DOCSLIB.ORG

Howson, J. M.M. Et Al. (2017) Fifteen New Risk Loci for Coronary Artery Disease Highlight Arterial-Wall-Specific Mechanisms

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Howson, J. M.M. Et Al. (2017) Fifteen New Risk Loci for Coronary Artery Disease Highlight Arterial-Wall-Specific Mechanisms Howson, J. M.M. et al. (2017) Fifteen new risk loci for coronary artery disease highlight arterial-wall-specific mechanisms. Nature Genetics, 49(7), pp. 1113-1119. (doi:10.1038/ng.3874) This is the author’s final accepted version. There may be differences between this version and the published version. You are advised to consult the publisher’s version if you wish to cite from it. http://eprints.gla.ac.uk/141471/ Deposited on: 24 May 2017 Enlighten – Research publications by members of the University of Glasgow http://eprints.gla.ac.uk33640 1 Fifteen new risk loci for coronary artery disease highlight arterial wall-specific mechanisms 2 Joanna M.M. Howson1, Wei Zhao2,65, Daniel R. Barnes1,65, Weang-Kee Ho1,3, Robin Young1,4, Dirk S. 3 Paul1, Lindsay L. Waite5, Daniel F. Freitag1, Eric B. Fauman6, Elias L. Salfati7,8, Benjamin B. Sun1, 4 John D. Eicher9,10, Andrew D. Johnson9,10, Wayne H.H. Sheu11,12,13, Sune F. Nielsen14, Wei-Yu Lin1,15, 5 Praveen Surendran1, Anders Malarstig16, Jemma B. Wilk17, Anne Tybjærg-Hansen18,19, Katrine L. 6 Rasmussen14, Pia R. Kamstrup14, Panos Deloukas20,21, Jeanette Erdmann22,23,24, Sekar Kathiresan25,26, 7 Nilesh J. Samani27,28, Heribert Schunkert29,30, Hugh Watkins31,32, CARDIoGRAMplusC4D, Ron Do33, 8 Daniel J. Rader34, Julie A. Johnson35, Stanley L. Hazen36, Arshed Quyyumi37, John A. Spertus38,39, 9 Carl J. Pepine40, Nora Franceschini41, Anne Justice41, Alex P. Reiner42, Steven Buyske43, Lucia A. 10 Hindorff44, Cara L. Carty45, Kari E. North46,47, Charles Kooperberg45, Eric Boerwinkle48,49, Kristin 11 Young46, Mariaelisa Graff46, Ulrike Peters45, Devin Absher5, Chao A. Hsiung50, Wen-Jane Lee51, Kent 12 D. Taylor52, Ying-Hsiang Chen50, I-Te Lee53,54,55, Xiuqing Guo52, Ren-Hua Chung50, Yi-Jen Hung13,56, 13 Jerome I. Rotter57, Jyh-Ming J. Juang58,59, Thomas Quertermous7,8, Tzung-Dau Wang58,59, Asif 14 Rasheed60, Philippe Frossard60, Dewan S. Alam61, Abdulla al Shafi Majumder62, Emanuele Di 15 Angelantonio1,63, Rajiv Chowdhury1, EPIC-CVD, Yii-Der Ida. Chen52, Børge G. Nordestgaard14,19, 16 Themistocles L. Assimes7,8,66, John Danesh1,63,64,66, Adam S. Butterworth1,63,66, Danish Saleheen1,2,60,66 17 1 . MRC/BHF Cardiovascular Epidemiology Unit, Department of Public Health and Primary Care, 18 University of Cambridge, UK. 19 2 . Department of Biostatistics and Epidemiology, University of Pennsylvania, USA. 20 3 . Department of Applied Mathematics, University of Nottingham Malaysia Campus, Malaysia. 21 4 . Robertson Centre for Biostatistics, University of Glasgow, UK. 22 5 . HudsonAlpha Institute for Biotechnology, USA. 23 6 . Pfizer Worldwide Research and Development, USA. 24 7 . Department of Medicine, Division of Cardiovascular Medicine, Stanford University, USA. 25 8 . Stanford Cardiovascular Institute, Stanford University, USA. 26 9 . National Heart, Lung and Blood Institute, Population Sciences Branch, USA. 27 10 . NHLBI and Boston University's The Framingham Heart Study, USA. 1 28 11 . Division of Endocrine and Metabolism, Department of Internal Medicine, Taichung Veterans 29 General Hospital, Taiwan ROC. 30 12 . School of Medicine, National Yang-Ming University, Taiwan ROC. 31 13 . College of Medicine, National Defense Medical Center, Taiwan ROC. 32 14 . Department of Clinical Biochemistry, Herlev and Gentofte Hospital, Copenhagen University 33 Hospital, Denmark. 34 15 . Northern Institute for Cancer Research, Paul O'Gorman Building, Newcastle University, UK. 35 16 . Pfizer Worldwide Research and Development, Sweden. 36 17 . Pfizer Worldwide Research and Development, Human Genetics, USA. 37 18 . Dept. of Clinical Biochemistry, Rigshospitalet, Copenhagen University Hospital, Denmark. 38 19 . Faculty of Health and Medical Sciences, University of Copenhagen, Denmark. 39 20 . William Harvey Research Institute, Barts and The London School of Medicine and Dentistry, 40 Queen Mary University of London, UK. 41 21 . Centre for Genomic Health, Queen Mary University of London, UK. 42 22 . Institute for Cardiogenetics, University of Lübeck, Germany. 43 23 . DZHK (German Research Centre for Cardiovascular Research), partner site 44 Hamburg/Lübeck/Kiel, Germany. 45 24 . University Heart Center Luebeck, Germany. 46 25 . Center for Human Genetic Research | Massachusetts General Hospital, USA. 47 26 . Harvard Medical School, USA. 48 27 . Department of Cardiovascular Sciences, University of Leicester, UK. 49 28 . NIHR Leicester Biomedical Research Centre, Glenfield Hospital, UK. 50 29 . Deutsches Herzzentrum München, Technische Universität München, Germany. 51 30 . DZHK (German Center for Cardiovascular Research), partner site Munich Heart Alliance, 52 Germany. 53 31 . Radcliffe Department of Medicine, University of Oxford, UK. 54 32 . Wellcome Trust Centre for Human Genetics, University of Oxford, UK. 55 33 . The Charles Bronfman Institute for Personalized Medicine, Department of Genetics and Genomic 2 56 Sciences, Icahn School of Medicine at Mount Sinai, USA. 57 34 . Departments of Genetics, Medicine, and Pediatrics, Perelman School of Medicine, University of 58 Pennsylvania, USA. 59 35 . University of Florida College of Pharmacy, USA. 60 36 . Department of Cellular and Molecular Medicine, Lerner Research Institute, USA. 61 37 . Division of Cardiology, Emory University School of Medicine, USA. 62 38 . Saint Luke's Mid America Heart Institute, USA. 63 39 . University of Missouri-Kansas City, USA. 64 40 . College of Medicine, University of Florida, USA. 65 41 . Department of Epidemiology, Gillings School of Global Public Health, University of North 66 Carolina, USA. 67 42 . Department of Epidemiology, University of Washington, Seattle, WA, USA. 68 43 . Department of Statistics & Biostatistics, Rutgers University, Piscataway, NJ, USA. 69 44 . Division of Genomic Medicine, National Human Genome Research Institute, NIH, USA. 70 45 . Public Health Sciences Division, Fred Hutchinson Cancer Research Center, USA. 71 46 . Gillings School of Global Public Health, University of North Carolina, USA. 72 47 . Carolina Center for Genome Sciences, USA. 73 48 . Human Genetics Center, School of Public Health, The University of Texas Health Science Center 74 at Houston, USA. 75 49 . Human Genome Sequencing Center, Baylor College of Medicine, USA. 76 50 . Division of Biostatistics and Bioinformatics, Institute of Population Health Sciences, National 77 Health Research Institutes, Taiwan ROC. 78 51 . Department of Medical Research, Taichung Veterans General Hospital, Taiwan ROC. 79 52 . Institute for Translational Genomics and Population Sciences, Department of Pediatrics, 80 LABioMed at Harbor-UCLA Medical Center, USA. 81 53 . Division of Endocrine and Metabolism, Department of Internal Medicine, Taichung Veterans 82 General Hospital, Taiwan. 83 54 . School of Medicine, National Yang-Ming University, Taiwan. 3 84 55 . School of Medicine, Chung Shan Medical University, Taiwan. 85 56 . Division of Endocrinology and Metabolism, Tri-Service General Hospital, National Defense 86 Medical Center, Taiwan ROC. 87 57 . Institute for Translational Genomics and Population Sciences, Departments of Pediatrics and 88 Medicine, LABioMed at Harbor-UCLA Medical Center, USA. 89 58 . Cardiovascular Center and Division of Cardiology, Department of Internal Medicine, National 90 Taiwan University Hospital, Taiwan ROC. 91 59 . National Taiwan University College of Medicine, Taiwan ROC. 92 60 . Centre for Non-Communicable Disease, Pakistan. 93 61 . School of Kinesiology and Health Science, York University, Canada. 94 62 . National Institute of Cardiovascular Diseases, Sher-e-Bangla Nagar, Bangladesh. 95 63 . The National Institute for Health Research Blood and Transplant Research Unit in Donor Health 96 and Genomics, University of Cambridge, UK. 97 64 . Wellcome Trust Sanger Institute, UK. 98 65. Authors contributed equally 99 66. Authors contributed equally 100 Corresponding author: Joanna M M Howson, [email protected] 101 4 102 Summary paragraph 103 Coronary artery disease (CAD) is a leading cause of morbidity and mortality worldwide1,2. Although 104 58 genomic regions have been associated with CAD to date3-9, most of the heritability is unexplained9, 105 indicating additional susceptibility loci await identification. An efficient discovery strategy may be 106 larger-scale evaluation of promising associations suggested by genome-wide association studies 107 (GWAS). Hence, we genotyped 56,309 participants using a targeted gene array derived from earlier 108 GWAS results and meta-analysed results with 194,427 participants previously genotyped to give a 109 total of 88,192 CAD cases and 162,544 controls. We identified 25 new SNP-CAD-associations (P < 110 5x10-8, in fixed effects meta-analysis) from 15 genomic regions, including SNPs in or near genes 111 involved in cellular adhesion, leucocyte migration and atherosclerosis (PECAM1, rs1867624), 112 coagulation and inflammation (PROCR, rs867186 [p.Ser219Gly]) and vascular smooth muscle cell 113 differentiation (LMOD1, rs2820315). Correlation of these regions with cell type-specific gene 114 expression and plasma protein levels shed light on potential novel disease mechanisms. 115 116 117 118 5 119 MAIN TEXT 120 The CardioMetabochip is a genotyping array that contains 196,725 variants of confirmed or suspected 121 relevance to cardiometabolic traits derived from earlier GWAS.10 A previous meta-analysis by the 122 CARDIoGRAMplusC4D consortium of 79,138 SNPs common to the CardioMetabochip and GWAS 123 arrays, identified 15 new loci associated with CAD3. Using the CardioMetabochip, we genotyped 124
Load more

Recommended publications
  • ABSTRACT ANGSTADT, ANDREA Y. Evaluation of the Genomic
    ABSTRACT ANGSTADT, ANDREA Y. Evaluation of the Genomic Aberrations in Canine Osteosarcoma and Their Resemblance to the Human Counterpart. (Under the direction of Dr. Matthew Breen). In the last decade the domestic dog has emerged as an ideal biomedical model of complex genetic diseases such as cancers. Cancer in the dog occurs spontaneously and several studies have concluded that human and canine cancers have similar characteristics such as presentation of disease, rate of metastases, genetic dysregulation, and survival rates. Furthermore, in the genomic era the dog genome was found more homologous in sequence conservation to humans than mice, making it a valuable model organism for genetic study in addition to pathophysiological analysis. Osteosarcoma (OS), the most commonly diagnosed malignant bone tumor in humans and dogs, is one such cancer that would benefit from comparative genomic analysis. In humans, OS is a rare cancer diagnosed in fewer than 1,000 people per year in the USA, while in the domestic dog population the annual number of new cases is estimated to far exceed 10,000. This high rate of disease occurrence in dogs provides a unique opportunity to study the genomic imbalances in canine OS and their translational value to human OS as a means to identify important alterations involved in disease etiology. OS in humans is characterized by extremely complex karyotypes which contain both structural changes (translocations and/or rearrangements) and DNA copy number changes. Metaphase and array comparative genomic hybridization (aCGH) has assisted in uncovering the genetic imbalances that are associated with human OS phenotype. In dog OS, previous low-resolution (10-20Mb) aCGH analysis identified a wide range of recurrent copy number aberrations (CNAs), indicative of a similar level of genomic instability to human OS.
    [Show full text]
  • PRODUCT SPECIFICATION Anti-C12orf43
    Anti-C12orf43 Product Datasheet Polyclonal Antibody PRODUCT SPECIFICATION Product Name Anti-C12orf43 Product Number HPA046148 Gene Description chromosome 12 open reading frame 43 Clonality Polyclonal Isotype IgG Host Rabbit Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEF RAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGG REKEESPQPR Purification Method Affinity purified using the PrEST antigen as affinity ligand Verified Species Human Reactivity Recommended IHC (Immunohistochemistry) Applications - Antibody dilution: 1:50 - 1:200 - Retrieval method: HIER pH6 WB (Western Blot) - Working concentration: 0.04-0.4 µg/ml ICC-IF (Immunofluorescence) - Fixation/Permeabilization: PFA/Triton X-100 - Working concentration: 0.25-2 µg/ml Characterization Data Available at atlasantibodies.com/products/HPA046148 Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Concentration Lot dependent Storage Store at +4°C for short term storage. Long time storage is recommended at -20°C. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. For protocols, additional product information, such as images and references, see atlasantibodies.com. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions.
    [Show full text]
  • DHX38 Antibody - Middle Region Rabbit Polyclonal Antibody Catalog # AI10980
    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 DHX38 antibody - middle region Rabbit Polyclonal Antibody Catalog # AI10980 Specification DHX38 antibody - middle region - Product Information Application WB Primary Accession Q92620 Other Accession NM_014003, NP_054722 Reactivity Human, Mouse, Rat, Rabbit, Zebrafish, Pig, Horse, Bovine, Dog Predicted Human, Rat, WB Suggested Anti-DHX38 Antibody Rabbit, Zebrafish, Titration: 1.0 μg/ml Pig, Chicken Positive Control: OVCAR-3 Whole Cell Host Rabbit Clonality Polyclonal Calculated MW 140kDa KDa DHX38 antibody - middle region - Additional Information Gene ID 9785 Alias Symbol DDX38, KIAA0224, PRP16, PRPF16 Other Names Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16, 3.6.4.13, ATP-dependent RNA helicase DHX38, DEAH box protein 38, DHX38, DDX38, KIAA0224, PRP16 Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Reconstitution & Storage Add 50 ul of distilled water. Final anti-DHX38 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at 20°C. Avoid repeat freeze-thaw cycles. Precautions Page 1/2 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 DHX38 antibody - middle region is for research use only and not for use in diagnostic or therapeutic procedures. DHX38 antibody - middle region - Protein Information Name DHX38 Synonyms DDX38, KIAA0224, PRP16 Function Probable ATP-binding RNA helicase (Probable). Involved in pre-mRNA splicing as component of the spliceosome (PubMed:<a href="http://www.uniprot.org/c itations/29301961" target="_blank">29301961</a>, PubMed:<a href="http://www.uniprot.org/ci tations/9524131" target="_blank">9524131</a>).
    [Show full text]
  • Refinement and Discovery of New Hotspots of Copy-Number Variation
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector ARTICLE Refinement and Discovery of New Hotspots of Copy-Number Variation Associated with Autism Spectrum Disorder Santhosh Girirajan,1,5 Megan Y. Dennis,1,5 Carl Baker,1 Maika Malig,1 Bradley P. Coe,1 Catarina D. Campbell,1 Kenneth Mark,1 Tiffany H. Vu,1 Can Alkan,1 Ze Cheng,1 Leslie G. Biesecker,2 Raphael Bernier,3 and Evan E. Eichler1,4,* Rare copy-number variants (CNVs) have been implicated in autism and intellectual disability. These variants are large and affect many genes but lack clear specificity toward autism as opposed to developmental-delay phenotypes. We exploited the repeat architecture of the genome to target segmental duplication-mediated rearrangement hotspots (n ¼ 120, median size 1.78 Mbp, range 240 kbp to 13 Mbp) and smaller hotspots flanked by repetitive sequence (n ¼ 1,247, median size 79 kbp, range 3–96 kbp) in 2,588 autistic individuals from simplex and multiplex families and in 580 controls. Our analysis identified several recurrent large hotspot events, including association with 1q21 duplications, which are more likely to be identified in individuals with autism than in those with developmental delay (p ¼ 0.01; OR ¼ 2.7). Within larger hotspots, we also identified smaller atypical CNVs that implicated CHD1L and ACACA for the 1q21 and 17q12 deletions, respectively. Our analysis, however, suggested no overall increase in the burden of smaller hotspots in autistic individuals as compared to controls. By focusing on gene-disruptive events, we identified recurrent CNVs, including DPP10, PLCB1, TRPM1, NRXN1, FHIT, and HYDIN, that are enriched in autism.
    [Show full text]
  • Sorting Nexins in Protein Homeostasis Sara E. Hanley1,And Katrina F
    Preprints (www.preprints.org) | NOT PEER-REVIEWED | Posted: 6 November 2020 doi:10.20944/preprints202011.0241.v1 Sorting nexins in protein homeostasis Sara E. Hanley1,and Katrina F. Cooper2* 1Department of Molecular Biology, Graduate School of Biomedical Sciences, Rowan University, Stratford, NJ, 08084, USA 1 [email protected] 2 [email protected] * [email protected] Tel: +1 (856)-566-2887 1Department of Molecular Biology, Graduate School of Biomedical Sciences, Rowan University, Stratford, NJ, 08084, USA Abstract: Sorting nexins (SNXs) are a highly conserved membrane-associated protein family that plays a role in regulating protein homeostasis. This family of proteins is unified by their characteristic phox (PX) phosphoinositides binding domain. Along with binding to membranes, this family of SNXs also comprises a diverse array of protein-protein interaction motifs that are required for cellular sorting and protein trafficking. SNXs play a role in maintaining the integrity of the proteome which is essential for regulating multiple fundamental processes such as cell cycle progression, transcription, metabolism, and stress response. To tightly regulate these processes proteins must be expressed and degraded in the correct location and at the correct time. The cell employs several proteolysis mechanisms to ensure that proteins are selectively degraded at the appropriate spatiotemporal conditions. SNXs play a role in ubiquitin-mediated protein homeostasis at multiple levels including cargo localization, recycling, degradation, and function. In this review, we will discuss the role of SNXs in three different protein homeostasis systems: endocytosis lysosomal, the ubiquitin-proteasomal, and the autophagy-lysosomal system. The highly conserved nature of this protein family by beginning with the early research on SNXs and protein trafficking in yeast and lead into their important roles in mammalian systems.
    [Show full text]
  • Environmental Influences on Endothelial Gene Expression
    ENDOTHELIAL CELL GENE EXPRESSION John Matthew Jeff Herbert Supervisors: Prof. Roy Bicknell and Dr. Victoria Heath PhD thesis University of Birmingham August 2012 University of Birmingham Research Archive e-theses repository This unpublished thesis/dissertation is copyright of the author and/or third parties. The intellectual property rights of the author or third parties in respect of this work are as defined by The Copyright Designs and Patents Act 1988 or as modified by any successor legislation. Any use made of information contained in this thesis/dissertation must be in accordance with that legislation and must be properly acknowledged. Further distribution or reproduction in any format is prohibited without the permission of the copyright holder. ABSTRACT Tumour angiogenesis is a vital process in the pathology of tumour development and metastasis. Targeting markers of tumour endothelium provide a means of targeted destruction of a tumours oxygen and nutrient supply via destruction of tumour vasculature, which in turn ultimately leads to beneficial consequences to patients. Although current anti -angiogenic and vascular targeting strategies help patients, more potently in combination with chemo therapy, there is still a need for more tumour endothelial marker discoveries as current treatments have cardiovascular and other side effects. For the first time, the analyses of in-vivo biotinylation of an embryonic system is performed to obtain putative vascular targets. Also for the first time, deep sequencing is applied to freshly isolated tumour and normal endothelial cells from lung, colon and bladder tissues for the identification of pan-vascular-targets. Integration of the proteomic, deep sequencing, public cDNA libraries and microarrays, delivers 5,892 putative vascular targets to the science community.
    [Show full text]
  • Structure of the Human Frataxin-Bound Iron-Sulfur Cluster Assembly Complex Provides Insight Into Its Activation Mechanism
    bioRxiv preprint doi: https://doi.org/10.1101/561795; this version posted February 28, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Structure of the human frataxin-bound iron-sulfur cluster assembly complex provides insight into its activation mechanism Nicholas G. Fox1,4, Xiaodi Yu2,4, Xidong Feng2, Henry J. Bailey1, Alain Martelli3, Joseph F. Nabhan3, Claire Strain-Damerell1, Christine Bulawa3, Wyatt W. Yue1,*, Seungil Han2,* 1Structural Genomics Consortium, Nuffield Department of Clinical Medicine, University of Oxford, UK OX3 7DQ 2Discovery Sciences, Worldwide Research and Development, Pfizer Inc., Eastern Point Road, Groton, CT, 06340, United States 3Rare Disease Research Unit, Worldwide Research and Development, Pfizer Inc., 610 Main Street, Cambridge, MA, 02139, United States 4These authors contributed equally. *Correspondence should be addressed to Wyatt W. Yue, [email protected] Seungil Han, [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/561795; this version posted February 28, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Abstract Iron-sulfur clusters (ISC) are essential in all life forms and carry out many crucial cellular functions. The core machinery for de novo ISC biosynthesis, located in the mitochondria matrix, is a five- protein complex containing the cysteine desulfurase NFS1 that is activated by frataxin (FXN), scaffold protein ISCU, accessory protein ISD11, and acyl-carrier protein ACP.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Anti-NFS1 Antibody (ARG56331)
    Product datasheet [email protected] ARG56331 Package: 100 μl anti-NFS1 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes NFS1 Tested Reactivity Hu, Ms, Rat Tested Application ICC/IF, IHC-P, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name NFS1 Antigen Species Human Immunogen Recombinant protein of Human NFS1 Conjugation Un-conjugated Alternate Names HUSSY-08; NIFS; EC 2.8.1.7; IscS; Cysteine desulfurase, mitochondrial Application Instructions Application table Application Dilution ICC/IF 1:50 - 1:200 IHC-P 1:50 - 1:200 WB 1:500 - 1:2000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control Rat liver Calculated Mw 50 kDa Properties Form Liquid Purification Affinity purification with immunogen. Buffer PBS (pH 7.3), 0.02% Sodium azide and 50% Glycerol. Preservative 0.02% Sodium azide Stabilizer 50% Glycerol Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. www.arigobio.com 1/3 Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation Database links GeneID: 18041 Mouse GeneID: 9054 Human Swiss-port # Q9Y697 Human Swiss-port # Q9Z1J3 Mouse Gene Symbol NFS1 Gene Full Name NFS1 cysteine desulfurase Background Iron-sulfur clusters are required for the function of many cellular enzymes.
    [Show full text]
  • Prevalence and Significance of Nonsense-‐Mediated Mrna Decay
    Prevalence and Significance of Nonsense-Mediated mRNA Decay Coupled with Alternative Splicing in Diverse Eukaryotic Organisms By Courtney Elizabeth French A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Molecular and Cell Biology in the Graduate Division of the University of California, Berkeley Committee in charge: Professor Steven E. Brenner, Co-Chair Professor Donald C. Rio, Co-Chair Professor Britt A. Glaunsinger Professor Sandrine Dudoit Spring 2016 Prevalence and Significance of Nonsense-Mediated mRNA Decay Coupled with Alternative Splicing in Diverse Eukaryotic Organisms Copyright 2016 by Courtney Elizabeth French Abstract Prevalence and Significance of Nonsense-Mediated mRNA Decay Coupled with Alternative Splicing in Diverse Eukaryotic Organisms by Courtney Elizabeth French Doctor of Philosophy in Molecular and Cell Biology University of California, Berkeley Professor Steven E. Brenner, Co-Chair Professor Donald C. Rio, Co-Chair Alternative splicing plays a crucial role in increasing the amount of protein diversity and in regulating gene expression at the post-transcriptional level. In humans, almost all genes produce more than one mRNA isoform and, while the fraction varies, many other species also have a substantial number of alternatively spliced genes. Alternative splicing is regulated by splicing factors, often in a developmental time- or tissue-specific manner. Mis- regulation of alternative splicing, via mutations in splice sites, splicing regulatory elements, or splicing factors, can lead to disease states, including cancers. Thus, characterizing how alternative splicing shapes the transcriptome will lead to greater insights into the regulation of numerous cellular pathways and many aspects of human health. A critical tool for investigating alternative splicing is high-throughput mRNA sequencing (RNA-seq).
    [Show full text]
  • CRNKL1 Is a Highly Selective Regulator of Intron-Retaining HIV-1 and Cellular Mrnas
    bioRxiv preprint doi: https://doi.org/10.1101/2020.02.04.934927; this version posted February 11, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 CRNKL1 is a highly selective regulator of intron-retaining HIV-1 and cellular mRNAs 2 3 4 Han Xiao1, Emanuel Wyler2#, Miha Milek2#, Bastian Grewe3, Philipp Kirchner4, Arif Ekici4, Ana Beatriz 5 Oliveira Villela Silva1, Doris Jungnickl1, Markus Landthaler2,5, Armin Ensser1, and Klaus Überla1* 6 7 1 Institute of Clinical and Molecular Virology, University Hospital Erlangen, Friedrich-Alexander 8 Universität Erlangen-Nürnberg, Erlangen, Germany 9 2 Berlin Institute for Medical Systems Biology, Max-Delbrück-Center for Molecular Medicine in the 10 Helmholtz Association, Robert-Rössle-Strasse 10, 13125, Berlin, Germany 11 3 Department of Molecular and Medical Virology, Ruhr-University, Bochum, Germany 12 4 Institute of Human Genetics, University Hospital Erlangen, Friedrich-Alexander Universität Erlangen- 13 Nürnberg, Erlangen, Germany 14 5 IRI Life Sciences, Institute für Biologie, Humboldt Universität zu Berlin, Philippstraße 13, 10115, Berlin, 15 Germany 16 # these two authors contributed equally 17 18 19 *Corresponding author: 20 Prof. Dr. Klaus Überla 21 Institute of Clinical and Molecular Virology, University Hospital Erlangen 22 Friedrich-Alexander Universität Erlangen-Nürnberg 23 Schlossgarten 4, 91054 Erlangen 24 Germany 25 Tel: (+49) 9131-8523563 26 e-mail: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.02.04.934927; this version posted February 11, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder.
    [Show full text]
  • 1 Supporting Information for a Microrna Network Regulates
    Supporting Information for A microRNA Network Regulates Expression and Biosynthesis of CFTR and CFTR-ΔF508 Shyam Ramachandrana,b, Philip H. Karpc, Peng Jiangc, Lynda S. Ostedgaardc, Amy E. Walza, John T. Fishere, Shaf Keshavjeeh, Kim A. Lennoxi, Ashley M. Jacobii, Scott D. Rosei, Mark A. Behlkei, Michael J. Welshb,c,d,g, Yi Xingb,c,f, Paul B. McCray Jr.a,b,c Author Affiliations: Department of Pediatricsa, Interdisciplinary Program in Geneticsb, Departments of Internal Medicinec, Molecular Physiology and Biophysicsd, Anatomy and Cell Biologye, Biomedical Engineeringf, Howard Hughes Medical Instituteg, Carver College of Medicine, University of Iowa, Iowa City, IA-52242 Division of Thoracic Surgeryh, Toronto General Hospital, University Health Network, University of Toronto, Toronto, Canada-M5G 2C4 Integrated DNA Technologiesi, Coralville, IA-52241 To whom correspondence should be addressed: Email: [email protected] (M.J.W.); yi- [email protected] (Y.X.); Email: [email protected] (P.B.M.) This PDF file includes: Materials and Methods References Fig. S1. miR-138 regulates SIN3A in a dose-dependent and site-specific manner. Fig. S2. miR-138 regulates endogenous SIN3A protein expression. Fig. S3. miR-138 regulates endogenous CFTR protein expression in Calu-3 cells. Fig. S4. miR-138 regulates endogenous CFTR protein expression in primary human airway epithelia. Fig. S5. miR-138 regulates CFTR expression in HeLa cells. Fig. S6. miR-138 regulates CFTR expression in HEK293T cells. Fig. S7. HeLa cells exhibit CFTR channel activity. Fig. S8. miR-138 improves CFTR processing. Fig. S9. miR-138 improves CFTR-ΔF508 processing. Fig. S10. SIN3A inhibition yields partial rescue of Cl- transport in CF epithelia.
    [Show full text]