ZIC1 Monoclonal Antibody (M08), Clone 1A8

Total Page：16

File Type：pdf, Size：1020Kb

ZIC1 monoclonal antibody (M08), clone 1A8 Catalog # : H00007545-M08 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full length recombinant Western Blot (Cell lysate) Description: ZIC1. Immunogen: ZIC1 (NP_003403, 139 a.a. ~ 212 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: GHLLFPGLHEQAAGHASPNVVNGQMRLGFSGDMYPRPEQYGQVTSPR SEHYAAPQLHGYGPMNVNMAAHHGAGA enlarge Western Blot (Recombinant Host: Mouse protein) Reactivity: Human, Rat ELISA Isotype: IgG2b Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: Western Blot detection against Immunogen (34.14 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Cell lysate) Page 1 of 2 2016/5/22 ZIC1 monoclonal antibody (M08), clone 1A8. Western Blot analysis of ZIC1 expression in PC-12. Protocol Download Western Blot (Recombinant protein) Protocol Download ELISA Gene Information Entrez GeneID: 7545 GeneBank NM_003412 Accession#: Protein NP_003403 Accession#: Gene Name: ZIC1 Gene Alias: ZIC,ZNF201 Gene Zic family member 1 (odd-paired homolog, Drosophila) Description: Omim ID: 600470 Gene Ontology: Hyperlink Gene Summary: This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development. Aberrant expression of this gene is seen in medulloblastoma, a childhood brain tumor. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 4, a related family member on chromosome 3. This gene encodes a transcription factor that can bind and transactivate the apolipoprotein E gene. [provided by RefSeq Other Zic family member 1 (odd-paired Drosophila homolog),Zinc finger Designations: protein of the cerebellum 1,zinc finger protein of the cerebellum 1 Related Disease Genetic Predisposition to Disease Neural Tube Defects 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2016/5/22.

Copy Link

Recommended publications

The Complete Genome Sequences, Unique Mutational Spectra, and Developmental Potency of Adult Neurons Revealed by Cloning
Article The Complete Genome Sequences, Unique Mutational Spectra, and Developmental Potency of Adult Neurons Revealed by Cloning Highlights Authors d Reprogramming neurons by cloning enables high-ﬁdelity Jennifer L. Hazen, Gregory G. Faust, whole-genome sequencing Alberto R. Rodriguez, ..., Sergey Kupriyanov, Ira M. Hall, d Neurons harbor 100 unique mutations but lack recurrent Kristin K. Baldwin DNA rearrangements Correspondence d Neuronal mutations impact expressed genes and exhibit unique molecular signatures [email protected] (I.M.H.), [email protected] (K.K.B.) d Mature adult neurons can generate fertile adult mouse clones In Brief Hazen et al. use cloning to amplify and perform complete genome sequence analyses on adult neurons. They discover unique characteristics of neuronal genomes consistent with postmitotic mutation and further establish neuronal genomic integrity by generating fertile mice from these neurons. Hazen et al., 2016, Neuron 89, 1223–1236 March 16, 2016 ª2016 Elsevier Inc. http://dx.doi.org/10.1016/j.neuron.2016.02.004 Neuron Article The Complete Genome Sequences, Unique Mutational Spectra, and Developmental Potency of Adult Neurons Revealed by Cloning Jennifer L. Hazen,1,8 Gregory G. Faust,2,8 Alberto R. Rodriguez,3 William C. Ferguson,1 Svetlana Shumilina,2 Royden A. Clark,2 Michael J. Boland,1 Greg Martin,3 Pavel Chubukov,1,4 Rachel K. Tsunemoto,1,5 Ali Torkamani,4 Sergey Kupriyanov,3 Ira M. Hall,6,7,* and Kristin K. Baldwin1,5,* 1Department of Molecular and Cellular Neuroscience, The Scripps Research Institute, 10550 N. Torrey Pines Road, La Jolla, CA 92037, USA 2Department of Biochemistry and Molecular Genetics, University of Virginia School of Medicine, 1340 Jefferson Park Avenue, Charlottesville, VA 22901, USA 3Mouse Genetics Core Facility 4Department of Integrative Structural and Computational Biology The Scripps Research Institute, 10550 N.
[Show full text]
Genome-Wide DNA Methylation Profiling Reveals Methylation Markers Associated with 3Q Gain for Detection of Cervical Precancer and Cancer
Published OnlineFirst January 24, 2017; DOI: 10.1158/1078-0432.CCR-16-2641 Biology of Human Tumors Clinical Cancer Research Genome-wide DNA Methylation Profiling Reveals Methylation Markers Associated with 3q Gain for Detection of Cervical Precancer and Cancer Wina Verlaat1, Peter J.F. Snijders1, Putri W. Novianti1,2, Saskia M. Wilting1, Lise M.A. De Strooper1, Geert Trooskens3, Johan Vandersmissen3, Wim Van Criekinge3, G. Bea A. Wisman4, Chris J.L.M. Meijer1, Danielle€ A.M. Heideman1, and Renske D.M. Steenbergen1 Abstract Purpose: Epigenetic host cell changes involved in cervical PCR (MSP) resulted in 3 genes (GHSR, SST, and ZIC1) that cancer development following a persistent high-risk human pap- showed a significant increase in methylation with severity of illomavirus (hrHPV) infection, provide promising markers for the disease in both tissue specimens and cervical scrapes (P < management of hrHPV-positive women. In particular, markers 0.005). The area under the ROC curve for CIN3 or worse varied based on DNA methylation of tumor suppressor gene promoters between 0.86 and 0.89. Within the group of CIN2/3, methylation are valuable. These markers ideally identify hrHPV-positive wom- levels of all 3 genes increased with duration of lesion existence en with precancer (CIN2/3) in need of treatment. Here, we set out (P < 0.0005), characterized by duration of preceding hrHPV to identify biologically relevant methylation markers by genome- infection, and were significantly higher in the presence of a 3q wide methylation analysis of both hrHPV-transformed cell lines gain (P < 0.05) in the corresponding tissue biopsy. and cervical tissue specimens.
[Show full text]
1A Multiple Sclerosis Treatment
The Pharmacogenomics Journal (2012) 12, 134–146 & 2012 Macmillan Publishers Limited. All rights reserved 1470-269X/12 www.nature.com/tpj ORIGINAL ARTICLE Network analysis of transcriptional regulation in response to intramuscular interferon-b-1a multiple sclerosis treatment M Hecker1,2, RH Goertsches2,3, Interferon-b (IFN-b) is one of the major drugs for multiple sclerosis (MS) 3 2 treatment. The purpose of this study was to characterize the transcriptional C Fatum , D Koczan , effects induced by intramuscular IFN-b-1a therapy in patients with relapsing– 2 1 H-J Thiesen , R Guthke remitting form of MS. By using Affymetrix DNA microarrays, we obtained and UK Zettl3 genome-wide expression profiles of peripheral blood mononuclear cells of 24 MS patients within the first 4 weeks of IFN-b administration. We identified 1Leibniz Institute for Natural Product Research 121 genes that were significantly up- or downregulated compared with and Infection Biology—Hans-Knoell-Institute, baseline, with stronger changed expression at 1 week after start of therapy. Jena, Germany; 2University of Rostock, Institute of Immunology, Rostock, Germany and Eleven transcription factor-binding sites (TFBS) are overrepresented in the 3University of Rostock, Department of Neurology, regulatory regions of these genes, including those of IFN regulatory factors Rostock, Germany and NF-kB. We then applied TFBS-integrating least angle regression, a novel integrative algorithm for deriving gene regulatory networks from gene Correspondence: M Hecker, Leibniz Institute for Natural Product expression data and TFBS information, to reconstruct the underlying network Research and Infection Biology—Hans-Knoell- of molecular interactions. An NF-kB-centered sub-network of genes was Institute, Beutenbergstr.
[Show full text]
Rabbit Anti-Zic1/FITC Conjugated Antibody
SunLong Biotech Co.,LTD Tel: 0086-571- 56623320 Fax:0086-571- 56623318 E-mail:[email protected] www.sunlongbiotech.com Rabbit Anti-Zic1/FITC Conjugated antibody SL11609R-FITC Product Name: Anti-Zic1/FITC Chinese Name: FITC标记的Zinc finger protein201抗体 ZNF201; Odd paired homolog Drosophila; Zic 1; ZIC; Zic family member 1 (odd- paired Drosophila homolog); Zic family member 1; Zic protein member 1; zic1; Alias: ZIC1_HUMAN; Zinc finger protein 201; Zinc finger protein of the cerebellum 1; Zinc finger protein ZIC 1; Zinc finger protein ZIC1; ZNF 201. Organism Species: Rabbit Clonality: Polyclonal React Species: Human,Mouse,Rat,Chicken,Pig,Cow, ICC=1:50-200IF=1:50-200 Applications: not yet tested in other applications. optimal dilutions/concentrations should be determined by the end user. Molecular weight: 48kDa Form: Lyophilized or Liquid Concentration: 1mg/ml immunogen: KLH conjugated synthetic peptide derived from human Zic1 (201-286aa) Lsotype: IgG Purification: affinitywww.sunlongbiotech.com purified by Protein A Storage Buffer: 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year Storage: when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C. background: Zic1 is a C2H2 zinc finger transcription factor that controls the expansion of neuronal precursors by inhibiting the progression of neuronal differentiation. Zic1 determines the Product Detail: cerebellar folial pattern by influencing proliferation in the external germinal layer (EGL).
[Show full text]
Transcriptional Expression of Zics As an Independent Indicator of Survival in Gliomas Zhaocheng Han, Jingnan Jia, Yangting Lv, Rongyanqi Wang & Kegang Cao*
www.nature.com/scientificreports OPEN Transcriptional expression of ZICs as an independent indicator of survival in gliomas Zhaocheng Han, Jingnan Jia, Yangting Lv, Rongyanqi Wang & Kegang Cao* The functional signifcance of the zinc-fnger of the cerebellum (ZIC) gene family in gliomas remains to be elucidated. Clinical data from patients with gliomas, containing expression levels of ZIC genes, were extracted from CCLE, GEPIA2 and The Human Protein Atlas (HPA). Univariate survival analysis adjusted by Cox regression via OncoLnc was used to determine the prognostic signifcance of ZIC expression. We used cBioPortal to explore the correlation between gene mutations and overall survival (OS). ZIC expression was found to be related to immune cell infltration in gliomas via TIMER analysis. GO term and KEGG pathway enrichment analyzes were performed with Metascape. PPI networks were constructed using STRING. The expression levels of ZIC1/3/4/5 in gliomas were signifcantly diferent from those in normal samples. High expression levels of ZIC1/5 were associated with poor OS in brain low-grade glioma (LGG) patients, while low ZIC3 expression combined was related to favorable OS in glioblastoma multiforme (GBM). ZIC alterations were associated with poor prognosis in LGG patients and related to favorable prognosis in GBM patients. We observed that the expression of ZICs was related to immune cell infltration in glioma patients. ZICs were enriched in several pathways and biological processes involving Neuroactive ligand-receptor interaction (hsa04080). The PPI network revealed that some proteins coexpressed with ZICs played a role in the pathogenesis of gliomas. Diferences in the expression levels of ZIC genes could provide a signifcant marker for predicting prognosis in gliomas.
[Show full text]
Product Description SALSA MLPA Probemix P267
MRC-Holland ® Product Description version B1-01; Issued 11 April 2018 MLPA Product Description SALSA ® MLPA ® Probemix P267-B1 Dandy-Walker To be used with the MLPA General Protocol. Version B1. As compared to version A3, probes for FOXC1 and VLDLR exon 9 have been added, one probe for ZIC1 exon 1 has been removed, and several probes for VLDLR , ZIC1 , ZIC4 and SMARCA2 have been replaced. Seven reference probes have been replaced and two reference probes have been added. In addition, several probes have been changed in length, but no or small change in sequence detected. For complete product history see page 8. Catalogue numbers: • P267-025R: SALSA MLPA Probemix P267 Dandy-Walker, 25 reactions. • P267-050R: SALSA MLPA Probemix P267 Dandy-Walker, 50 reactions. • P267-100R: SALSA MLPA Probemix P267 Dandy-Walker, 100 reactions. To be used in combination with a SALSA MLPA reagent kit, available for various number of reactions. MLPA reagent kits are either provided with FAM or Cy5.0 dye-labelled PCR primer, suitable for Applied Biosystems and Beckman capillary sequencers, respectively (see www.mlpa.com ). Certificate of Analysis: Information regarding storage conditions, quality tests, and a sample electropherogram from the current sales lot is available at www.mlpa.com. Precautions and warnings: For professional use only. Always consult the most recent product description AND the MLPA General Protocol before use: www.mlpa.com . It is the responsibility of the user to be aware of the latest scientific knowledge of the application before drawing any conclusions from findings generated with this product. General Information: The SALSA MLPA Probemix P267 Dandy-Walker is a research use only (RUO) assay for the detection of deletions or duplications in the ZIC1 , ZIC4 , VLDLR , and FOXC1 genes, which are associated with Dandy-Walker malformation.
[Show full text]
Nb600-488Af647
Product Datasheet ZIC1 Antibody [Alexa Fluor® 647] NB600-488AF647 Unit Size: 0.1 ml Store at 4C in the dark. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/NB600-488AF647 Updated 5/6/2020 v.20.1 Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/NB600-488AF647 Page 1 of 3 v.20.1 Updated 5/6/2020 NB600-488AF647 ZIC1 Antibody [Alexa Fluor® 647] Product Information Unit Size 0.1 ml Concentration Please see the vial label for concentration. If unlisted please contact technical services. Storage Store at 4C in the dark. Clonality Polyclonal Preservative 0.05% Sodium Azide Isotype IgG Conjugate Alexa Fluor 647 Purity Immunogen affinity purified Buffer 50mM Sodium Borate Product Description Host Rabbit Gene ID 7545 Gene Symbol ZIC1 Species Human, Mouse Reactivity Notes Human and mouse. Predicted to react with rat based on 100% sequence homology. Marker Ectoderm Marker Immunogen A synthetic peptide made to an internal portion of the human Zic1 protein (between residues 20-75) [UniProt Q15915] Notes Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research.
[Show full text]
Hypermethylation of Human DNA: Fine-Tuning Transcription Associated with Development
bioRxiv preprint doi: https://doi.org/10.1101/212191; this version posted October 31, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Hypermethylation of human DNA: Fine-tuning transcription associated with development Carl Baribault1,2, Kenneth C. Ehrlich3, V. K. Chaithanya Ponnaluri4, Sriharsa Pradhan4, Michelle Lacey2, and Melanie Ehrlich1,3,5* 1Tulane Cancer Center, Tulane University Health Sciences Center, New Orleans, LA 70112, USA. 2Department of Mathematics, Tulane University, New Orleans, LA 70118, USA. 3Center for Bioinformatics and Genomics, Tulane University Health Sciences Center. 4 New England Biolabs, Ipswich, MA 01938, USA. 5Hayward Genetics Center Tulane University Health Sciences Center, New Orleans, LA 70112, USA. *Correspondence: [email protected] Email addresses of other authors: [email protected] , [email protected] , [email protected], [email protected], [email protected] , and [email protected] Key words: DNA methylation, chromatin, development, epigenetic memory, CTCF, NR2F2 (COUP-TFII), NKX2-5, LXN (Latexin), EN1, and PAX3 1 bioRxiv preprint doi: https://doi.org/10.1101/212191; this version posted October 31, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Tissue-specific gene transcription can be affected by DNA methylation in ways that are difficult to discern from studies focused on genome-wide analyses of differentially methylated regions (DMRs). We studied 95 genes in detail using available epigenetic and transcription databases to detect and elucidate less obvious associations between development-linked hypermethylated DMRs in myoblasts (Mb) and cell- and tissue- specific expression.
[Show full text]
A Role for Zic1 and Zic2 in Myf5 Regulation and Somite Myogenesis
CORE Metadata, citation and similar papers at core.ac.uk Provided by Elsevier - Publisher Connector Developmental Biology 351 (2011) 120–127 Contents lists available at ScienceDirect Developmental Biology journal homepage: www.elsevier.com/developmentalbiology A role for Zic1 and Zic2 in Myf5 regulation and somite myogenesis Hua Pan a, Marcus K. Gustafsson a, Jun Aruga c,JohnJ.Tiedkena,JenniferC.J.Chenb, Charles P. Emerson Jr. a,b,⁎ a Department of Cell and Developmental Biology, University of Pennsylvania School of Medicine, Philadelphia, PA 19104-6058, USA b Boston Biomedical Research Institute, 64 Grove Street, Watertown, MA 02472, USA c Laboratory for Developmental Neurobiology, RIKEN Brain Sciences Institute, 2-1 Hirosawa, Wako-shi, Saitama 351-0198, Japan article info abstract Article history: Zic genes encode a conserved family of zinc ﬁnger proteins with essential functions in neural development Received for publication 11 March 2009 and axial skeletal patterning in the vertebrate embryo. Zic proteins also function as Gli co-factors in Hedgehog Revised 15 December 2010 signaling. Here, we report that Zic genes have a role in Myf5 regulation for epaxial somite myogenesis in the Accepted 20 December 2010 mouse embryo. In situ hybridization studies show that Zic1, 2, and 3 transcripts are expressed in Myf5- Available online 4 January 2011 expressing epaxial myogenic progenitors in the dorsal medial dermomyotome of newly forming somites, and immunohistological studies show that Zic2 protein is co-localized with Myf5 and Pax3 in the dorsal medial lip Keywords: Zic of the dermomyotome, but is not expressed in the forming myotome. In functional reporter assays, Zic1 and Sonic hedgehog Zic2, but not Zic3, potentiate the transactivation of Gli-dependent Myf5 epaxial somite-speciﬁc (ES) enhancer Gli activity in 3T3 cells, and Zic1 activates endogenous Myf5 expression in 10T1/2 cells and in presomitic Myf5 mesoderm explants.
[Show full text]
Nb600-488Af488
Product Datasheet ZIC1 Antibody [Alexa Fluor 488] NB600-488AF488 Unit Size: 0.1 ml Store at 4C in the dark. Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/NB600-488AF488 Updated 10/26/2016 v.20.1 Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/NB600-488AF488 Page 1 of 2 v.20.1 Updated 10/26/2016 NB600-488AF488 ZIC1 Antibody [Alexa Fluor 488] Product Information Unit Size 0.1 ml Concentration Please see the vial label for concentration. If unlisted please contact technical services. Storage Store at 4C in the dark. Clonality Polyclonal Preservative 0.05% Sodium Azide Conjugate Alexa Fluor 488 Purity Immunogen affinity purified Buffer 50mM Sodium Borate Product Description Host Rabbit Gene ID 7545 Gene Symbol ZIC1 Species Human, Mouse Reactivity Notes Human and mouse. Predicted to react with rat based on 100% sequence homology. Marker Ectoderm Marker Immunogen A synthetic peptide made to an internal portion of the human Zic1 protein (between residues 20-75) [UniProt Q15915] Product Application Details Applications Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Frozen, Immunohistochemistry- Paraffin Recommended Dilutions Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen Application Notes This Zic1 antibody is useful for Western Blot and Immunohistochemisty-paraffin
[Show full text]
Product Datasheet ZIC1 Antibody NB600-488
Product Datasheet ZIC1 Antibody NB600-488 Unit Size: 0.1 ml Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Publications: 4 Protocols, Publications, Related Products, Reviews, Research Tools and Images at: www.novusbio.com/NB600-488 Updated 9/27/2020 v.20.1 Earn rewards for product reviews and publications. Submit a publication at www.novusbio.com/publications Submit a review at www.novusbio.com/reviews/destination/NB600-488 Page 1 of 5 v.20.1 Updated 9/27/2020 NB600-488 ZIC1 Antibody Product Information Unit Size 0.1 ml Concentration 1.0 mg/ml Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. Clonality Polyclonal Preservative 0.01% Sodium Azide Isotype IgG Purity Immunogen affinity purified Buffer PBS and 30% Glycerol Product Description Host Rabbit Gene ID 7545 Gene Symbol ZIC1 Species Human, Mouse Reactivity Notes Human and mouse. Predicted to react with rat based on 100% sequence homology. Marker Ectoderm Marker Immunogen A synthetic peptide made to an internal portion of the human Zic1 protein (between residues 20-75) [UniProt Q15915] Product Application Details Applications Western Blot, Immunocytochemistry/Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Frozen, Immunohistochemistry- Paraffin Recommended Dilutions Western Blot 1:1000, Immunohistochemistry 1:400, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry- Paraffin 1:400, Immunohistochemistry-Frozen Application Notes This Zic1 antibody is useful for Western Blot and Immunohistochemisty-paraffin sections. Prior to immunostaining paraffin tissues, antigen retrieval with sodium citrate buffer (pH 6.0) is recommended. Use in Immunohistochemisty-frozen sections was reported in the scientific literature (PMID: 23862012).
[Show full text]
Anti-Zic1 Antibody (ARG41833)
Product datasheet [email protected] ARG41833 Package: 100 μl anti-Zic1 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes Zic1 Tested Reactivity Hu Tested Application FACS, ICC/IF, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name Zic1 Antigen Species Human Immunogen Synthetic peptide of Human Zic1. Conjugation Un-conjugated Alternate Names Zinc finger protein 201; Zinc finger protein ZIC 1; ZIC; Zinc finger protein of the cerebellum 1; ZNF201 Application Instructions Application table Application Dilution FACS 1:120 ICC/IF 1:50 - 1:200 WB 1:500 - 1:2000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control SW480 Calculated Mw 48 kDa Observed Size ~ 48 kDa Properties Form Liquid Purification Affinity purified. Buffer PBS (pH 7.4), 150 mM NaCl, 0.02% Sodium azide and 50% Glycerol. Preservative 0.02% Sodium azide Stabilizer 50% Glycerol Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. www.arigobio.com 1/2 Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation Gene Symbol ZIC1 Gene Full Name Zic family member 1 Background This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development.
[Show full text]