061-5. doi: 646 10.1042/BST20130059. 647 Takeyari S, Yamamoto T, Kinoshita Y, Fukumoto S, Glorieux FH, Michigami T, 648 Hasegawa K, Kitaoka T, Kubota T, Imanishi Y, Shimotsuji T and Ozono K. 2014. 649 Hypophosphatemic osteomalacia and bone sclerosis caused by a novel homozygous 650 mutation of the FAM20C gene in an elderly man with a mild variant of Raine 651 syndrome. Bone 67:56-62. doi: 10.1016/j.bone.2014.06.026.
27 652 van Heel M, Harauz G, Orlova EV, Schmidt R and Schatz M. 1996. A new generation 653 of the IMAGIC image processing system. J Struct Biol 116:17-24. doi: 654 10.1006/jsbi.1996.0004. 655 Villa F, Capasso P, Tortorici M, Forneris F, de Marco A, Mattevi A and Musacchio A. 656 2009. Crystal structure of the catalytic domain of Haspin, an atypical kinase 657 implicated in chromatin organization. Proceedings of the National Academy of 658 Sciences of the United States of America 106:20204-9. doi: 659 10.1073/pnas.0908485106. 660 Volodarsky M, Zilberman U and Birk OS. 2015. Novel FAM20A mutation causes 661 autosomal recessive amelogenesis imperfecta. Arch Oral Biol 60:919-22. doi: 662 10.1016/j.archoralbio.2015.02.018. 663 Voss NR, Yoshioka CK, Radermacher M, Potter CS and Carragher B. 2009. DoG Picker 664 and TiltPicker: software tools to facilitate particle selection in single particle 665 electron microscopy. J Struct Biol 166:205-13. doi. 666 Wang SK, Aref P, Hu Y, Milkovich RN, Simmer JP, El-Khateeb M, Daggag H, Baqain ZH 667 and Hu JC. 2013. FAM20A mutations can cause enamel-renal syndrome (ERS). PLoS 668 genetics 9:e1003302. doi: 10.1371/journal.pgen.1003302. 669 Wang SK, Reid BM, Dugan SL, Roggenbuck JA, Read L, Aref P, Taheri AP, Yeganeh MZ, 670 Simmer JP and Hu JC. 2014. FAM20A mutations associated with enamel renal 671 syndrome. Journal of dental research 93:42-8. doi: 10.1177/0022034513512653. 672 Wen J, Xiao J, Rahdar M, Choudhury BP, Cui J, Taylor GS, Esko JD and Dixon JE. 2014. 673 Xylose phosphorylation functions as a molecular switch to regulate proteoglycan 674 biosynthesis. Proc Natl Acad Sci U S A 111:15723-8. doi: 675 10.1073/pnas.1417993111. 676 Whyte MP, McAlister WH, Fallon MD, Pierpont ME, Bijanki VN, Duan S, Otaify GA, Sly 677 WS and Mumm S. 2016. Raine Syndrome (OMIM #259775), Caused By FAM20C 678 Mutation, Is Congenital Sclerosing Osteomalacia With Cerebral Calcification (OMIM 679 259660). Journal of bone and mineral research : the official journal of the American 680 Society for Bone and Mineral Research. doi: 10.1002/jbmr.3034. 681 Xiao J, Tagliabracci VS, Wen J, Kim SA and Dixon JE. 2013. Crystal structure of the 682 Golgi casein kinase. Proc Natl Acad Sci U S A 110:10574-9. doi: 683 10.1073/pnas.1309211110. 684 Zeqiraj E, Filippi BM, Goldie S, Navratilova I, Boudeau J, Deak M, Alessi DR and van 685 Aalten DM. 2009. ATP and MO25alpha regulate the conformational state of the 686 STRADalpha pseudokinase and activation of the LKB1 tumour suppressor. PLoS Biol 687 7:e1000126. doi: 10.1371/journal.pbio.1000126. 688 Zeqiraj E and van Aalten DM. 2010. Pseudokinases-remnants of evolution or key 689 allosteric regulators? Curr Opin Struct Biol 20:772-81. doi: 690 10.1016/j.sbi.2010.10.001. 691 Zhu Q, Venzke D, Walimbe AS, Anderson ME, Fu Q, Kinch LN, Wang W, Chen X, 692 Grishin NV, Huang N, Yu L, Dixon JE, Campbell KP and Xiao J. 2016. Structure of
28 693 protein O-mannose kinase reveals a unique active site architecture. Elife 5. doi: 694 10.7554/eLife.22238. 695
29 696 Legends
697 Figure 1. The structure of Fam20A reveals a unique disulfide pattern.
698 (A) Structure of human Fam20A. The N-terminal segments were colored in green.
699 The Kβ1-Kβ2, Kβ6-Kβ7, and Kβ3-Kα3 loops were colored in red, teal, and magenta,
700 respectively. The rest of the kinase core is shown in white. The side chains of
701 Cys209, Cys211, Cys319, Cys323, and Gln258 are shown as sticks. The N- and C-
702 termini of the molecule are indicated. (B) Structure of ceFam20 (PDB ID: 4KQA) is
703 shown in the same orientation as Fam20A in (A) and colored in the same color
704 scheme. The side chains Cys273, Cys277, and Glu213 are shown as sticks. The
705 active site of ceFam20 is indicated with an oval in dashed line. (C) The schematic of
706 the human Fam20A gene structure and RNA splicing. Exon 3 is highlighted in red.
707 Relevant amino acid sequences are shown at the bottom. The two Cys residues in
708 the Kβ1-Kβ2 loop are highlighted in red. (D) Effect of Fam20A exon 3 deletion on
709 OPN phosphorylation. C-terminal V5-tagged OPN was expressed alone or co-
710 expressed with Flag-tagged Fam20A WT or Δexon3 in U2OS cells that were
711 metabolically labeled with 32P orthophosphate. OPN-V5 was immunoprecipitated
712 from the medium. Total OPN and 32P incorporation were detected by anti-V5
713 immunoblotting and autoradiography. Expression of Fam20A was monitored by
714 anti-Flag immunoblotting. (E) Effect of exon 3 deletion on Fam20A secretion. Flag-
715 tagged Fam20A WT or Δexon3 was expressed in U2OS cells and
716 immunoprecipitated from conditioned media using anti-Flag antibody. (F) Effect of
717 C209A/C211A mutation (CC/AA) on Fam20A secretion and OPN phosphorylation.
718
30 719 Figure 1-figure supplement 1. Sequence alignment of Fam20A, Fam20C, and
720 ceFam20 in the kinase core region.
721 The Kβ1-Kβ2, Kβ6-Kβ7, and Kβ3-Kα3 loops of the three proteins are highlighted in
722 red, teal, and magenta, respectively. The Cys residues are highlighted in orange.
723 Disulfide bonds conserved in Fam20A and ceFam20 are indicated with black dots
724 and lines. Disulfide bonds specific for Fam20A or ceFam20 are indicated with
725 orange dots and lines. The secondary structures of Fam20A and ceFam20 are
726 shown above and below the sequence blocks, respectively. Residues in Fam20A that
727 are involved in ATP-binding and dimer formation are highlighted with unfilled
728 rhombuses and triangles, respectively, at the top. Residues involved in binding to
729 Mn/ADP in ceFam20 are highlighted with filled gray rhombuses at the bottom.
730
731 Figure 1-figure supplement 2. Sequence alignment of Fam20A, Fam20B, and
732 Fam20C family members around the Fam20A-specific insertion region.
733 Conserved residues are highlighted with black rectangles. The Fam20A-specific
734 insertion is highlighted using a red rectangle, and the two conserved Cys are shaded
735 in red. The secondary structures of Fam20A are shown above the sequence blocks
736 and labeled.
737
738 Figure 2. Fam20A binds ATP without cations.
739 (A) Thermal stability shift assays of ATP binding to Fam20A or Fam20C in the
2+ 740 presence or absence of Mn . ATP, 250 μM; MnCl2, 1 mM. (B) Fam20A thermal
741 stability shift assay. The ΔTm values are plotted against ATP concentration. Data
31 742 points are represented as mean ± SD and fitted by non-linear regression of the
743 equation Y = ΔTm max*X/(Kd + X). (C) Thermal stability shift assays of ATP, GTP,
744 CTP or UTP binding to Fam20A or Fam20C. Nucleotide concentration is 10 μM for
745 Fam20A and 250 μM for Fam20C. (D) Thermal stability shift assays of ATP or ADP
746 binding to Fam20A without cations. Data were plotted and fitted as in (B). (E) Gel
747 filtration analyses of the Fam20A/Fam20C complex in the absence or presence of
748 250 μM ATP. (F) 2D class averages of the negatively stained Fam20A/20C
749 complexes. Representative 2D class averages of the complex assembled in the
750 presence or absence of ATP (250 μM) are shown at the same pixel size to highlight
751 the overall size changes between the two samples. Scale bar, 200 Å.
752
753 Figure 2-figure supplement 1. 2D class averages of the Fam20A/20C complex
754 assembled in the presence or absence of ATP (250 μM) determined by negative-
755 stain single particle electron microscopy. Scale bar, 200 Å.
756
757 Figure 2-figure supplement 2. Representative negative stain micrographs of the
758 Fam20A/20C complex assembled in the presence or absence of ATP (250 μM). Scale
759 bar, 200 nm.
760
761 Figure 3. ATP binds to Fam20A in an inverted orientation.
762 (A) The Fo-Fc difference electron density map (calculated before ATP is built and
763 contoured at 3σ) is shown as a green mesh, revealing the presence of ATP. Fam20A
764 is shown as ribbons and colored in the same scheme as Figure 1A (the Kβ1-Kβ2 loop
32 765 in red). The ATP molecule built afterwards is shown in sticks, and its carbon atoms
766 are colored in magenta. (B) Superimposition of Fam20A/ATP and ceFam20/ADP.
767 Fam20A and ceFam20 are shown in white and cyan, respectively. The carbons in
768 ATP and ADP are colored in magenta and cyan, respectively. (C) An enlarged image
769 of the ATP-binding pocket of Fam20A showing the detailed molecular interactions
770 with ATP. Fam20A is colored in the same scheme as in Figure 1A, with the Nα2
771 helix highlighted in green. Salt-bridge and hydrogen-bond interactions are shown
772 as dashed lines. (D) Thermal stability shift assays of ATP binding to Fam20C or
773 Fam20A. 100 μM and 250 μM ATP were used to assay Fam20A and Fam20C,
774 respectively. 5 mM MnCl2 was present in the Fam20C assay conditions. (E) Thermal
775 stability shift assays of ATP binding to Fam20A WT, K129A, K233A, S346E, and
776 M235W. Data were plotted and fitted as in Figure 2B.
777
778 Figure 4. Fam20A forms a dimer in the crystal and an intact dimer interface is
779 essential for its function.
780 (A) Fam20A dimerizes in solution in a concentration-dependent manner. 1 mg or
781 100 μg purified Fam20A (both in 500 μl) were individually loaded on a Superdex
782 200 increase 10/300 GL column (GE healthcare) and eluted using 20 mM HEPES, pH
783 7.5, and 100 mM NaCl. The peak positions of the two runs are highlighted with
784 dashed lines. The elution volumes of the molecular weight standards are indicated.
785 (B) Co-immunoprecipitation of Fam20A-Flag and Fam20A-V5 (or Fam20B-V5) from
786 U2OS cells. AAA, Fam20A V249A/F251A/F254A mutant. (C) The structure of
787 Fam20A dimer. One protomer in the dimer is shown in ribbons, and the other is
33 788 shown in surface representation. The Kβ1-Kβ2 and Kβ3-Kα3 loops are highlighted
789 in red and magenta, respectively. The rest of the two molecules are shown in white
790 and cyan. A close view of the Kβ3-Kα3 loop mediated interaction is shown on the
791 right. The side chains of Val249, Phe251, Phe254 are shown as sticks. (D) Secretion
792 of Fam20A WT and V249A/F251A/F254A. (E) Effect of V249A/F251A/F254A
793 mutation on Fam20A-Fam20C interaction. Fam20A-V5 (WT or AAA) and Fam20C-
794 Flag were co-expressed in U2OS cells and coimmunoprecipitated from the cell
795 lysate. (F and G) Effect of Fam20A-AAA on ENAM phosphorylation by Fam20C in
796 vitro. (H) Effect of Fam20A-AAA on OPN phosphorylation in metabolically 32P
797 radiolabeled U2OS cells.
798
799 Figure 4-figure supplement 1. Schematic drawing of the interactions between the
800 two protomers in the Fam20A dimer. Residues involved in forming hydrophobic
801 interactions are indicated, and the hydrophobic contacts are represented by spoked
802 arcs. Residues participating in hydrogen bonds are shown in ball-and-stick
803 representation, and the hydrogen bonds are shown as green dashed lines. Note that
804 the Fam20A dimer is symmetrical, therefore two sets of interactions shown in the
805 picture are present in the dimer structure.
806
34 807 Table 1. Data collection and refinement statistics. 808 809 Fam20A Fam20A with ATP (PDB ID: 5WRR) (PDB ID: 5WRS) Data collection Space group P 32 2 1 P 32 2 1 Cell dimensions a=156.854 Å, a=157.202 Å, b=156.854 Å, b=157.202 Å, c=143.655 Å c=144.802 Å Wavelength (Å) 0.979 1.009 Resolution (Å) 2.50 2.75
Rmerge 0.172 (1.804) 0.168 (1.470) Rpim 0.055 (0.566) 0.053 (0.472) CC1/2 (highest-resolution shell) 0.841 0.788 I / σI 28.8 (2.8) 21.2 (2.4) Completeness (%) 99.9 (100.0) 99.9 (100.0) Multiplicity 10.9 (11.1) 10.7 (10.6) Wilson B-factor 54.1 57.9
Refinement Reflections used in refinement 70216 (6906) 53997 (5329)
Reflections used for Rfree 1994 (197) 1946 (193) Rwork / Rfree 0.215 / 0.231 0.203 / 0.238 No. of non-hydrogen atoms Protein 7039 7018 Ligands 98 146 Protein residues 876 874 B-factors Protein 75.1 72.3 Ligands 116.7 101.4 R.m.s deviations Bond lengths (Å) 0.002 0.003 Bond angles (°) 0.62 1.01 Ramachandran Favored (%) 96.8 96.5 Allowed (%) 3.1 3.5 Outliers (%) 0.1 0 810 Each dataset was collected from a single crystal. Values in parentheses are for highest-resolution shell.
35 A Kβ1−Kβ2 Kβ6−Kβ7 B C319 C209 C323 Kβ3−Kα3 N C273 C277 C211 Nα2 Q258 E213
N
C C
C Genomic DNA 2 3 4
Spliced mRNA
D197YSQDEKALLGACDCTQI214 V197 Protein WT Δexon3
D OPN-V5 E F OPN-V5 20A-Flag 20A-Flag WT CC/AA WT Δexon3 20A-Flag WT Δexon3 autorad V5 IP from autorad Flag IP from medium α-V5 medium (OPN)
medium α-V5 V5 IP from V5 IP (OPN) Flag IP from
WB: α -Flag medium Lysate α-Flag α-Flag Lysate (20A) (20A) Lysate
Figure 1 Kα1 Kα2 Kβ1 Kα2A Kα2B Fam20A ss Fam20A 160 SWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVH Fam20C 225 NWLKFHIGINRYELYSRHNPAIEALLHDLSSQRITSVAMKSG------GTQ ceFam20 133 NWERFYSNIGSCSVYSD-DQMIDNLLHDLNTSPIKHVHIMDG------GTQ ceFam20 ss
Kβ2 Kβ3 Kα3 Fam20A ss Fam20A 222 LKLVLRFSDFGKAMFKPMRQQRDEETPVDFFYFIDFQRHNAEIAAFHLDRILDFRRVPPTVG Fam20C 270 LKLIMTFQNYGQALFKPMKQTREQETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAG ceFam20 177 VKFVFTFKNDKQAVFKPMRFGRDYESDPNHFYFSDFERHHAEIATFHLDRVLGFRRAIPTVG ceFam20 ss
Kβ4 Kα4 Kα5 Kβ5 Kβ6 Kα5A Kβ7 Fam20A ss Fam20A 284 RIVNVTKEILEVTKNEILQSVFFVSPASNVCFFAKCPYMCKTEYAVCGNPHLLEGSLSAFLP Fam20C 332 RMVNMTKEIRDVTRDKKLWRTFFISPANNICFYGECSYYCSTEHALCGKPDQIEGSLAAFLP ceFam20 239 RVLNMTTELFEKA-EKKLKKTFFFSPAKNFCFVSRCDYYCDTTHAICGLPDMKEGSVQVFLP ceFam20 ss
Kβ8 Kα6 Kα7 Fam20A ss Fam20A 346 SLNLAPRLSVPNPWIRSYTLA-GKEEWEVNPLYCD-TVKQIYPYNNSQRLLNVIDMAIFDFL Fam20C 394 DLSLAKRKTWRNPWRRSYHKR-KKAEWEVDPDYCE-EVKQTPPYDSSHRILDVMDMTIFDFL ceFam20 300 DESAVPRKHNRSPYRRTYSKKNQVAEWQSSMNYCTDKVKTKRQYAHGRRLLDLVDIHILDYL ceFam20 ss
Kβ9 Kα8 Kα9 Fam20A ss Fam20A 406 IGNMDRHHYEMFTKFGD-DGFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLL Fam20C 454 MGNMDRHHYETFEKFGN-ETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLL ceFam20 362 IGNQDRHHFESFNVFNDLPSYAIHLDHGRAFGRSDFDDDDIILPLRQCCILRPSTFQTLMNF ceFam20 ss
Kα10 Kα11 Kα12 Fam20A ss Fam20A 467 AQADYRLSDVMRESLLEDQLSPVLTEPHLLALDRRLQTILRTVEGCIVAHGQQSVIVDG Fam20C 515 AKEEYKLSLLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVERNGLHSVVDDD ceFam20 424 YSTPKSLTKALHESLSKDPAHPILAYKHYPAMERRLAKIMSHILECFESRGVAEVLVAE ceFam20 ss
Figure 1-figure supplement 1 Kα2 Kβ1 Kα2A Kα2B Kβ2
H.sapiens SPVVSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRF M.musculus SLAISKLLHDMRHFPTISADYSQDEKALLGACDCSQIVKPSGVHLKLVLRF Fam20A R.norvegicus SPVVSKLLHDMRHFPTISADHSQDEKALLGACDCSQIVKPSGVHLKLVLRF G.gallus SPAVSRLLRDMHDFATISADYSQDEKALLGACDCSQIVKPSGVHLKLVLRF D.rerio DSSVDTLLQDMQTDTVINADFTQDEKALKGACDCSQVVKPSGLHLKLALKL H.sapiens TPELGAVMHAMATKKIIKADVGYK------GTQLKALLIL M.musculus TPELGAIMHAMATKKIIKADVGYK------GTQLKALLIL R.norvegicus TPELGAVMHAMATKKIIKADVGYK------GTQLKALLTL Fam20B G.gallus TPELGAVMHAMSTKKIVKADVGYK------GTQLKALLIL D.rerio TPELAAVLNALATAHVERADVGYK------GTQLKALLVL D.melanogaster DSSMGQLLETLRREPITRVSNLGR------GTQLKLLVRL H.sapiens NPAIEALLHDLSSQRITSVAMKSG------GTQLKLIMTF M.musculus NPAIDALLRDLGSQKITSVAMKSG------GTQLKLIMTF R.norvegicus NPAIDALLHDLGSQKITSVAMKSG------GTQLKLIMTF Fam20C G.gallus DPLMPTLLQDLATMKIVSSVQKSG------GTQLKLIMTF D.rerio NPVITALLRDLLSQKISSVGMKSG------GTQLKLIMSF D.melanogaster DTLVDAVLRDMIKLPIQHVVQKEG------GTQLKLIIEY C.elegans DQMIDNLLHDLNTSPIKHVHIMDG------GTQVKFVFTF
Figure 1-figure supplement 2 15 12 20A 20C A 20A B C 8 6 20C ) ) no cation
C 8 10 C °
ATP ° (
( Mn
(°C ) m
ATP-Mn m 4 3 T T m T 5 4
0 0 0 0 0 50 100 P P P P Mn no cation T T T T ATP conc. (µM) ATP GTP C U ATP GTP C U
12 D E 20A/C F
) 30 30
C 8 u ° (
A 20A/C 20A ATP - m m 20A T 15 15 4 ATP ADP ATP + 0 0 0 0 50 100 10 15 ml 10 15 ml ATP/ADP conc. (µM) ATP - ATP +
Figure 2 ATP -
ATP +
Figure 2-figure supplement 1 ATP - ATP +
Figure 2-figure supplement 2 A C Nα2
ATP K233 M235 K129
F343 S341 A342 ATP S346 B Y125 P279 L347 L429 L344 R352
ATP E ADP 10 9 6 5 WT 3 WT K129A K233A
12 ) 0 0 C °
( 0 50 100 0 50 100 D m T
) 10 12 C ° ( 6 m
T 8 WT WT M235W 5 S346E 4 0 20C-WT 20A-WT 0 0 20C-K271A 20A-K223A 0 50 100 0 50 100 20C-D478A 20A-D430A ATP conc. (µM)
Figure 3 A B 20B-V5 + 20A-V5 WT WT AAA AAA 20A-Flag WT WT WT AAA AAA
α-Flag
IP: α-V5 α-V5
Lysate α-Flag C
V249
F254 F251
D E F 20A-V5 WT AAA
20A-V5 AAA WT 20C-Flag + + + 20C + 20C + 20C 20A-WT 20A-AAA α-Flag V5 IP from IP: Time (min) 0 2 5 0 2 5 0 2 5 medium α-V5 α -V5 α-V5 autorad ENAM Lysate WB: (173-277) Lysate α-Flag Coomassie G H OPN-V5
20A-Flag AAA 20A - WT AAA WT
autorad 20C + + + + + + A:C ratio - 1 1 2 5 10 α-V5 medium
autorad from V5 IP (OPN) ENAM α-Flag (173-277) Coomassie Lysate (20A)
Figure 4 Mol A/B H413 I360 E415 E442 P358 L353 V355 P356 Y377 T380 I384 M409 A204
C323 A204 F251 Y253 C211 V249 F254 Y363 T212 V215 R361 T364 Mol B/A
Figure 4-figure supplement 1