NFKBIL1 (NM 001144963) Human Tagged ORF Clone Product Data

Total Page:16

File Type:pdf, Size:1020Kb

Load more

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC227000 NFKBIL1 (NM_001144963) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: NFKBIL1 (NM_001144963) Human Tagged ORF Clone Tag: Myc-DDK Symbol: NFKBIL1 Synonyms: IKBL; NFKBIL Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC227000 representing NM_001144963 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCTCCACTTCCCGCCGCCAACGCCGAGAACGTCGCTTTCGTCGTTACTTGTCTGCAGGACGGCTGG TCCGGGCCCAGGCCCTCCTCCAGCGACACCCAGGCCTCGATGTAGATGCTGGGCAGCCCCCACCACTGCA CCGGGCCTGTGCCCGCCACGATGCCCCTGCCCTGTGCCTGCTGCTTCGGCTCGGGGCTGACCCTGCCCAC CAGGACCGCCATGGGGACACGGCACTGCATGCTGCTGCCCGCCAGGGCCCAGATGCCTACACCGATTTCT TCCTCCCGCTGCTAAGCCGCTGTCCCTCCGCCATGGGAATAAAGAATAAGGATGGGGAGACCCCTGGCCA AATTTTGGGCTGGGGACCCCCCTGGGATTCTGCTGAAGAGGAGGAAGAAGATGATGCCTCCAAGGAGCGG GAATGGAGACAGAAGCTCCAGGGTGATGCCTCCCATGAAACCCAGGAACCTGAGTCCTTCTCAGCCTGGT CAGATCGCCTGGCCCGGGAACATGCCCAGAAGTGCCAGCAGCAGCAGCGAGAAGCAGAGGGATCCCGTCG ACCCCCACGTGCTGAGGGCTCCAGCCAGAGCTGGCGACAGCAGGAGGAGGAGCAGCGGCTCTTCAGGGAG CGAGCCCGGGCCAAGGAGGAAGAGCTGCGTGAGAGCCGAGCCAGGAGGGCGCAGGAGGCTCTAGGGGACC GAGAACCCAAGCCAACCAGGGCCGGGCCCAGGGAAGAGCACCCCAGAGGAGCGGGGAGGGGCAGCCTCTG GCGATTTGGTGATGTGCCCTGGCCCTGCCCTGGGGGAGGGGACCCAGAGGCCATGGCTGCAGCCCTGGTG GCCAGGGGCCCCCCTTTGGAGGAACAGGGGGCTCTGAGGAGGTACTTGAGGGTCCAGCAGGTCCGCTGGC ACCCTGACCGCTTCCTGCAGCGATTCCGAAGCCAGATTGAGACCTGGGAGCTGGGCCGTGTGATGGGAGC AGTGACAGCCCTTTCTCAGGCCCTGAATCGCCATGCAGAGGCCCTCAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 NFKBIL1 (NM_001144963) Human Tagged ORF Clone – RC227000 Protein Sequence: >RC227000 representing NM_001144963 Red=Cloning site Green=Tags(s) MASTSRRQRRERRFRRYLSAGRLVRAQALLQRHPGLDVDAGQPPPLHRACARHDAPALCLLLRLGADPAH QDRHGDTALHAAARQGPDAYTDFFLPLLSRCPSAMGIKNKDGETPGQILGWGPPWDSAEEEEEDDASKER EWRQKLQGDASHETQEPESFSAWSDRLAREHAQKCQQQQREAEGSRRPPRAEGSSQSWRQQEEEQRLFRE RARAKEEELRESRARRAQEALGDREPKPTRAGPREEHPRGAGRGSLWRFGDVPWPCPGGGDPEAMAAALV ARGPPLEEQGALRRYLRVQQVRWHPDRFLQRFRSQIETWELGRVMGAVTALSQALNRHAEALK myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/ja1543_e09.zip Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_001144963 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 NFKBIL1 (NM_001144963) Human Tagged ORF Clone – RC227000 ORF Size: 1029 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_001144963.2 RefSeq ORF: 1032 bp Locus ID: 4795 UniProt ID: Q9UBC1 Protein Families: Transcription Factors MW: 38.8 kDa Gene Summary: This gene encodes a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009] Product images: Western blot validation of overexpression lysate (Cat# [LY428610]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC227000 using transfection reagent MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Recommended publications
  • What Is the Extent of the Role Played by Genetic Factors in Periodontitis?

    What Is the Extent of the Role Played by Genetic Factors in Periodontitis?

    Perio Insight 4 Summer 2017 www.efp.org/perioinsight DEBATE EXPERT VIEW FOCUS RESEARCH Editor: Joanna Kamma What is the extent of the role played by genetic factors in periodontitis? Discover latest JCP research hile genetic factors are known to play a role in In a comprehensive overview of current knowledge, The Journal of Clinical Periodontology Wperiodontitis, a lot of research still needs to be they outline what is known today and discuss the (JCP) is the official scientific publication done to understand the mechanisms that are involved. most promising lines for future inquiry. of the European Federation of Indeed, the limited extent to which the genetic They note that the phenotypes of aggressive Periodontology (EFP). It publishes factors associated with periodontitis have been periodontitis (AgP) and chronic periodontitis (CP) may research relating to periodontal and peri- identified is “somewhat disappointing”, say Bruno not be as distinct as previously assumed because they implant diseases and their treatment. G. Loos and Deon P.M. Chin, from the Academic share genetic and other risk factors. The six JCP articles summarised in this Centre for Dentistry in Amsterdam. More on pages 2-5 edition of Perio Insight cover: (1) how periodontitis changes renal structures by oxidative stress and lipid peroxidation; (2) gingivitis and lifestyle influences on high-sensitivity C-reactive protein and interleukin 6 in adolescents; (3) the long-term efficacy of periodontal Researchers call regenerative therapies; (4) tooth loss in generalised aggressive periodontitis; (5) the association between diabetes for global action mellitus/hyperglycaemia and peri- implant diseases; (6) the efficacy of on periodontal collagen matrix seal and collagen sponge on ridge preservation in disease combination with bone allograft.
  • Molecular and Epigenetic Features of Melanomas and Tumor Immune

    Molecular and Epigenetic Features of Melanomas and Tumor Immune

    Seremet et al. J Transl Med (2016) 14:232 DOI 10.1186/s12967-016-0990-x Journal of Translational Medicine RESEARCH Open Access Molecular and epigenetic features of melanomas and tumor immune microenvironment linked to durable remission to ipilimumab‑based immunotherapy in metastatic patients Teofila Seremet1,3*† , Alexander Koch2†, Yanina Jansen1, Max Schreuer1, Sofie Wilgenhof1, Véronique Del Marmol3, Danielle Liènard3, Kris Thielemans4, Kelly Schats5, Mark Kockx5, Wim Van Criekinge2, Pierre G. Coulie6, Tim De Meyer2, Nicolas van Baren6,7 and Bart Neyns1 Abstract Background: Ipilimumab (Ipi) improves the survival of advanced melanoma patients with an incremental long-term benefit in 10–15 % of patients. A tumor signature that correlates with this survival benefit could help optimizing indi- vidualized treatment strategies. Methods: Freshly frozen melanoma metastases were collected from patients treated with either Ipi alone (n: 7) or Ipi combined with a dendritic cell vaccine (TriMixDC-MEL) (n: 11). Samples were profiled by immunohistochemistry (IHC), whole transcriptome (RNA-seq) and methyl-DNA sequencing (MBD-seq). Results: Patients were divided in two groups according to clinical evolution: durable benefit (DB; 5 patients) and no clinical benefit (NB; 13 patients). 20 metastases were profiled by IHC and 12 were profiled by RNA- and MBD-seq. 325 genes were identified as differentially expressed between DB and NB. Many of these genes reflected a humoral and cellular immune response. MBD-seq revealed differences between DB and NB patients in the methylation of genes linked to nervous system development and neuron differentiation. DB tumors were more infiltrated by CD8+ and PD-L1+ cells than NB tumors.
  • NFKBIL1 Antibody (Center) Blocking Peptide Synthetic Peptide Catalog # Bp10682c

    NFKBIL1 Antibody (Center) Blocking Peptide Synthetic Peptide Catalog # Bp10682c

    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 NFKBIL1 Antibody (Center) Blocking peptide Synthetic peptide Catalog # BP10682c Specification NFKBIL1 Antibody (Center) Blocking NFKBIL1 Antibody (Center) Blocking peptide - peptide - Background Product Information This gene encodes a divergent member of the Primary Accession Q9UBC1 I-kappa-Bfamily of proteins. Its function has not been determined. The genelies within the major histocompatibility complex (MHC) class NFKBIL1 Antibody (Center) Blocking peptide - Additional Information Iregion on chromosome 6. Multiple transcript variants encodingdifferent isoforms have been found for this gene. [provided byRefSeq]. Gene ID 4795 NFKBIL1 Antibody (Center) Blocking Other Names peptide - References NF-kappa-B inhibitor-like protein 1, Inhibitor of kappa B-like protein, I-kappa-B-like Clancy, R.M., et al. Arthritis Rheum. protein, IkappaBL, Nuclear factor of kappa 62(11):3415-3424(2010)Bailey, S.D., et al. light polypeptide gene enhancer in B-cells Diabetes Care inhibitor-like 1, NFKBIL1, IKBL 33(10):2250-2253(2010)Ucisik-Akkaya, E., et Format al. Mol. Hum. Reprod. Peptides are lyophilized in a solid powder 16(10):770-777(2010)Rose, J.E., et al. Mol. format. Peptides can be reconstituted in Med. 16 (7-8), 247-253 (2010) :Owecki, M.K., solution using the appropriate buffer as et al. Pol. Merkur. Lekarski needed. 28(167):366-370(2010) Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. Precautions This product is for research use only. Not for use in diagnostic or therapeutic procedures.
  • NFKBIL1 Antibody Cat

    NFKBIL1 Antibody Cat

    NFKBIL1 Antibody Cat. No.: 56-654 NFKBIL1 Antibody Confocal immunofluorescent analysis of NFKBIL1 NFKBIL1 Antibody immunohistochemistry analysis in Antibody with MDA-MB435 cell followed by Alexa Fluor formalin fixed and paraffin embedded human brain tissue 488-conjugated goat anti-rabbit lgG (green).Actin filaments followed by peroxidase conjugation of the secondary have been labeled with Alexa Fluor 555 phalloidin antibody and DAB staining. (red).DAPI was used to stain the cell nuclear (blue). Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Human HOMOLOGY: Predicted species reactivity based on immunogen sequence: Mouse, Pig This NFKBIL1 antibody is generated from rabbits immunized with a KLH conjugated IMMUNOGEN: synthetic peptide between 327-356 amino acids from the C-terminal region of human NFKBIL1. TESTED APPLICATIONS: IF, IHC-P, WB September 24, 2021 1 https://www.prosci-inc.com/nfkbil1-antibody-56-654.html For WB starting dilution is: 1:1000 APPLICATIONS: For IHC-P starting dilution is: 1:10~50 For IF starting dilution is: 1:10~50 PREDICTED MOLECULAR 43 kDa WEIGHT: Properties This antibody is purified through a protein A column, followed by peptide affinity PURIFICATION: purification. CLONALITY: Polyclonal ISOTYPE: Rabbit Ig CONJUGATE: Unconjugated PHYSICAL STATE: Liquid BUFFER: Supplied in PBS with 0.09% (W/V) sodium azide. CONCENTRATION: batch dependent Store at 4˚C for three months and -20˚C, stable for up to one year. As with all antibodies STORAGE CONDITIONS: care should be taken to avoid repeated freeze thaw cycles. Antibodies should not be exposed to prolonged high temperatures. Additional Info OFFICIAL SYMBOL: NFKBIL1 NF-kappa-B inhibitor-like protein 1, Inhibitor of kappa B-like protein, I-kappa-B-like ALTERNATE NAMES: protein, IkappaBL, Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor-like 1, NFKBIL1, IKBL ACCESSION NO.: Q9UBC1 PROTEIN GI NO.: 44888077 GENE ID: 4795 USER NOTE: Optimal dilutions for each application to be determined by the researcher.
  • Pleiotropy in Complex Traits

    Pleiotropy in Complex Traits

    Pleiotropy in complex traits Sophie Hackinger Wellcome Sanger Institute University of Cambridge Jesus College This dissertation is submitted for the degree of Doctor of Philosophy September 2018 ii Abstract Thesis title: Pleiotropy in complex traits Name: Sophie Hackinger Genome-wide association studies (GWAS) have uncovered thousands of complex trait loci, many of which are associated with multiple phenotypes. The dedicated study of these pleiotropic effects is becoming increasingly common due to the availability of sample collections with high-dimensional phenotype data, such as the UK Biobank, and can yield important insights into the aetiology underlying complex disorders. In my PhD, I performed multi-trait analyses of medically relevant complex phenotypes to identify shared genetic factors. My first project involved a genome-wide overlap analysis of osteoarthritis (OA) and bone- mineral density (BMD), using summary statistics from two large-scale GWAS. OA and BMD are known to be inversely correlated, yet the genetics underlying this link remain poorly understood. I found robust evidence for association with OA at the SMAD3 locus, which is known to play a role in bone remodeling and cartilage maintenance. My second project aimed to elucidate the increased prevalence of type 2 diabetes (T2D) in schizophrenia (SCZ) patients. I used GWAS summary statistics of SCZ and T2D from the PGC and DIAGRAM consortia, respectively, to perform polygenic risk score analyses in three patient groups (SCZ only, T2D only, comorbid SCZ and T2D) and population-based controls. I find that the comorbid patient group have a higher genetic risk for both T2D and SCZ compared to controls, supporting the hypothesis that the epidemiologic link between these disorders is at least in part due to genetic factors.
  • Uq00522f8 OA.Pdf

    Uq00522f8 OA.Pdf

    1 2 DR THAISE MELO (Orcid ID : 0000-0003-0983-4602) 3 DR MARINA R. S. FORTES (Orcid ID : 0000-0002-7254-1960) 4 5 6 Article type : Original Article 7 8 9 Short Running Title: Across-breed QTL validation for sexual precocity in tropical cattle 10 Title: ACROSS-BREED VALIDATION STUDY CONFIRMS AND IDENTIFIES 11 NEW LOCI ASSOCIATED WITH SEXUAL PRECOCITY IN BRAHMAN AND 12 NELLORE CATTLE1 13 Thaise Pinto de Melo*, Marina Rufino Salinas Fortes†‡, Ben Hayes‡, Lucia Galvão de 14 Albuquerque*§, Roberto Carvalheiro*§ 15 16 *Department of Animal Science, School of Agricultural and Veterinarian Sciences, 17 FCAV/ UNESP - Sao Paulo State University, Jaboticabal, Sao Paulo, 14884-900, 18 Brazil. 19 †The University of Queensland, School of Chemistry and Molecular Biosciences, St 20 Lucia, Queensland 4072, Australia. 21 ‡The University of Queensland, Queensland Alliance for Agriculture and Food 22 Innovation, St Lucia, Queensland 4072, Australia. 23 §National Council for Scientific and Technological Development (CNPq), Brasília, 24 Distrito Federal, Brazil. 25 Corresponding author: Roberto Carvalheiro, School of Agricultural and Veterinarian 26 Sciences, FCAV/ UNESP - Sao Paulo State University, Jaboticabal, Brazil. Email: 27 [email protected] Manuscript 28 This is the author manuscript accepted for publication and has undergone full peer review but has not been through the copyediting, typesetting, pagination and proofreading process, which may lead to differences between this version and the Version of Record. Please cite this article as doi: 10.1111/JBG.12429 This article is protected by copyright. All rights reserved 29 ABSTRACT: The aim of this study was to identify candidate regions associated with 30 sexual precocity in Bos indicus.
  • A Prioritization Analysis of Disease Association by Data-Mining of Functional Annotation of Human Genes

    A Prioritization Analysis of Disease Association by Data-Mining of Functional Annotation of Human Genes

    Genomics 99 (2012) 1–9 Contents lists available at SciVerse ScienceDirect Genomics journal homepage: www.elsevier.com/locate/ygeno A prioritization analysis of disease association by data-mining of functional annotation of human genes Takayuki Taniya a,b, Susumu Tanaka c, Yumi Yamaguchi-Kabata b,1, Hideki Hanaoka d, Chisato Yamasaki a,b, Harutoshi Maekawa a,e, Roberto A. Barrero f, Boris Lenhard g, Milton W. Datta h, Mary Shimoyama i, Roger Bumgarner j, Ranajit Chakraborty k,l, Ian Hopkinson m, Libin Jia n, Winston Hide o, Charles Auffray p, Shinsei Minoshima q, Tadashi Imanishi b,⁎, Takashi Gojobori b,r,⁎⁎ a Japan Biological Information Research Center, Japan Biological Informatics Consortium, AIST Bio-IT Research Building 7F, 2-4-7 Aomi, Koto-ku, Tokyo 135-0064, Japan b Biological Information Research Center, National Institute of Advanced Industrial Science and Technology, 2-4-7 Aomi, Koto-ku, Tokyo 135-0064, Japan c Tokyo Metropolitan Institute of Medical Science, 2-1-6 Kamikitazawa, Setagaya-ku, Tokyo 156-8506, Japan d University of Tokyo, Laboratory of Plant Biotechnology, Biotechnology Research Center, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan e C's Lab Co., Ltd., Yamate Bldg. 2F, 7-5-1 Hamamatsu-cho, Minato-ku, Tokyo 101-0041, Japan f Centre for Comparative Genomics, Murdoch University, South Street, WA 6150, Australia g Center for Genomics and Bioinformatics, Karolinska Institute, Berzelius väg 35, SE-171 77 Stockholm, Sweden h Department of Laboratory Medicine and Pathology, University of Minnesota Medical School, United
  • Influence of Chromosome 6 Deletion on the Expressional Characteristics in Humans

    Influence of Chromosome 6 Deletion on the Expressional Characteristics in Humans

    MOJ Biology and Medicine Mini Review Open Access Influence of chromosome 6 deletion on the expressional characteristics in humans Abstract Volume 6 Issue 1 - 2021 Deletion of chromosomal fragments bring about the devastating disease onset which Taskina Murshed, Rashed Noor is apparently almost incurable. Such deletions usually arise denovo as well as from Department of Life Sciences (DLS), School of Environment and the unstable chromosomal translocations, which in turn affect the terminal part of a Life Sciences (SELS), Independent University, Bangladesh chromosome or an interstitial region, making a large number of genes malfunctioning with the onset of various complications. Chromosome 6q deletion happens due to a missing Correspondence: Rashed Noor, Associate Professor, copy of the genetic material existing within the long arm (q) of the chromosome, which Department of Life Sciences (DLS), School of Environment and causes the loss of multiple necessary genes ending up with an array of physical and mental Life Sciences (SELS), Independent University, Bangladesh (IUB), abnormalities. current review discussed the background of such deleterious effects along Plot 16, Block B, Bashundhara, Dhaka 1229, Bangladesh, with some examples, and depicted on the possible mechanisms; i.e., the genetic insights of Tel +8801749401451, Email chromosomal breakpoint based on the information gathered from the previous literature which could be useful in perspective of the surveillance of genetic disease as well as for the Received: December 11, 2020 | Published:
  • Epigenetic Reprogramming in Naive CD4&#43

    Epigenetic Reprogramming in Naive CD4+

    Page 1 of 33 Arthritis & Rheumatology Epigenetic reprogramming in naïve CD4+ T cells favoring T cell activation and non-Th1 effector T cell immune response as an early event in lupus flares Patrick Coit, BS 1* , Mikhail G. Dozmorov, PhD 2* , Joan T. Merrill, MD 3, W. Joseph McCune, MD 1, Kathleen Maksimowicz-McKinnon, DO 4, Jonathan D. Wren, PhD 5,6 , Amr H. Sawalha, MD 1,7 1 Division of Rheumatology, Department of Internal Medicine, University of Michigan, Ann Arbor, Michigan, USA 2 Department of Biostatistics, Virginia Commonwealth University, Richmond, Virginia, USA 3 Clinical Pharmacology Program, Oklahoma Medical Research Foundation, Oklahoma City, Oklahoma, USA 4 Division of Rheumatology, Henry Ford Health System, Detroit, Michigan, USA 5 Arthritis and Clinical Immunology Program, Oklahoma Medical Research Foundation, Oklahoma City, Oklahoma, USA 6 Department of Biochemistry and Molecular Biology, The University of Oklahoma Health Sciences Center, Oklahoma City, Oklahoma, USA 7 Center for Computational Medicine and Bioinformatics, University of Michigan, Ann Arbor, Michigan, USA * These two authors equally contributed to this work Please address correspondence to Amr H. Sawalha, MD; 5520 MSRB-1, SPC 5680, 1150 W. MedicalAccepted Article Center Drive, Ann Arbor, MI 48109, USA. Phone: (734) 763-1858. Fax: (734) 763-4151. Email: [email protected] Running title: T cell epigenetic landscape shift in lupus flares Conflict of interest: None of the authors has any financial conflict of interest to disclose This is the author manuscript accepted for publication and has undergone full peer review but has not been through the copyediting, typesetting, pagination and proofreading process, which may lead to differences between this version and the Version record.
  • Complete Sequence and Gene Map of a Human Major Histocompatibility

    Complete Sequence and Gene Map of a Human Major Histocompatibility

    letters to nature diluted in phosphate-buffered saline (PBS) containing 0.1% bovine serum albumin (BSA) 27. Kahle, P., Barker, P. A., Shooter, E. M. & Hertel, C. p75 nerve growth factor receptor modulates and usually applied by a picospritzer (Parker) coupled to standard micropipettes or to p140trkA kinase activity, but not ligand internalization, in PC12 cells. J. Neurosci. Res. 38, 599–606 double-barrelled theta glass capillaries (Clark). The application pipettes were placed at a (1994). distance of roughly 15 mm above the soma. When NTs were applied at intervals of 5 min or 28. Blo¨chl, A. & Thoenen, H. Localization of cellular storage compartments and sites of constitutive and longer, the NT-elicited responses remained stable for up to 2 h. At shorter application activity-dependent release of nerve growth factor (NGF) in primary cultures of hippocampal neurons. intervals, probably because of desensitization, the responses were smaller or absent. In Mol. Cell Neurosci. 7, 173–190 (1996). some experiments, BDNF was bath-applied. For this purpose it was directly dissolved in 29. Zhou, X. F. & Rush, R. A. Endogenous brain-derived neurotrophic factor is anterogradely transported ACSF containing (in mM): 10 bicuculline, 5 CNQX, 100 APV. The protein kinase in primary sensory neurons. Neuroscience 74, 945–953 (1996). antagonists K-252a or K-252b (both diluted in ACSF; Calbiochem) were either applied to 30. Goodman, L. J. et al. Regulated release and polarized localization of brain-derived neurotrophic factor the somata by micropipettes or by a gravitation-based microperfusion system. All plastic in hippocampal neurons. Mol. Cell Neurosci. 7, 222–238 (1996).
  • Looking Beyond the Standard Genome-Wide Association Study

    Looking Beyond the Standard Genome-Wide Association Study

    Looking beyond the standard genome-wide association study: Biologically-motivated methodological approaches to discover novel genetic variants associated with complex human traits and disease by Cindy Im A thesis submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in Epidemiology School of Public Health University of Alberta © Cindy Im, 2018 ABSTRACT The standard approach for testing associations between common single nucleotide genetic variants (referred to as single nucleotide polymorphisms or SNPs) and disease entails testing disease associations for each SNP in the genome individually. This “hypothesis-free” approach has identified thousands of statistically significant associations between single SNPs and a wide range of diseases. However, complex forms of genetic variation – which include epistatic interactions, gene-environment interactions, inheritance patterns, rare variants, and structural variants – represent a tremendous potential source of transcriptional complexity in the human genome and may contribute substantially to disease risk. These complex forms of genetic variation are not explored in conventional single-SNP genome-wide association studies, largely due to computational, methodological, and statistical constraints. In this dissertation, we look beyond the contributions of single SNPs to the genetic architecture of disease and consider novel approaches to investigate how untested classes of genomic variation present in the human genome may advance our understanding of the genetic basis of disease. More specifically, the studies presented in this thesis describe a novel methodological framework to detect patterns of epistasis (multiple SNP interactions) and haplotypes (SNP alleles arranged on the same chromosome) associated with complex disease traits that may also potentially model the regulation of trait-related gene transcription events, thereby elucidating central biomolecular mechanisms that influence disease trait pathogenesis.
  • (12) United States Patent (10) Patent No.: US 7,951,382 B2 Gelber Et Al

    (12) United States Patent (10) Patent No.: US 7,951,382 B2 Gelber Et Al

    US007951382B2 (12) United States Patent (10) Patent No.: US 7,951,382 B2 Gelber et al. (45) Date of Patent: May 31, 2011 (54) METHODS FORTREATMENT OF TYPE 2 WO O3,O14151 A2 2/2003 DABETES WO 2004/084797 A2 10, 2004 WO 2005/055956 6, 2005 (75) Inventors: Cohava Gelber, Nokesville, VA (US); W 38885 33.9 Liping Liu, Manassas, VA (US); Zhidong Xie, Manassas, VA (US); OTHER PUBLICATIONS Pranvera Ikonomi, Manassas, VA (US); Antibody Directory (2006), Antichymotrypsin, 3 pages. John R Simms, Haymarket, VA (US); Belagaje et al. (1979) The Journal of Biochemistry 254:5765-5780. Catherine R Auge, Haymarket, VA (US) Better et al. (1988), Science 240: 1041-1043. Boulianne et al. (1984), Nature 312:643-646. (73) Assignee: American Type Culture Collection, Budde et al. (2005), Combinatorial Chemistry & High Throughput Manassas, VA (US) Screening 8:775-781. Burke et al. (1999), Arch. Intern. Med. 159: 1450-1456. (*) Notice: Subject to any disclaimer, the term of this Cabilly et al. (1984) Proc. Natl. Acad. Sci. USA 81:3273-3277. patent is extended or adjusted under 35 Chater et al. (1986) In: Sixth International Symposium on U.S.C. 154(b) by 0 days. Actinomycetales Biology, Akademiai Kaido, Budapest, Hungary pp. 45-54. (21) Appl. No.: 12/759,072 DeLong et al. (1988) Biometrics 44:837-845. Eddy et al. (2003) Diabetes Care 26:3102-31 10. (22) Filed: Apr. 13, 2010 Eddy et al. (2003) Diabetes Care 26:3093-3101. Glover (1985) ed. DNA Cloning vol. II. pp. 143-238, IRL Press. (65) Prior Publication Data Glover (1985) ed.