DOCSLIB.ORG

PRSS16 (NM 005865) Human Tagged ORF Clone Product Data

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
PRSS16 (NM 005865) Human Tagged ORF Clone Product Data OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC223128 PRSS16 (NM_005865) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: PRSS16 (NM_005865) Human Tagged ORF Clone Tag: Myc-DDK Symbol: PRSS16 Synonyms: TSSP Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 PRSS16 (NM_005865) Human Tagged ORF Clone – RC223128 ORF Nucleotide >RC223128 representing NM_005865 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGTCTGGCTTGCCCAGTGGCTGGGCCCTCTGCTCTTGGTTTCCCTCTGGGGACTCTTGGCTCCAG CCTCCCTTCTTAGGCGCCTGGGTGAGCACATTCAGCAGTTTCAGGAGAGCTCTGCCCAGGGCCTGGGCCT GAGCCTGGGGCCAGGTGCTGCAGCCCTCCCAAAAGTGGGGTGGCTGGAGCAACTGCTGGACCCCTTCAAC GTGTCCGACAGACGATCCTTCCTACAGCGTTACTGGGTGAATGACCAACATTGGGTTGGCCAGGATGGAC CCATATTCCTGCATCTAGGGGGTGAGGGCAGCCTTGGGCCTGGCTCAGTGATGAGAGGCCATCCCGCAGC CTTGGCCCCAGCCTGGGGCGCCCTGGTGATAAGCCTGGAACACAGATTTTATGGCCTGAGTATACCTGCT GGAGGCCTGGAAATGGCCCAGCTCCGCTTCTTGTCCAGCCGCCTTGCGCTGGCTGATGTGGTCTCTGCCC GCCTGGCACTTTCCCGCCTCTTTAACATCTCCTCCTCCAGCCCCTGGATCTGCTTCGGAGGCTCCTATGC CGGCTCCTTGGCCGCCTGGGCCCGGCTGAAGTTCCCCCATCTCATTTTCGCGTCGGTCGCCTCCTCCGCC CCGGTGCGGGCCGTGCTGGATTTCTCCGAGTATAATGACGTGGTATCCCGAAGCCTAATGAGCACCGCGA TCGGCGGGTCCCTGGAGTGCCGGGCGGCGGTGTCCGTCGCCTTCGCTGAAGTGGAGCGGCGGCTGCGCTC GGGTGGGGCGGCTCAAGCAGCATTGCGGACGGAGCTGAGCGCTTGCGGGCCCCTGGGCCGCGCTGAAAAC CAGGCGGAGCTGTTGGGGGCGCTGCAGGCACTGGTGGGAGGTGTAGTGCAGTATGATGGGCAGACGGGAG CGCCGCTAAGCGTGCGACAGCTCTGCGGACTTCTCCTCGGGGGCGGGGGCAACCGCAGCCACTCCACGCC CTACTGCGGGCTTCGTCGGGCGGTGCAGATTGTCTTGCACAGCCTGGGCCAGAAGTGTTTAAGCTTTTCC CGAGCAGAGACAGTGGCACAGCTGAGGAGCACAGAACCTCAACTGTCTGGTGTGGGTGACCGGCAGTGGT TGTATCAGACATGTACCGAGTTCGGCTTCTATGTCACCTGTGAGAATCCCAGATGTCCTTTCTCCCAGCT CCCAGCACTGCCCTCCCAGCTAGACCTATGTGAGCAGGTGTTTGGGCTCTCAGCCTTGTCAGTAGCCCAG GCTGTGGCTCAGACGAACTCCTACTACGGTGGCCAGACCCCTGGGGCTAACAAAGTGCTGTTTGTTAATG GGGACACAGACCCCTGGCATGTGCTAAGTGTAACACAGGCTTTAGGATCCTCAGAATCAACTCTTCTTAT CCGCACTGGCTCCCACTGCTTGGACATGGCACCTGAGAGGCCCTCAGACTCCCCCAGCCTCCGCCTAGGG CGCCAGAACATCTTCCAGCAGCTACAGACCTGGCTCAAGCTGGCAAAGGAGAGCCAGATTAAGGGTGAAG TC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC223128 representing NM_005865 Red=Cloning site Green=Tags(s) MAVWLAQWLGPLLLVSLWGLLAPASLLRRLGEHIQQFQESSAQGLGLSLGPGAAALPKVGWLEQLLDPFN VSDRRSFLQRYWVNDQHWVGQDGPIFLHLGGEGSLGPGSVMRGHPAALAPAWGALVISLEHRFYGLSIPA GGLEMAQLRFLSSRLALADVVSARLALSRLFNISSSSPWICFGGSYAGSLAAWARLKFPHLIFASVASSA PVRAVLDFSEYNDVVSRSLMSTAIGGSLECRAAVSVAFAEVERRLRSGGAAQAALRTELSACGPLGRAEN QAELLGALQALVGGVVQYDGQTGAPLSVRQLCGLLLGGGGNRSHSTPYCGLRRAVQIVLHSLGQKCLSFS RAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQ AVAQTNSYYGGQTPGANKVLFVNGDTDPWHVLSVTQALGSSESTLLIRTGSHCLDMAPERPSDSPSLRLG RQNIFQQLQTWLKLAKESQIKGEV myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk8008_d07.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 4 PRSS16 (NM_005865) Human Tagged ORF Clone – RC223128 Cloning Scheme: Plasmid Map: ACCN: NM_005865 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 4 PRSS16 (NM_005865) Human Tagged ORF Clone – RC223128 ORF Size: 1542 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_005865.4 RefSeq Size: 2722 bp RefSeq ORF: 1545 bp Locus ID: 10279 UniProt ID: Q9NQE7 Protein Families: Druggable Genome, Protease, Transmembrane MW: 54.9 kDa Gene Summary: This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells. The gene is found in the large histone gene cluster on chromosome 6, near the major histocompatibility complex (MHC) class I region. A second transcript variant has been described, but its full length nature has not been determined. [provided by RefSeq, Jul 2008] Product images: Coomassie blue staining of purified PRSS16 protein (Cat# [TP323128]). The protein was produced from HEK293T cells transfected with PRSS16 cDNA clone (Cat# RC223128) using MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 4 / 4.
Load more

Recommended publications
  • Integrating Single-Step GWAS and Bipartite Networks Reconstruction Provides Novel Insights Into Yearling Weight and Carcass Traits in Hanwoo Beef Cattle
    animals Article Integrating Single-Step GWAS and Bipartite Networks Reconstruction Provides Novel Insights into Yearling Weight and Carcass Traits in Hanwoo Beef Cattle Masoumeh Naserkheil 1 , Abolfazl Bahrami 1 , Deukhwan Lee 2,* and Hossein Mehrban 3 1 Department of Animal Science, University College of Agriculture and Natural Resources, University of Tehran, Karaj 77871-31587, Iran; [email protected] (M.N.); [email protected] (A.B.) 2 Department of Animal Life and Environment Sciences, Hankyong National University, Jungang-ro 327, Anseong-si, Gyeonggi-do 17579, Korea 3 Department of Animal Science, Shahrekord University, Shahrekord 88186-34141, Iran; [email protected] * Correspondence: [email protected]; Tel.: +82-31-670-5091 Received: 25 August 2020; Accepted: 6 October 2020; Published: 9 October 2020 Simple Summary: Hanwoo is an indigenous cattle breed in Korea and popular for meat production owing to its rapid growth and high-quality meat. Its yearling weight and carcass traits (backfat thickness, carcass weight, eye muscle area, and marbling score) are economically important for the selection of young and proven bulls. In recent decades, the advent of high throughput genotyping technologies has made it possible to perform genome-wide association studies (GWAS) for the detection of genomic regions associated with traits of economic interest in different species. In this study, we conducted a weighted single-step genome-wide association study which combines all genotypes, phenotypes and pedigree data in one step (ssGBLUP). It allows for the use of all SNPs simultaneously along with all phenotypes from genotyped and ungenotyped animals. Our results revealed 33 relevant genomic regions related to the traits of interest.
    [Show full text]
  • Next-MP50 Status Report
    The neXt-50 Challenge The neXt-50 Challenge September 16, 2017 status report of next-50 Challenge by individual Chromosome groups. PI MPs Silver MPs JPR SI JPR SI JPR SI Other Papers Ch Submitted In press In revision 1 Ping Xu 2 1 1 0 2 Lydie Lane 12 3 2 2 0 2 3 Takeshi Kawamura 0 4 0 0 0 1 4 Yu-Ju Chen 26 in progress 86 1 0 1 0 5 6 7 Ed Nice 0 0 1 8 9 10 Jin Park 0 1 0 0 0 0 11 Jong Shin 2 in progress 2 1 0 1 0 12 Ravi Sirdeshmukh 0 0 0 0 0 0 13 Young-Ki Paik 0 5 2 1 1 0 14 CharLes Pineau 12 3 15 GiLberto Domont 0 2 1 0 1 0 16 Fernando CorraLes 2 (+ 9) 165 2 0 2 5 17 GiL Omenn 0 0 3 1 2 8 18 Andrey Archakov 0 0 1 0 1 3 19 20 Siqi Liu 1 0 1 21 Albert Sickmann 0 0 0 0 0 22 X Tadashi Yamamoto 1 0 1 0 Y Hosseini SaLekdeh 1 2 1 1 0 Mt TOTAL 15 268 19 6 13 20 (in progress) 37 C-HPP 2017-09-16 1 The neXt-50 Challenge Chromosome 1 (Ping Xu) PIC Leaders: Ping Xu, Fuchu He Contributing labs: Ping Xu, Beijing Proteome Research Center Fuchu He, Beijing Proteome Research Center Dong Yang, Beijing Proteome Research Center Wantao Ying, Beijing Proteome Research Center Pengyuan Yang, Fudan University Siqi Liu, Beijing Genome Institute Qinyu He, Jinan University Major lab members or partners contributing to the neXt50: Yao Zhang (Beijing Proteome Research Center), Yihao Wang (Beijing Proteome Research Center), Cuitong He (Beijing Proteome Research Center), Wei Wei (Beijing Proteome Research Center), Yanchang Li (Beijing Proteome Research Center), Feng Xu (Beijing Proteome Research Center), Xuehui Peng (Beijing Proteome Research Center).
    [Show full text]
  • Qt8b18n6c6 Nosplash Caf9e24
    Copyright 2014 by Christopher K. Fuller ii For Kai and Lena iii Acknowledgements This work would not have been possible without the support of my research advisor Hao Li. His broad base of interests gave me the freedom to search for something that so well matches my inclinations. I appreciate his insight, enthusiasm, skepticism, and overall encouragement of this effort. I wish to thank my committee, Saunak Sen and Kathleen Giacomini, for their suggestions and support. I wish to thank postdoctoral scholar Xin He for catalyzing the research that became the focus of my work. In addition, I wish to thank postdoctoral scholar Jiashun Zheng for his numerous suggestions and support. I wish to thank the thousands of anonymous individuals who make integrative genomics research possible by providing samples and the researchers dedicated to making these widely available. In addition, I wish to thank the MuTHER and DIAGRAM consortia for providing access to their full summary results. I wish to thank my wife, Sharoni, for her support and for permitting me to encroach on her domain of expertise. You are still the real biologist in the family. Finally, I wish to thank my Mom and Dad ... who took me to the library. iv Abstract Genome-wide association studies (GWAS) have linked various complex diseases to many dozens, sometimes hundreds, of individual genomic loci. Since these are generally of small effect and may lack both functional annotations and an obvious relation to other disease-associated regions, they are difficult to place in a functional context that advances our understanding of the disease.
    [Show full text]
  • Adaptation to Disease Exposure in Indigenous Southern African Populations
    Adaptation to disease exposure in indigenous southern African populations Katharine Owers Degree project in biology, Master of science (2 years), 2012 Examensarbete i biologi 30 hp till masterexamen, 2012 Biology Education Centre and Department of Evolutionary Biology, Uppsala University Supervisor: Mattias Jakobsson Abstract Infectious diseases have impacted humans throughout history. While contemporary diseases can be studied with modern methods, allowing rapid collection and dissemination of information about their effects on populations, studies of the effects of diseases in historical times do not have those advantages. Some historical disease events, such as the plague that struck Europe in the 14th century, are relatively well-understood, but in other cases we have little information on the diseases and their impacts. Such is the case for the waves of disease, both known and speculated, caused by migrations into southern Africa of other African groups and European colonists. Southern indigenous societies did not keep written records, so we must reconstruct their history from European reports, oral histories, and information from archeology and linguistics. Recent advances in genetics, however, provide new sources of information on population history, structure, and selection. I analyzed single nucleotide polymorphisms (SNPs) from two indigenous southern African Khoe-San populations with differing levels of contact with the immigrant groups—the ≠Khomani with abundant such contact and the isolated Ju/’hoansi—to search for evidence of adaptation in the genome due to selection pressure from introduced infectious diseases. Two approaches were used. First, I located regions of the genome likely under selection according to a combination of test statistics based on haplotype homozygosity and population differentiation and then examined those regions for enrichment of genes related to the immune system.
    [Show full text]
  • Organization of the Class I Region of the Bovine Major
    ORGANIZATION OF THE CLASS I REGION OF THE BOVINE MAJOR HISTOCOMPATIBILITY COMPLEX (BOLA) AND THE CHARACTERIZATION OF A CLASS I FRAMESHIFT DELETION (BOLA-Adel) PREVALENT IN FERAL BOVIDS A Dissertation by NICOLE RAMLACHAN Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY December 2004 Major Subject: Genetics ORGANIZATION OF THE CLASS I REGION OF THE BOVINE MAJOR HISTOCOMPATIBILITY COMPLEX (BOLA) AND THE CHARACTERIZATION OF A CLASS I FRAMESHIFT DELETION (BOLA-Adel) PREVALENT IN FERAL BOVIDS A Dissertation by NICOLE RAMLACHAN Submitted to Texas A&M University in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY Approved as to style and content by: _________________________ _________________________ Loren C. Skow Bhanu P. Chowdhary (Chair of Committee) (Member) _________________________ _________________________ James E. Womack Rajesh C. Miranda (Member) (Member) _________________________ _________________________ Geoffrey M. Kapler Evelyn Tiffany-Castiglioni (Chair of Genetics Faculty) (Head of Department) December 2004 Major Subject: Genetics iii ABSTRACT Organization of the Class I Region of the Bovine Major Histocompatibility Complex (BoLA) and the Characterization of a Class I Frameshift Deletion (BoLA-Adel) Prevalent in Feral Bovids. (December 2004) Nicole Ramlachan, B.Sc., University of Guelph, Ontario, Canada; M.Sc., University of Guelph, Ontario, Canada Chair of Advisory Committee: Dr. Loren Skow The major histocompatibility complex (MHC) is a genomic region containing genes of immunomodulatory importance. MHC class I genes encode cell-surface glycoproteins that present peptides to circulating T cells, playing a key role in recognition of self and non-self. Studies of MHC loci in vertebrates have examined levels of polymorphism and molecular evolutionary processes generating diversity.
    [Show full text]
  • AM 112.Indd 3 04.05.12 11:31 the Genes Found to Be Associated with SZ Using Computer Ance of Researched Population, and Linkage Disequilibrium Gene Databases (28, 46)
    REVIEW ARTICLE GENOME ‑WIDE ASSOCIATION STUDIES IN SCHIZOPHRENIA, AND POTENTIAL ETIOLOGICAL AND FUNCTIONAL IMPLICATIONS OF THEIR RESULTS Ladislav Hosák1,2, Petr Šilhan2, Jiřina Hosáková2 Charles University in Prague, Faculty of Medicine in Hradec Králové, and University Hospital Hradec Králové, Czech Repub‑ lic: Department of Psychiatry1; University of Ostrava, Faculty of Medicine, and University Hospital Ostrava, Czech Republic: Department of Clinical Studies and Department of Psychiatry2 Summary: Background: Despite the fact that the genetic basis of schizophrenia has been intensively studied for more than two decades, our contemporary knowledge in this field is rather fractional, and a substantial part of it is still missing. The aim of this review article is to sum up the data coming from genome ‑wide association genetic studies in schizophrenia, and indicate prospective directions of further scientific endeavour. Methods: We searched the National Human Genome Research Institute’s Catalog of genome‑wide association studies for schizophrenia to identify all papers related to this topic. In consequence, we looked up the possible relevancy of these findings for etiology and pathogenesis of schizophrenia using the computer gene and PubMed databases. Results: Eighteen genome‑wide association studies in schizophrenia have been published till now, referring to fifty‑seven genes supposedly involved into schizophrenia’s etiopathogenesis. Most of these genes are related to neurodevelopment, neuroendocrinology, and immunology. Conclusions: It
    [Show full text]
  • BMC Genomics Biomed Central
    BMC Genomics BioMed Central Research article Open Access A genome-wide survey of Major Histocompatibility Complex (MHC) genes and their paralogues in zebrafish Jennifer G Sambrook1, Felipe Figueroa2 and Stephan Beck*1 Address: 1Wellcome Trust Sanger Institute, Genome Campus, Hinxton, Cambridge CB10 ISA, UK and 2Max-Planck-Institut für Biologie, Abteilung Immunogenetik, 72076 Tübingen, Germany Email: Jennifer G Sambrook - [email protected]; Felipe Figueroa - [email protected]; Stephan Beck* - [email protected] * Corresponding author Published: 04 November 2005 Received: 05 June 2005 Accepted: 04 November 2005 BMC Genomics 2005, 6:152 doi:10.1186/1471-2164-6-152 This article is available from: http://www.biomedcentral.com/1471-2164/6/152 © 2005 Sambrook et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: The genomic organisation of the Major Histocompatibility Complex (MHC) varies greatly between different vertebrates. In mammals, the classical MHC consists of a large number of linked genes (e.g. greater than 200 in humans) with predominantly immune function. In some birds, it consists of only a small number of linked MHC core genes (e.g. smaller than 20 in chickens) forming a minimal essential MHC and, in fish, the MHC consists of a so far unknown number of genes including non-linked MHC core genes. Here we report a survey of MHC genes and their paralogues in the zebrafish genome.
    [Show full text]
  • Genome-Wide Analysis of Self-Reported Risk-Taking Behaviour
    Strawbridge et al. Translational Psychiatry (2018) 8:39 DOI 10.1038/s41398-017-0079-1 Translational Psychiatry ARTICLE Open Access Genome-wide analysis of self-reported risk- taking behaviour and cross-disorder genetic correlations in the UK Biobank cohort Rona J. Strawbridge 1,2,JoeyWard1, Breda Cullen1, Elizabeth M. Tunbridge3,4, Sarah Hartz 5, Laura Bierut5, Amy Horton 5,6,MarkE.S.Bailey 7, Nicholas Graham1,AmyFerguson1, Donald M. Lyall1, Daniel Mackay1, Laura M. Pidgeon1, Jonathan Cavanagh1, Jill P. Pell1,MichaelO’Donovan 8, Valentina Escott-Price 8, Paul J. Harrison 3,4 and Daniel J. Smith 1 Abstract Risk-taking behaviour is a key component of several psychiatric disorders and could influence lifestyle choices such as smoking, alcohol use, and diet. As a phenotype, risk-taking behaviour therefore fits within a Research Domain Criteria (RDoC) approach, whereby identifying genetic determinants of this trait has the potential to improve our understanding across different psychiatric disorders. Here we report a genome-wide association study in 116,255 UK Biobank participants who responded yes/no to the question “Would you consider yourself a risk taker?” Risk takers (compared with controls) were more likely to be men, smokers, and have a history of psychiatric disorder. Genetic loci associated with risk-taking behaviour were identified on chromosomes 3 (rs13084531) and 6 (rs9379971). The effects of 1234567890():,; 1234567890():,; both lead SNPs were comparable between men and women. The chromosome 3 locus highlights CADM2, previously implicated in cognitive and executive functions, but the chromosome 6 locus is challenging to interpret due to the complexity of the HLA region.
    [Show full text]
  • Genome-Wide Analysis of Self-Reported Risk-Taking Behaviour
    Washington University School of Medicine Digital Commons@Becker Open Access Publications 2018 Genome-wide analysis of self-reported risk-taking behaviour and cross-disorder genetic correlations in the UK Biobank cohort Sarah Hartz Washington University School of Medicine in St. Louis Laura Bierut Washington University School of Medicine in St. Louis Amy Horton Washington University School of Medicine in St. Louis et al Follow this and additional works at: https://digitalcommons.wustl.edu/open_access_pubs Recommended Citation Hartz, Sarah; Bierut, Laura; Horton, Amy; and et al, ,"Genome-wide analysis of self-reported risk-taking behaviour and cross-disorder genetic correlations in the UK Biobank cohort." Translational Psychiatry.8,. (2018). https://digitalcommons.wustl.edu/open_access_pubs/6596 This Open Access Publication is brought to you for free and open access by Digital Commons@Becker. It has been accepted for inclusion in Open Access Publications by an authorized administrator of Digital Commons@Becker. For more information, please contact [email protected]. Strawbridge et al. Translational Psychiatry (2018) 8:39 DOI 10.1038/s41398-017-0079-1 Translational Psychiatry ARTICLE Open Access Genome-wide analysis of self-reported risk- taking behaviour and cross-disorder genetic correlations in the UK Biobank cohort Rona J. Strawbridge 1,2,JoeyWard1, Breda Cullen1, Elizabeth M. Tunbridge3,4, Sarah Hartz 5, Laura Bierut5, Amy Horton 5,6,MarkE.S.Bailey 7, Nicholas Graham1,AmyFerguson1, Donald M. Lyall1, Daniel Mackay1, Laura M. Pidgeon1, Jonathan Cavanagh1, Jill P. Pell1,MichaelO’Donovan 8, Valentina Escott-Price 8, Paul J. Harrison 3,4 and Daniel J. Smith 1 Abstract Risk-taking behaviour is a key component of several psychiatric disorders and could influence lifestyle choices such as smoking, alcohol use, and diet.
    [Show full text]
  • Reproducible Association with Type 1 Diabetes in the Extended Class I Region of the Major Histocompatibility Complex
    Genes and Immunity (2009) 10, 323–333 & 2009 Macmillan Publishers Limited All rights reserved 1466-4879/09 $32.00 www.nature.com/gene ORIGINAL ARTICLE Reproducible association with type 1 diabetes in the extended class I region of the major histocompatibility complex MK Viken1,2,10, A Blomhoff3,10, M Olsson4,5, HE Akselsen6, F Pociot7, J Nerup7, I Kockum8, A Cambon-Thomsen9, E Thorsby1,2, DE Undlien3,6 and BA Lie2 1Institute of Immunology, Faculty Division Rikshospitalet, University of Oslo, Oslo, Norway; 2Institute of Immunology, Rikshospitalet University Hospital, Oslo, Norway; 3Institute of Medical Genetics, Faculty Division Ulleva˚l University Hospital, University of Oslo, Oslo, Norway; 4Department of Mathematical Statistics, Chalmers University of Technology, Go¨teborg, Sweden; 5Department of Mathematical Statistics, Go¨teborg University, Go¨teborg, Sweden; 6Department of Medical Genetics, Ulleva˚l University Hospital, Oslo, Norway; 7Steno Diabetes Centre, Gentofte, Denmark; 8Department of Clinical Neurosciences, Neuroimmunology Unit, Karolinska Institutet, Stockholm, Sweden and 9Inserm U 558, University Paul Sabatier, Toulouse, France The high-risk human leukocyte antigen (HLA)-DRB1, DQA1 and DQB1 alleles cannot explain the entire type 1 diabetes (T1D) association observed within the extended major histocompatibility complex. We have earlier identified an association with D6S2223, located 2.3 Mb telomeric of HLA-A, on the DRB1*03-DQA1*0501-DQB1*0201 haplotype, and this study aimed to fine-map the associated region also on the DRB1*0401-DQA1*03-DQB1*0302 haplotype, characterized by less extensive linkage disequilibrium. To exclude associations secondary to DRB1-DQA1-DQB1 haplotypes, 205 families with at least one parent homozygous for these loci, were genotyped for 137 polymorphisms.
    [Show full text]
  • Suppementary Table 9. Predicted Targets of Hsa-Mir-181A by Targetscan 6.2
    Suppementary Table 9. Predicted targets of hsa-miR-181a by TargetScan 6.2. Total Aggregate Cancer Target Gene ID Gene name context+ P gene score CT ABL2 NM_001136000 V-abl Abelson murine leukemia viral oncogene homolog 2 > -0.03 0.31 √ ACAN NM_001135 Aggrecan -0.09 0.12 ACCN2 NM_001095 Amiloride-sensitive cation channel 2, neuronal > -0.01 0.26 ACER3 NM_018367 Alkaline ceramidase 3 -0.04 <0.1 ACVR2A NM_001616 Activin A receptor, type IIA -0.16 0.64 ADAM metallopeptidase with thrombospondin type 1 ADAMTS1 NM_006988 > -0.02 0.42 motif, 1 ADAM metallopeptidase with thrombospondin type 1 ADAMTS18 NM_199355 -0.17 0.64 motif, 18 ADAM metallopeptidase with thrombospondin type 1 ADAMTS5 NM_007038 -0.24 0.59 motif, 5 ADAMTSL1 NM_001040272 ADAMTS-like 1 -0.26 0.72 ADARB1 NM_001112 Adenosine deaminase, RNA-specific, B1 -0.28 0.62 AFAP1 NM_001134647 Actin filament associated protein 1 -0.09 0.61 AFTPH NM_001002243 Aftiphilin -0.16 0.49 AK3 NM_001199852 Adenylate kinase 3 > -0.02 0.6 AKAP7 NM_004842 A kinase (PRKA) anchor protein 7 -0.16 0.37 ANAPC16 NM_001242546 Anaphase promoting complex subunit 16 -0.1 0.66 ANK1 NM_000037 Ankyrin 1, erythrocytic > -0.03 0.46 ANKRD12 NM_001083625 Ankyrin repeat domain 12 > -0.03 0.31 ANKRD33B NM_001164440 Ankyrin repeat domain 33B -0.17 0.35 ANKRD43 NM_175873 Ankyrin repeat domain 43 -0.16 0.65 ANKRD44 NM_001195144 Ankyrin repeat domain 44 -0.17 0.49 ANKRD52 NM_173595 Ankyrin repeat domain 52 > -0.05 0.7 AP1S3 NM_001039569 Adaptor-related protein complex 1, sigma 3 subunit -0.26 0.76 Amyloid beta (A4) precursor protein-binding, family A, APBA1 NM_001163 -0.13 0.81 member 1 APLP2 NM_001142276 Amyloid beta (A4) precursor-like protein 2 -0.05 0.55 APOO NM_024122 Apolipoprotein O -0.32 0.41 ARID2 NM_152641 AT rich interactive domain 2 (ARID, RFX-like) -0.07 0.55 √ ARL3 NM_004311 ADP-ribosylation factor-like 3 > -0.03 0.51 ARRDC3 NM_020801 Arrestin domain containing 3 > -0.02 0.47 ATF7 NM_001130059 Activating transcription factor 7 > -0.01 0.26 ATG2B NM_018036 ATG2 autophagy related 2 homolog B (S.
    [Show full text]
  • University of Florida Thesis Or Dissertation Formatting
    FUNCTIONAL GENOMICS AND GENETICAL GENOMICS APPROACHES REVEAL ASSOCIATED GENES, GENE NETWORKS AND BIOLOGICAL PATHWAYS AFFECTING MEAT QUALITY IN BEEF By JOEL DAVID LEAL GUTIÉRREZ A DISSERTATION PRESENTED TO THE GRADUATE SCHOOL OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF DOCTOR OF PHILOSOPHY UNIVERSITY OF FLORIDA 2019 © 2019 Joel David Leal Gutiérrez Go as far as you can see; when you get there, you’ll be able to see further Thomas Carlyle ACKNOWLEDGMENTS First and foremost, I would like to thank my advisor, Dr. Raluca Mateescu for having given this opportunity, support and guidance to me. I want to thank all the professors in my committee: Dr. Tracy Scheffler, Francisco Peñagaricano and Matias Kirst. I am especially grateful to Dr. Mauricio Elzo for providing me his continuous support. I want to show my appreciation to my friends in Gainesville: Zaira Estrada, Victor Dueñas, Angelica Sanclemente, Carlos Martinez and Matthew Morse, and my lab mates: Mesfin Gobena, Heather Hamblen, Sarah Flowers, Kaitlyn Sarlo and Eduardo Rodriguez. I also want to show my gratitude to my friends in Colombia: Paola Gomez, Lady Garzon, Paola Monserrate, Natalia Garcia, Paula Esquinas, Jaime Pulido, Jair Parales and Cesar Vargas for some very good memories. I also want to thank my master advisor, Dr. Ligia Jimenez for her support. Finally, I would like to express my deepest appreciation to my family for their unconditional support and love, and being the reason I always keep moving forward. 4 TABLE OF CONTENTS page ACKNOWLEDGMENTS .................................................................................................. 4 LIST OF TABLES ............................................................................................................ 9 LIST OF FIGURES .......................................................................................................
    [Show full text]