Equipment Summary Specifications Generator Specifications

Two (2) 300kW Generators, with onboard paralleling capability, equal to:

Model: Kohler 300REOZJ x 2 kW: 300 x 2 Voltage: 277/480 Phase: 3 Wire: 4 Hertz: 60

Fuel: Diesel Cooling: Radiator Configuration: Outdoor " UL 2200 Listed " DEC-6000 Digital Generator Set Controller with digital display of voltage, amperes, frequency, accumulated run time, oil pressure and water pressure, rotary/push button selection, integral voltage regulation with +/-0.5% regulation, integral field breaker for generator protection, Modbus communication, equipped with form C dry contacts for alarm annunciation " (1) Master Control Panel " Kohler factory Sound Attenuated outdoor weather housing, designed to reduce ambient noise level to approximately 75 dBA @ 7 meters, equipped with electrical package wired to lights, outlets, battery charger, block heater and alternator heater " 2 x 85 hour sub base fuel tanks, UL 142 listed, 1865 gallons " Engine block heater, 2,500 watt, 120 volt " Restricted air filter indicator " 600amp circuit breakers, electronic trip, 100% rated, LSI, Aux contacts, electronically operated " Dry contacts kit - 10 dry contacts, each unit " (2) 22 light remote annunciators " Kohler battery charger, 10amp float type, with alarms " Steel skid base with end caps and lube oil drain extension " Lube oil and antifreeze " Operations and Maintenance manual on CD-ROM " Certified Test Report " Factory 0.8 Power Factor Test " Job site delivery - offloading by others " Initial start-up and customer demonstration " Jobsite load test with portable resistive load bank - assuming reasonable access " Kohler 2 Year warranty Decision-Maker r Paralleling System (DPS)

Generator Set Controlle r

Kohler r Decision-Maker r 6000 Paralleling Generator Set Controller General Description and Function

The Decision-Maker r 6000 generator set controller provides generator set advanced control, system monitoring, and system diagnostics, and control for paralleling multiple generator sets.

The Decision-Maker r 6000 interfaces the generator set to other power system equipment and other network management systems using standard industry network communications.

The controller uses unique software logic to manage sophisticated functions, such as voltage regulation, synchronizing and load sharing controls, and protective relays for paralleling up to eight generator sets on an isolated bus or one generator set to the local utility.

Decision-Maker r 6000 Paralleling Controller Paralleling controller features include:

D Isochronous (real and reactive) load sharing with other Decision-Maker r 6000 controller equipped generator sets. D Random first-on logic to prevent two or more generator sets from closing to a dead bus. D Automatic synchronizer with dead bus closing. D Soft loading and unloading. D Protective relays: d Synch check (25C) d Loss of field (40) d Over current (51) d Over frequency (81O) d Over power (32O) d Over voltage (59) d Reverse power (32R) d Under frequency (81U) d Under voltage (27)

Additional controller features include:

D A digital display and keypad provide access to data. The display provides complete and understandable information, and the keypad allows easy local access. D The controller communicates directly with a personal computer via a network or via a modem configuration. D A lockout key switch meets appropriate local code requirements. D The controller supports Modbus r RTU protocol.

Modbus r is a registered trademark of Schneider Electric.

G6-107 11/13c Page 1 Emergency Stop Switch Alarm Horn Status Lamps Breaker Control Buttons Digital Display

DECISION-MAKERr 6000

Lockout Key Switch Master Switch Buttons (Off/Auto/Run) Operating Guide Menu Keypad

GM62798-

Controller Specifications D Status lamps d System ready (green) Decision-Maker r 6000—Software Version 2.5.23 or higher d Shutdown active (red) d Warning active (yellow) D Power supply: 12- or 24-volt DC d Not in auto (yellow) D Power drain: 700 milliamps (or 400 milliamps without panel lamps) d Programming mode, flashing--local, steady--remote (yellow) D Humidity range: 5% to 95% noncondensing d Sync (green), off--not active, flashing--active, steady--in sync D Operating temperature range: --40 qC to +70 qC (--40 qF to +158 qF) d (Generator set status) (red), off--no voltage detected, D Storage temperature range: --40 qC to +85 qC (--40 qF to +185 qF) on--generator set output voltage is detected * D Standards: D Communication ports d NFPA 99 d Two RS-485 connector for Modbus r RTU communication ports d NFPA 110, Level 1 d One RS-232 connector for a PC or modem (optional software (requires optional RSA for standard NFPA outputs) required) d CSA 282-09 D Integrated functions include: d UL 508 d Base load control (kW and kVAR/PF) D Dimensions—W x H x D, d Generator set circuit breaker control 460 x 275 x 291 mm (18.15 x 10.8 x 11.47 in.) d Load sharing logic (kW and kVAR) d Load shed logic User Interface Controls and Components d Synchronizer d Voltage regulator, 3-phase, r0.25% D Emergency stop switch with International Electromechanical D Fuse-protected battery circuits Commission (IEC) yellow ring identification D Inputs and outputs (see Controller Monitoring for details) D Lockout key switch D Controller mounts on the generator set and is viewable from one of D Vacuum fluorescent display with two lines of 20 characters (see User four positions or remotely up to a distance of 12 m (40 ft.) Interface Displays for menus) D Customer and remote inputs: D Alarm horn indicates generator set shutdown and warning faults d Analog inputs 0--5 VDC (up to 7 user-defined analog inputs D Environmentally sealed membrane with five buttons and lamps with multiple shutdown and warning levels) d Off (red) d Digital contact inputs (up to 21 user-defined digital inputs with d Auto (green) shutdown or warning levels) d Run (yellow) d Remote emergency stop d Open paralleling breaker (green) d Remote reset d Close paralleling breaker (red) d Remote 2-wire start D Environmentally sealed 16-button membrane navigation and entry * The lamp is on when generator set output voltage is detected. Voltage keypad may be present on the generator set bus even if the lamp is off, in some d 0--9 numeric entry circumstances such as blown fuses in the generator voltage sensing d Yes/no entry d Menu reset, menu right, menu down, and enter circuit. d Stop program run d Alarm silence and time AM/PM d Lamp test

G6-107 11/13c Page 2 User Interface Controls and Components Relay Warning Shutdown Driver (continued) Status Event or Fault Function Function Output D Digital inputs (standard): Controller/Communication Function d Battery charger fault Active no dial X d Battleswitch d Emergency stop Auto button pressed X d Field overvoltage (350 kW and higher) Battle switch d First on enable (fault shutdown override switch) D d Frequency trim enable d Generator circuit breaker auxiliary Connection failed (communication) X d Generator circuit breaker, over current trip switch (OTS) Controller setup error D X d Ground fault detector Dialout message sent X d High oil temperature d Idle mode active (ECM models only) Date change from (controller) X d kVAR raise/lower Duplicate PGEN ID X d kVAR/PF raise/lower EEPROM initialized X d kW raise/lower d Load enable EEPROM write failure D X d Low coolant level Extra PGEN node X d Low coolant temperature d Low fuel warning Frequency selection error D X d Low fuel shutdown Key switch locked X d Speed raise/lower Key switch unlocked X d Synch enable d Utility circuit breaker auxiliary kW selection error D X d Voltage raise/lower Loss of ECM communication D X d Voltage trim enable Master not In auto (generator set D Thirty-one user-defined relay driver outputs (relays not included). switch) (status) D X See the Controller Functions for a breakdown of the available shutdown and warning functions. Master switch error D X d NFPA 110 faults Master switch open D X d Defined common faults Master switch to off D X Missing PGEN node X Controller Functions No coolant temperature signal D X No modem at power up X The following chart shows which functions cause a warning or shutdown. No oil pressure signal D X Most functions are available as relay outputs. The user customizes outputs Off button pressed X through a menu of warnings, shutdowns, and status conditions. User Open button pressed (circuit X defines up to 31 relay driver outputs (RDOs) (relays not included). breaker) Phase selection error D X Warning causes the warning lamp to show yellow, shows a text message Run button pressed X on the digital display, and sounds the alarm horn signaling an impending SCRDOs 1--4 (software controlled problem. RDOs) X Shutdown causesthefault lampto showred, showsa textmessage onthe State initialized X digital display, sounds the alarm horn, and stops the generator set. Volt selection error D X Generator Function Relay AC sensing loss D D X Warning Shutdown Driver Alternator protection D X Status Event or Fault Function Function Output Critical over voltage D X General Function Field over voltage digital aux. Analog aux. inputs A01--A07 d d input (M4, M5, M7, or M10 D Battery charger fault, digital aux. alternator only) D X input D01* Ground fault detected * D X Defined common faults (each Load shed common D X input value is set separately) D X Load shed kW over D X (default includes [) Load shed underfrequency D X Defined common warning (each input value is set D X Locked rotor D X separately) Loss of field (40) D X Digital aux. input D01--D21 d d Over current (51) D D X Emergency stop D[ X Over current with volts restraint D X EPS (emergency power system) (51VR) D X supplying load Over frequency (81O) D X Generator set running (status) X Over power (32O) D X Idle (speed) mode function digital Over voltage (each phase) (59) D X d aux. input D21 Under frequency (81U) D X Internal fault D X Under voltage (each phase) (27) D X NFPA 110 fault D D X D Standard functions Remote shutdown D X d Available user functions are engine and fuel dependant System ready (status) X * Function requires optional input sensors or kits and is engine dependent, see Controller Displays as Provided by the Engine ECM. [ Items included with common fault shutdown

G6-107 11/13c Page 3 Controller Functions (continued)

Relay Relay Warning Shutdown Driver Warning Shutdown Driver Status Event or Fault Function Function Output Status Event or Fault Function Function Output Engine Function Paralleling Function Dual starter application X Auto synch disabled D X ECM yellow alarm d X Circuit breaker close attempts fault D X ECM red alarm d X Circuit breaker close fault D X Engine derate active X Circuit breaker common fault D X Dual starter ’B’ X Circuit breaker current fault D X High battery voltage D X Circuit breaker open fault D X High coolant temperature D D[ X Circuit breaker X High oil temperature D D X Close breaker X Intake air temperature d d X Close button pressed (circuit Low battery voltage D X breaker) Low coolant level D X Common protective relay D X Low coolant level, digital aux. input Contactor X d D14 Dead bus sensing fault D X Low coolant temperature D D X External breaker trip D X Low fuel level (diesel models), First on fault D X d X digital aux. input D02 * Generator set circuit breaker closed X Low fuel pressure (gas models), d X Generator set circuit breaker digital aux. input D02 * opened X (Low) oil pressure D D[ X Generator set volts/Hz ok X Maintenance due D X In synch (25C) (status) X Overcrank D[ X PGEN common not online X Over speed D[ X Reverse kVAR D Speed sensor fault D X Reverse power (32R) D X Starter motor ’A’ failure D X Synch frequency match X Starter motor ’B’ failure D X Synch phase match X Time delay air/fuel mixture engine Synch timeout D X start X Time delay circuit breaker trip to Time delay engine cooldown shutdown D X (TDEC) X Utility circuit breaker closed X Time delay engine start (TDES) X Utility circuit breaker opened X Time delay engine starting aid X D Standard functions Weak battery (low cranking voltage) D X d Available user functions are engine and fuel dependant * Function requires optional input sensors or kits and is engine dependent, see Controller Displays as Provided by the Engine ECM. [ Items included with common fault shutdown Controller Displays as Provided by the Engine ECM (availability subject to change by the engine manufacturer) Display GM/PSI Doosan John Deere (JDEC) Volvo (EMS II) Volvo (EDC III) DD/MTU (ADEC) Ambient temperature X Charge air pressure X X X X X Charge air temperature X X X X X Coolant level X X X Coolant pressure X X Coolant temperature X X X X X X Crankcase pressure X X ECM battery voltage X X X ECM fault codes X X X X X X ECM serial number X Engine model number X X Engine serial number X X Engine speed X X X X X X Fuel pressure X X Fuel rate X X X X X X Fuel temperature X X X X Oil level X Oil pressure X X X X X X Oil temperature X X X Trip fuel X X X G6-107 11/13c Page 4 User Interface Display Menus Displays shown in this section relate to three-phase applications. d Time Single-phase applications are similar where relevant. d Date Some menus and line items appear only in paralleling applications. D Menu 7—Generator System d Operating mode, standby or prime The listing below has D denoting main menus, d denoting first level d System line voltage sub-menus, and -- denoting second level sub-menus. d System frequency D Menu 1—Generator Monitoring d Phase, single or three (wye or delta) d System kW rating (shown as three phase or single phase) d System rated current d Volts and Amps d Load shed output setting, %, kW -- Voltage and Current (line-to-line, line-to-neutral for each phase), -- Time delay, min:sec á0.25% accuracy d Over voltage setting, %, VAC -- Frequency, á0.5% accuracy -- Time delay, min:sec d Volts and Amps Summary (available as auto-scroll) d Under voltage setting, %, VAC -- Voltage (line-to-line, line-to-neutral for all phases), á0.25% -- Time delay, min:sec accuracy d Over frequency setting, %, Hz -- Current (L1, L2, L3 for all phases), á0.25% accuracy d Under frequency setting, %, Hz d Power kW d Overspeed, Hz, RPM -- Total kW, á0.5% accuracy d Battery voltage, 12 or 24 volt -- kW for each phase, á0.5% accuracy d Low battery voltage setting, VDC -- Total kW and % of rated kW (alternator duty level), á0.5% d High battery voltage setting, VDC accuracy d Block heater on setting, temp. d Power kVAR d Block heater off setting, temp. -- Total kVAR absorbing/generating, á0.5% accuracy d Enable variable speed governor (VSG), yes/no d Enable digital speed control (DSC), yes/no -- kVAR absorbing/generating for each phase (L1, L2, L3), á0.5% accuracy d English or metric units d Power kVA (power factor) d Set NFPA 110 defaults, yes/no (see NFPA 110 Requirements) -- kVA, total, á0.5% accuracy D Menu 8—Time Delays -- kVA, for each phase (L1, L2, L3), á0.5% accuracy d Engine start, min:sec D Menu 2—Engine Monitoring d Starting aid, min;sec Engine Monitoring (Basic) (metric or English units) d Crank on, min:sec d Crank pause, min:sec d Oil pressure and coolant temperature d Engine cooldown, min:sec d Engine RPM and battery voltage d Cooldown temperature override, yes/no d High coolant temperature warning and shutdown levels d Overcrank shutdown crank cycles d Low oil pressure warning and shutdown levels d Over voltage, min:sec d Engine warmed-up temperature d Under voltage, min:sec d Engine cooled-down temperature d Load shed kW, min:sec Engine Monitoring (Detailed) (metric or English units) D Menu 9—Input Setup d Engine fuel Input Setup (setup digital auxiliary inputs) -- Fuel pressure and temperature * -- Charge air pressure and temperature * d Digital input (up to 21 user-defined digital inputs) -- Fuel rate, expressed as L/hr. (gal./hr.) -- User-defined description -- Fuel used last run (trip fuel), expressed as L (gal.) * -- Message text, yes/no d Engine coolant -- Enable, yes/no -- Coolant pressure and temperature * -- Inhibit time, 0--60 sec. -- Coolant level * -- Delay time, 0--60 sec. d Engine oil Input Setup (setup analog auxiliary inputs) -- Oil pressure and temperature * d Analog input (up to 7user-defined analog inputs) -- Oil level and crankcase pressure * -- User-defined description d Engine misc. -- Warning enabled, yes/no -- ECM battery voltage and ambient temperature * -- Shutdown enabled, yes/no -- Engine model number * -- Inhibit time, 0--60 sec. -- Engine serial number * -- Warning delay time, 0--60 sec. -- Unit number and ECM serial number * -- Shutdown delay time, 0--60 sec. -- ECM fault codes -- Low shutdown value D Menu 3—Analog Monitoring -- Low warning value d Local battery voltage -- High warning value d Analog inputs 0--5 VDC (up to 7 user-defined analog inputs with -- High shutdown value multiple shutdown and warning levels) D Menu 10—Output Setup D Menu 4—Operational Records (up to 31 user-defined relay driver outputs) d Factory test date (relays not included) d Total run time hours d Define common faults d Total run time loaded hours d System events d Total run time unloaded hours -- Common fault, yes/no d Total run time kW hours d Digital inputs d Number of starts -- Common fault, yes/no d Engine start? yes/no and countdown time min:sec d Analog inputs -- Run time hours:minutes -- Common fault, yes/no d Records maintenance D Menu 11—Voltage Regulator -- Maintenance reminder in hours d Average voltage and voltage adjust -- Reset records, yes/no -- Line-to-line voltage of each phase d Run time since maintenance, total hours d Under frequency unload enabled, yes/no d Run time since maintenance, loaded hours -- Frequency setup d Run time since maintenance, unloaded hours -- Slope, volts per cycle d Run time since maintenance, total kW hours d Reactive droop enabled, yes/no d Number of operating days since last maintenance date -- Voltage droop % d Number of starts since last maintenance date d Regulator gain adjust d Last start time and date d Analog volt adjust enabled, yes/no d Total unloaded/loaded hours of last start d Reset regulator defaults, yes/no D Menu 5—Event History (up to 100 stored events) * Function requires optional input sensors or kits and is engine dependent, d Event, time, and date see Controller Displays as Provided by the Engine ECM. D Menu 6—Time and Date d Day of week G6-107 11/13c Page 5 User Interface Display Menus (continued) D Menu 12—Calibration d Synch parameters adjust Calibration (Scale AC Analog Inputs) -- Volts match: window, gain, and reset d Generator voltage line-to-neutral -- Synchronize frequency window and frequency match gain -- Generator line-to-neutral calibration reference for each phase -- Phase match: window, gain, and reset d Generator voltage line-to-line -- Dwell time: first on close time delay, fail to synch time delay, and -- Generator line-to-line calibration reference for each phase voltage/frequency ok timer -- Calibrate regulator, yes/no d Manual synchronize controls and monitoring d Generator amps -- Phase rotation -- Generator line amps calibration reference -- Voltage, frequency, and phase (generator set vs. bus) d Bus voltage line-to-neutral -- Speed and voltage bias -- Bus line-to-neutral calibration reference d Control input settings d Restore defaults -- First on enable -- Restore generator voltage defaults, yes/no -- Load enable -- Restore generator amperage defaults, yes/no -- Sync mode in auto enable -- Restore bus voltage defaults, yes/no -- Sync mode in run enable -- Restore all calibration defaults, yes/no -- kW base load control enable -- kW ramp hold Calibration (Scale Aux. Analog Inputs) -- Frequency trim enable (up to 7 user-defined analog inputs) -- Volts trim enable d Zero aux. analog inputs, yes/no -- Reactive droop enable d Analog input scale value 1 -- kW system control enable -- Scale 1 and scale 2 -- VAR power factor system control enable d Analog input scale value 2 -- External kW adjust enable -- Scale 1 and scale 2 -- External VAR/power factor adjust enable D Menu 13—Communications -- VAR power factor mode control enable d Protocol Modbus 0 -- kVAR control enable -- Modbus online, yes/no -- Power factor control enable -- Connection type, single or converter D Menu 17—Load Share Control -- Primary port, RS-485 or RS-232 d kW load control parameters -- Address -- kW sharing control parameters: kW sharing gain, kW sharing -- Baud rate, 19200 or 9600 reset, kW sharing dead band, frequency trim gain, and d Protocol Modbus 1 frequency trim deadband -- Modbus online, yes/no -- kW base load control parameters: kW adjust, gain, reset, and -- Connection type, single or converter kW dead band -- Primary port, RS-485 or RS-232 -- kW droop control parameters: % of droop at rated kW -- Address -- kW ramp rates: % kW ramp rate, and % kW up/down rate -- Baud rate, 19200 or 9600 -- Disconnect load level: % of kW d Protocol Dial Out (available option) d kVAR load control parameters -- Enabled, yes/no -- kVAR share control parameters: gain, reset, kVAR dead band, -- Target, pager or modem voltage trim gain, and volts trim dead band -- Phone number -- kVAR base load control parameters: kVAR adjust, gain, reset, -- Phone delay (pager only) kVAR dead band, and up/down rate -- Pin number (pager only) -- Power factor control parameters: PF adjust, gain, reset, PF -- Pin delay (pager only) dead band, and up/down rate D Menu 14—Programming Mode -- Reactive droop control parameters: % voltage droop d Programming mode d Circuit breaker and misc. control parameters -- Local -- Breaker energize time delay -- Remote -- Breaker reclose time delay -- Off -- Breaker close attempts d Programming mode change access code -- Circuit breaker current fault limit -- Change access code -- Circuit breaker current fault time delay -- Enter old code -- Transformer phase shift -- Enter new code D Menu 15—Protective Relays (PR--protective relay, SD--shutdown) NFPA 110 Requirements d PR over voltage, %, VAC In order to meet NFPA 110, Level 1 requirements, the generator -- Time delay, sec d PR under voltage, %, VAC set controller monitors the engine/generator functions and faults -- Time delay, sec shown below. [ d PR over frequency, %, Hz D Engine functions: -- Time delay, sec d Overcrank d PR under frequency, %, Hz d Low coolant temperature warning -- Time delay, sec d High coolant temperature warning d PR reverse power, %, kW d High coolant temperature shutdown -- Time delay, sec d Low oil pressure shutdown d SD reverse power, %, kW d Low oil pressure warning -- Time delay, sec d High engine speed d PR over power, %, kW d Low fuel (level or pressure) * -- Time delay, sec d Low coolant level d SD over power, %, kW d EPS supplying load -- Time delay, sec d High battery voltage * d PR loss of field, %, kVAR d Low battery voltage * -- Time delay, sec d SD loss of field, %, kVAR D General functions: -- Time delay, sec d Master switch not in auto d PR over current, %, amps d Battery charger fault * -- Time delay, sec d Lamp test d SD over current, %, amps d Contacts for local and remote common alarm -- Time delay, sec d Audible alarm silence switch d Time delay, breaker trip to SD, min:sec d Remote emergency stop D Menu 16—Paralleling Menu * Function requires optional input sensors or kits and is engine dependent, d PGEN (paralleling generator set) settings see Controller Displays as Provided by the Engine ECM. -- Generator ID -- Number of nodes on bus? [ Requires optional RSA for standard NFPA 110 outputs. G6-107 11/13c Page 6 Controller Features

The control functions apply to both the ECM and non-ECM equipped D Integrated Voltage Regulator . The voltage regulator provides models unless noted otherwise. r0.25% no-load to full-load regulation with three-phase sensing.

D AC Output Voltage Adjustment . The voltage adjustment provides D Lamp Test . Keypad switch verifies functionality of the indicator keypad adjustment in 0.1 volt increments of the average line-to-line lamps, alarm horn, and digital display. AC output voltage with a maximum adjustment of r10% of the system voltage. D Load Shed . The load shed function provides a load control output (RDO) with user-selectable load shed level. D Alternator Protection . The controller firmware provides generator set overload and short circuit protection matched to each alternator D Master Switch Fault . The generator set master switch has fault for the particular voltage/phase configuration. detection at four levels: 1) master switch to off, 2) master switch open, 3) master switch error, and 4) master switch not in auto. Each D Automatic Restart . The controller automatic restart feature initiates of these faults/ warnings provides local display, alarm horn on, and the start routine and recrank when the generator set slows to less activates a relay driver output (RDO). By placing the master switch than 390 RPM after a failed start attempt. to the off/reset position, all generator set faults can be reset.

D Battleswitch (Fault Shutdown Override Switch) . The battle D Measurement Units. The controller provides selection of English or switch input provides the ability to override the fault shutdowns metric displays. except emergency stop and overspeed shutdown in emergency situations and during generator set troubleshooting. D Modbus r Interface . The Modbus r interface provides industry standard open protocol for communication between the generator D Clock and Calendar . Real-time clock and calendar functions time set controller and other devices or for network communications. stamp shutdowns for local display and remote monitor. Also use these functions to determine the generator set start date and days of D Number of Starts . Total number of generator set successful starts operation. is recorded and displayed on the local display and remote PC monitor. This information is a resettable and total record. D Cooldown Temperature Override . This feature provides the ability to bypass (override) the cooldown temperature shutdown and force D Programmed Run . The programmed run function provides the generator set to run for the full engine cooldown time delay. Also user-selectable time for a one-time exercising of the generator set. see Time Delay Engine Cooldown (TDEC). The controller does not provide weekly scheduled exercise periods.

D Communication Access . The controller can connect to a PC for D Programming Access . The setup access and programming updates using SiteTech t software and can provide remote information is password protected. When locally accessing annunciation using Monitor software. Two of the three available programming information, the PM (programming mode) lamp ports may be used. flashes. When remotely accessing programming information, the PM lamp is steady. D Cyclic Cranking . The controller has programmable cyclic cranking. The customer selects the number of crank cycles (1--6) and the D Remote Reset . The remote reset function resets faults and allows crank time from 10 to 30 seconds. The crank disconnect depends restarting of the generator set without going to the master switch upon the speed sensor input information or the generator frequency off/reset position. The remote reset function is initiated via the information. The default cyclic crank setting is 15 seconds on, remote reset digital input. 15 seconds off for three cycles. D RSA II Remote Monitoring Panel. The controller is compatible with D Display Power Shutdown . To conserve battery power, the display the Kohler r Remote Serial Annunciator (RSA II). turns off after 5 minutes of inactivity. Pressing any keypad button activates the display. D Run Time Hourmeter . The run time hourmeter function is available on the local display and remote monitor. The information displayed D ECM Communication . The controller monitors ECM uses real time loaded and unloaded run time as an actual and communication links and provides fault detection for oil pressure resettable record. signal loss, coolant temperature signal loss, and ECM communication loss. Each of these faults provides local display, D Self-Test . The controller has memory protection and a alarm horn ON, and relay driver output (RDO) on ECM models only. microprocessor self-test. See Controller Functions following for additional information. D Time Delay Engine Cooldown (TDEC) . The TDEC provides a D ECM Diagnostics. The controller displays engine ECM fault code user-selectable time delay before the generator set shuts down. If descriptions to help in engine troubleshooting. See Controller the engine is above the preset temperature and unit is signalled to Functions following for additional information. shut down, unit will continue to run for the duration of the TDEC. If the engine is at or below the preset temperature and unit is signalled D Engine Starting Aid . The starting aid feature provides control for to shut down or the TDEC is running, unit will shut down without an ether injection system. This setup has adjustable on time before waiting for the time delay to expire. Also see Cooldown Temperature engine crank from 0 to 10 seconds. This feature is also part of the Override. remote communication option. D Time Delay Engine Start (TDES) . The TDES provides a D Event Logging . The controller keeps a record (up to 100 entries) user-selectable time delay before the generator set starts. for warning and shutdown faults. This fault information becomes a stored record of system events and can be reset.

D Idle Speed Function . Idle speed function provides the ability to Modbus r is a registered trademark of Schneider Electric. start and run the engine at idle speed for a selectable time period. The engine will go to normal speed should the temperature reach warm-up before the time delay is complete.

G6-107 11/13c Page 7 KOHLER CO., Kohler, Wisconsin 53044 USA Kohler Power Systems Phone 920-457-4441, Fax 920-459-1646 Asia Pacific Headquarters For the nearest sales and service outlet in the 7 Jurong Pier Road US and Canada, phone 1-800-544-2444 Singapore 619159 KOHLERPower.com Phone (65) 6264-6422, Fax (65) 6264-645 5

Decision-Maker r 6000 Available Options Communication and PC Software Available Options Other Available Options Refer to G6-76 Monitor III Software and the communication literature for - Common Failure Relay remotely signals auxiliary fault, emergency additional communication and PC software information including stop, high engine temperature, low oil pressure, overcrank, and Modbus r communication. overspeed via one single-pole, double-throw relay with 10-amp contacts at 120 VAC or 28 VDC maximum. - Local Single Connection. A PC is connected directly to the device communication module with an RS-232 cable for applications where - Controller Cable enables remote mounting of the controller with the PC is within 15 m (50 ft.) of the device or RS-485 cable for distances of up to 12 m (40 ft.) from the generator set. applications where the PC is up to 1220 m (4000 ft.) from the device. - Decision-Maker r Paralleling System (DPS) provides the components including a master control panel (MCP), switchboards, - Local Area Network (LAN). A PC is connected directly to the and circuit breakers to parallel several generator sets. (Refer to the device’s local area network. A LAN is a system of connecting more respective DPS literature for details.) than one device to a single PC. - Dry Contact Kit interfaces between the controller signals and - Remote Network (Ethernet): A PC with a NIC card uses an customer-supplied accessories providing contact closure to activate Ethernet connection to access a remotely located converter warning devices such as lamps or horns. Kits are available with (Modbus r/Ethernet) serving a controller. Refer to G6-79 for system either one or ten single-pole, double-throw relays with 10-amp details. contacts at 120 VAC or 28 VDC maximum.

- Remote Network (Modem): A PC uses a modem to connect to a - Float/Equalize Battery Charger with Alarm Feature signals remotely located device modem serving a controller. Monitoring controller of battery charger fault. software (Monitor III) runs on the PC to view system operation. - Prealarm Kit for NFPA 110 (gas fuel models only) warns the - Monitor III Software for Monitoring and Control operator of low fuel pressure. Select the kit based on LP vapor or (Windows r-based user interface) natural gas, combination dual fuel, or LP liquid withdrawal.

- Converter, Modbus r/Ethernet. Supports a power system using - Prime Power Switch prevents battery drain during generator set controllers accessed via the Ethernet. Converter is supplied with an non-operation periods and when the generator set battery cannot be IP address by the site administrator. Refer to G6-79 for converter maintained by an AC battery charger. details. - Remote Audiovisual Alarm Panel warns the operator of fault - RS-232 to RS-485 Port Converters shutdowns and warning conditions. Kit includes common fault lamp and horn with silence switch.

- Remote Emergency Stop Panel immediately shuts the generator set down from a remote station.

Ethernet Modbus r/ - Remote Serial Annunciator (RSA) Panel enables the operator to Ethernet Network monitor the status of the generator set from a remote location, which Converter Personal may be required for NFPA 99 and NFPA 110 installations. Uses Computer OR Modbus r protocol, an industry standard. with NIC

Remote RS-232 to - Run Relay provides a three-pole, double-throw relay with 10-amp Network RS-485 Port contacts at 120 VAC or 28 VDC maximum for indicating that the (Modem) Converter Telephone generator set is running. lines

Personal Computer Modbus r is a registered trademark of Schneider Electric. Windows r is a registered trademark of Microsoft Corporation.

Generator Set with the Decision-Maker r 6000 controller DISTRIBUTED BY:

Availability is subject to change without notice. Kohler Co. reserves the right to change the design or specifications without notice and without any obligation or liability whatsoever. Contact your local Kohler r generator set distributor for availability. ¤ 2010, 2011, 2013 by Kohler Co., All rights reserved.

G6-107 11/13c Page 8 Decision-Maker r Paralleling System

Master Control Panel

MCP 3000 Master Control Panel The MCP 3000 Master Control Panel provides generator management and load management (load add/shed) for generator sets equipped with a Decision-Maker r 6000 controller. The MCP 3000 is capable of managing up to eight (8) generator sets on an isolated bus.

Standard Features

The MCP 3000 provides the following: D Generator management D Load management (load add/shed) d Seven load add relays d Seven load shed relays D 7.5 inch color touchscreen D Graphical system overview D Individual generator set stop/start D No-load test D Electrical metering of the generator sets D Mechanical metering of the generator sets MCP 3000 D Alarm and event logging Master Control Panel Available Option D IBC Seismic Certification available

MCP 3000

G6--113 Master Control Panel 8/10a Page 1 MCP 3000 Functions and Specifications Controls Monitoring D Generator Set Control D Electrical Metering d Auto d Power, kW d Off d Voltage, VAC (Average, AN, BN, CN, AB, BC, CA) d Run d Current, Amps (Average, A, B, C) D Load Management Control (up to 7 loads) d Frequency, Hz d Auto d Power factor d Bypass d Loading, % d Shed D Mechanical Metering d Manual load add d Oil pressure, PSI d Reset d Coolant temperature D No-Load Test d Battery voltage, VDC d Start d Engine speed, RPM d Stop d Engine run time d Test duration, minutes d Number of starts Adjustable Parameters D Alarm and Event Log d Alarm list D Generator Management d Event list (at least 100 events) d Order selection method, runtime or manual D Generator Management Status d Minimum number of generators online d System capacity d Load stable time delay d System load d Next start load level and time delay D Load Management Status d Next stop load level and time delay d Load priority settings d Overload % and time delay d System load D Load Management, Load Add d System capacity d Load add time delay d Load add/shed status d Maximum load level to autoload, %kW D Load Management, Load Shed Specifications d Load shed relay priority level D UL508 listed d Overload setpoint kW D Wall-mounted NEMA 1 enclosure for indoor installation d Overload shed timer D 7.5 inch color human-machine interface (HMI) touchscreen d Under frequency load shed setpoint D 24 VDC power required d Under frequency load shed timer D Environmental specifications: d Under frequency load shed priority level d Operating temperature: 0 _ to 50 _C. (32 _ to 122 _F) d Storage temperature: -20 _ to 60 _C (-4 _ to 140 _F) d Maximum operating humidity: 93% (non-condensing) D Dimensions, L x D x H, mm (in.): 450 x 182 x 791 (17.7 x 7.2 x 31.1) D Weight: 28 kg (62 lbs.)

G6--113 Master Control Panel 8/10a Page 2 Paralleling System Operation System Operation Load Management When the Master Control Panel receives a start signal from one Load management (Load Add/Shed) provides dry contacts to or more automatic transfer switch(es), the lower priority loads control the loads connected to the generator sets. are signaled to shed and the generator sets are signaled to Seven (7) load shed relays are provided. The customer assigns start. The first generator set to reach rated frequency and a priority level to each load shed relay. The customer also voltage connects to the generator paralleling bus. The configures the criteria and time delays for load shed remaining generator sets then synchronize to the paralleling (disconnect) and load add (connect) for each priority level. bus. As additional generator sets connect to the bus, lower priority loads are signaled to add. Load add is based on the number of generator sets on-line and/or kW capacity. The method of load add is user- Graphical System Overview configurable. The main screen graphically depicts system operation Load shed is based on underfrequency and/or kW overload. including: Time delays can be set to control the load shed sequence. D Generator set status D Generator set metering D System or generator set alarms

Individual Generator Set Start/Stop The individual control screen allows the operator to run each generator set in the system. Generator Management Generator management optimizes the number of on-line generator sets based on the kW demand of the load. After a user-configured load stable time delay, generator management starts and stops generator sets based on the requirements of the load. The customer assigns each generator set a priority level. Higher priority units are sequenced on in the order of their priority and taken off in reverse priority. User-defined setpoints determine percent load level and the time delay before each generator set is brought on or taken off line. No Load Test No load test allows the user to test the system from the touchsceen on the Master Control Panel.

G6--113 Master Control Panel 8/10a Page 3 KOHLER CO., Kohler, Wisconsin 53044 USA Kohler Power Systems Phone 920-457-4441, Fax 920-459-1646 Asia Pacific Headquarters For the nearest sales and service outlet in the 7 Jurong Pier Road US and Canada, phone 1-800-544-2444 Singapore 619159 KohlerPower.com Phone (65) 6264-6422, Fax (65) 6264-6455

Electrical Metering Alarms The electrical metering screen allows the user to view electrical The Alarm screen allows the user to view system alarms, system information for each generator set. The multi-gen logged events, and alarm status. metering display shows system information for multiple generator sets for easy comparison. .

History The history screen allows the user to view past alarms, start and stop history, and all system events.

Mechanical Metering The mechanical metering screen allows the user to monitor mechanical engine information for each generator set.

DISTRIBUTED BY:

Availability is subject to change without notice. Kohler Co. reserves the right to change the design or specifications without notice and without any obligation or liability whatsoever. Contact your local Kohler r Power Systems distributor for availability. ¤ 2010 by Kohler Co. All rights reserved. G6--113 Master Control Panel 8/10a Page 4 Drawing Name: A050L371 Revision: A Part Name: A050L370 Revision: A Sheet 1 of 5

Generator Paralleling Switchboard Specifications 106 Mountain Ave SW Date: 04/18/2017 Roanoke, VA 24016 Telephone: (540) 206-3557 Email: [email protected] Fax: Speedi Version: V 11.90 Bill of Material Mondail DR1 SWBD Proposal/Quote Type: Base Bid Quote #: S0AD873 Revision #: 1.0

Valued Customer,

We are pleased to offer this proposal for your review. Thank you for allowing us the opportunity to participate on this project. Please do not hesitate to contact us with any questions. _____ Item#Qty Description ___

11 Spectra Bolt-On AV5 Swb (108A) 3 Section(s) Service Entrance Estimated Shipping Weight:1586 lbs 1 Service Entrance Labeling 3P4W/480/277V/60Hz 600A 65 kAIC Fully Rated Incoming Feed: Bottom Incoming Left Feeding Right Type 3R (non-walk-in) Enclosure Front/Rear Lineup Front Only Access 1 Bussed Pull Section 30W 1 Individually Mounted Feeder Section 25W 1 Group Mounted Feeder Section 35W 3 Bus Bracing 65000 AIC 3 Fully Rated Aluminum Bus 750 A/Sq. in. 3 Ground: Equipment U/L With Lugs 3 Space Heater 120 Volt 2 Full Height Side Barriers 600A Main Lug Only 16 Compression (1 Hole) AL Lugs Service Disconnects 1 400A 3 Pole SGLC4 (400A Frame) Indiv. Mtd. Programmer (MET) LSI 1 STANDARD PADLOCK PROVISIONS 3 Mechanical AL Load Lugs 2 600A 3 Pole SGLA6 (600A Frame) 2 PADLOCK PROVISION 2 SHUNT TRIP - 24V AC/24V DC 2 1 AUX SWITCH - 240V AC/125V DC 4 Mechanical AL Load Lugs Monitoring/Control Devices 1 Thermostat Control Others 3 Engraved Nameplates 3 Screw-On Nameplates 1 Lifting Brackets 1 Spectra Bolt-On (C/B feeders only) 28X Page: 1 Name: Mondail DR1 SWBD Date: 04/18/2017 Quote #: S0AD873 .

Item# Qty Description . 2 3P SGLA6 Single BR Module 9 Equipment Ground Lugs 1 Ground Lug 4 Neutral Lugs 1 Neutral Lugs 1 Bonding Jumper 1 Lug Section - Connectors

Total Lot Price $______Price to follow

Page: 2 )250$71 $&&(6672 )URQW2QO\ 3+$6( 3: &/$66 $03(5( $ /$%(/ 8/6( %8607/ $O$LQð 92/7$*( 9 3/$7( 7LQ3ODWH 67

6ZLWFKERDUG'HYLFH,QIRUPDWLRQ &LUFXLW1R 'HYLFH $PSV 3ROHV 1DPHSODWHV /XJV&DEOH6L]H 1RWHV 6' 6*/& 0&0&80HFK$/ 6' 6*/$ 0&0&80HFK$/ 6' 6*/$ 0&0&80HFK$/ 127(6 6ZLWFKERDUGIXUQLVKHGZLWKDUDLQSURRI7<3(5 QRQZDONLQ HQFORVXUH127(6HHSODQYLHZIRUGHWDLOV1HHGDGGLWRQDOLQFKVSDFH FOHDUDQFHRQWRSDQGLQFKFOHDUDQFHRQWKHUHDURIWKHVZEG (TXLSPHQWJURXQGEXVIXUQLVKHGZLWKOXJV 6ZLWFKERDUGIXUQLVKHGZLWK1DPHSODWHV $OO1DPHSODWHVWREHIDVWHQHGZLWKVFUHZV 6KLSSLQJVSOLWVEHWZHHQHDFKVHFWLRQVKLSHDFKVHFWLRQVHSDUDWHO\ 6ZLWFKERDUGIXUQLVKHGZLWKVHFWLRQVSDFHKHDWHUV 6ZLWFKERDUGIXUQLVKHGZLWKWKHUPRVWDWFRQWUROIRUVHFWLRQVSDFHKHDWHUV 6ZLWFKERDUGIXUQLVKHGZLWKIXOO\UDWHGSDQHO 'HYLFHIXUQLVKHGZLWK0(7 /6, SURJUDPPHU 'HYLFHIXUQLVKHGZLWKSDGORFNLQJSURYLVLRQV 'HYLFHIXUQLVKHGZLWK9$&9'&DX[LOLDU\VZLWFKHV 63'7 'HYLFHIXUQLVKHGZLWK9$&9'&VKXQWWULS (VWLPDWHGVKLSSLQJZHLJKWIRUWKHOLQHXSLVOEV

-2%1$0( 0RQGDLO'56:%' &86720(5 3/$17 0$5.

&86725'(512 12'$7( 5(9,6,216 ,1,7,$/6 0$'(%< ,668(' 5(4112 86$6$' 5(/%< &DUWHU6 25'(512 6+((7 RI ,7(0 3'DWH30 )250$71 $&&(6672 )URQW2QO\ 3+$6( 3: &/$66 $03(5( $ /$%(/ 8/6( %8607/ $O$LQð 92/7$*( 9 3/$7( 7LQ3ODWH 67

8/ 6( 8/ 6( 8/

+HDWHU&RQWURO ;),//(5

;),//(5

6' 6*/& ;),//(5 $ 6' ;),//(5 ;

6 6 6

OEV OEV OEV (VW (VW (VW )52179,(:

$ $ $ 3529,6,21 $ )25)8785( (;7(16,21

6' $

1 $ $ $

%866,1*',$*5$0 0&0&8 &2035(66,21 +2/( $/ 3(53+$6( 1(875$/

-2%1$0( 0RQGDLO'56:%' &86720(5 3/$17 0$5.

7RS&RQGXLW$UHD

6HFWLRQ 6HFWLRQ 6HFWLRQ

&RQGXLW$UHD '[:

7<3

)URQW3ODQ9LHZ

%RWWRP&RQGXLW$UHD

&RQGXLW$UHD &RQGXLW$UHD &RQGXLW$UHD '[: '[: '[:

)URQW3ODQ9LHZ

-2%1$0( 0RQGDLO'56:%' &86720(5 3/$17 0$5.

&86725'(512 12'$7( 5(9,6,216 ,1,7,$/6 0$'(%< ,668(' 5(4112 86$6$' 5(/%< &DUWHU6 25'(512 6+((7 RI ,7(0 3'DWH30 UPS

Equal to Eaton 93PM: Quantity two (2), 70kW, 480/480V, Dual Input, Gateway Card and Industrial Relay Card, Factory Startup, 300A battery disconnect switch, top entry sidecar UPS Installation Plan and Unpacking

Front Front UPS With Left-Mounted Sidecar UPS With Right-Mounted Sidecar

Dimensions are in millimeters [inches]

Figure 3-4. UPS Cabinet with Left-Mounted or Right-Mounted Sidecar Dimensions (Front and Right Side Views)

Eaton 93PM UPS (20–100 kW, 480V – 100 kW Frame) Installation and Operation Manual P-164000227—Rev 6 www.eaton.com/powerquality 3-9 Batteries & Battery Cabinet

Two (2) complete battery systems. Each system comprised of:

Forty (40) Unigy batteries, Model HR-4000 Two (2) C&D Technologies Cabinets, Model RD01623WP MOREMORE POWER POWER ––LESSLESS SPACE SPACE TM

HIGH RATE SERIES

HR4000 I Exclusive IPF ® Technology optimizes power capacity, cell consistency, and long-term reliability I Advanced AGM technology for superior high rate, short term power I Reinforced case resists bulging and meets safety requirements I Case & cover heat sealed and 100% tested to prevent leaks I Epoxy-sealed posts eliminate leaks I Puncture resistant micro-porous glass mat separators extend life I Flame arresting, low pressure, self-sealing valves are 100% factory tested I Computer-aided design, manufacturing control processes, and standards to ensure quality products I All batteries meet or exceed IEEE recommended practices RETURN I Battery design and construction meet UL LEAD recognition requirements Pb

RECYCLE SPECIFICATIONS Nominal Voltage: 12-Volt/420 w.p.c. Safety Vent: Low positive pressure, @ 15 min. rate to 1.67 v.p.c. self-sealing w/ flame arrestor Positive Plate: Pure lead, low-calcium, Float Voltage: 2.25 v.p.c. ± 0.01 v.p.c. (Range: 13.44 high-tin alloy to 13.56 volts per 6-cell battery) Negative Plate: Lead calcium alloy Design Life: 10 years in float applications at 77°F (25°C) Post Seal: Epoxy-sealed Dimensions: 12.93" (328 mm) L Terminal: Top access, x 6.84" (173 mm) W 1/4" - 20 threaded insert x 8.70" (221 mm) H Container: Flame-retardant, polypropylene - Weight: 80 Ibs. (36.2 kg) UL 94 V-0/>28% L.O.I.

DISCHARGE RATE IN WATTS PER CELL RATINGS @ 77°F (25°C) † Volts Per Cell (VPC) 1 MIN. 5 MINS. 10 MINS. 15 MINS. 20 MINS. 30 MINS. 40 MINS. 50 MINS. 60 MINS. 1.60 1405 832 554 428 350 257 204 168 145 1.67 1227 780 541 420 344 254 202 167 143 1.70 1125 750 532 417 342 252 201 166 143 1.75 1027 705 506 404 335 249 198 163 140 1.80 — 640 471 381 316 237 191 159 138

† Subject to change without notice. Lyon Station, PA 19536-0147 • Phone: 610-682-6361 • Fax: 610-682-4781 Order Department Hotline: 610-682-4231 www.eastpennunigy.com • e-mail: [email protected] All data subject to change without notice. No part of this document may be copied or reproduced, electronically E.P.M. Form No. 2010 7/13 © 2013 by EPM Printed in U.S.A. or mechanically, without written permission from the company.

Static Transfer Switches

Two (2) Liebert Static Transfer Switches, 480V, 100A, Dual CB3 output circuit breakers, programmable relay alarm card, factory startup. Installation Drawings

7.0 I NSTALLATION D RAWINGS

Figure 4 Outline drawing: 100 M 250 amp Liebert STS2 30" (762mm) 32.1" (815mm)

Center Center of of Gravity 77" Gravity (1956mm)

36.7" (932mm)

Air Intake Area Do Not Block 18.8" Air Filter 19.2" (477mm) (488mm) FRONT SIDE

23.4" (594mm) Caster Centers Power Cable 24.4" 11.1" See Top Entry Area 8.4" (213mm) (620mm) (280mm) Detail A

FRONT 9.4" (238mm) 13.5" Control Cable 12mm (343mm) Bottom Entry Area 10.7" Centers (272mm) 21.6" 29" (548mm) Power Cable (736mm) 12.8" Caster Bottom Entry Area 14.8" (326mm) 21.5" (376mm) Centers Air (546mm) 10.4" Exhaust FRONT (265mm) Control Cable 1.1" 5.1" Top Entry Area (28mm) 24.4" Maximum Door 29.8" (130mm) 12mm (619mm) Swing 180º (756mm) Centers NOTES TOP 1. 18" (457mm) clearance above unit is required for air exhaust. 2.75" 2. Clearance of 36" (914mm) is required in the front only for (69.8mm) 12mm Diameter Typical installation and service access. Mounting Hole 3. Heat output: 2710 BTU/Hr (0.80kW) maximum for 100A switch. (4 Typically) 4680 BTU/Hr (1.37kW) maximum for 250A switch. See Note 10 4. Weight: 780 lb. (354kg) 5. Unit bottom is structurally adequate for forklift handling. 6. Keep cabinet within 15 degrees of vertical. Leveler 7. Color: Black gray matte DETAIL A 9. Open door to replace air filter, disposable type 1"x25"x25" Front of Unit Shown (25.4 x 635 x 635mm). Without Side Panel 10. Threaded mounting holes (see Detail A) are provided for seismic anchoring or floor stand. Mounting bolts must be threaded into PS211100 the unit from underneath the unit base. If a floor stand is used, Rev. 6 the casters must rest on the floor stand to support the unit's weight.

Liebert & STS2 ( 18 Server Room CRAC Units

Two (2) Liebert 30 Ton Glycool Systems, downflow, EC fans, unloaders, locking disconnect, no reheat or humidifier, condensate pump, Intellislot Unity Card, 18" floorstand, drycoolers with disconnect switch, dual pump package, compression tank with sight glass, factory startup, five (5) year extended compressor warranty Liebert DS Dimensions and Weights

Figure 13 Cabinet and floor planning dimensionsNdownflow, water/glycol/GLYCOOL, 105kW (30 ton), all compressor models Notes: Filters are accessible through top of unit only. Condenser Cleanout Access Downflow electrical 102-13/16" connections can be made (2611mm) Opening from top or bottom of unit.

33" 24-3/8" (838mm) AIR INLET OPENING (619mm Opening Digital scroll 35" compressor not (889mm) available on 105 3/4" models. (19mm Bezels TOP VIEW

Secondary Entrance Secondary Condenser Secondary Entrance Low-Volt Connections Fluid Entrance High-Volt Connection(s) Required for 24" condenser (610mm) cleanout 132" (3353mm) Minimum required for filter replacement 5" (127mm)

76" (1930mm)

34" (864mm) Shaded area indicates a 131" (3327mm) recommended minimum clearance be provided for FRONT VIEW component access. DPN001013 Rev. 4 Table 10 Weights for downflow, water/glycol/GLYCOOL, 105kW (30 ton), all compressor models Compressor Type Coolant Type Forward-Curved Fans EC Fans Water/Glycol 3410 (1550) 3144 (1426) Semi-Hermetic GLYCOOL/Dual-Cool 3770 (1714) 3504 (1589) Water/Glycol 3290 (1495) 3024 (1372) Standard Scroll * GLYCOOL/Dual-Cool 3650 (1659) 3384 (1535) * Digital scroll compressor not available on 105 models. Source: DPN001013, Rev. 4

Liebert & DS ( 18 Dimensions and Weights

Figure 6-2 Drycooler planning dimensional dataNThree- and four-fan units

43-9/16" (1106mm) 131-1/2" (3340mm) 43-9/16" (1106mm) 37-7/8" (962mm) 171-1/2" (4356mm) 70" (1778mm) 37-7/8" 18" (962mm) (457mm) Eyebolts 124" for Lifting (3150mm) 18" (457mm) 43-3/16" (1097mm)

164" Note: (4166mm) Overall height to the top of fan guard 43-1/8" (1095mm) 43-3/16" Emerson recommends a clearance of 36" (915mm) on each side for (1097mm) proper operation and component access. Anchor Plan 122" (3099mm)

41-3/16" Three-Fan Unit (1046mm) See Figure 6-4 for typical drycooler footprint dimensions.

Anchor Plan 82" 80" (2083 mm) (2032mm)

Electric 41-3/16" Box Four-Fan Unit (1046mm) End

Liebert & Drycooler Technical Design Manual 22 Pump Packages and Expansion TankNAncillary Items

Figure 8-3 Dual-pump package and mounting DUAL PACKAGE 0.75 - 5 HP 1 3" (76.2mm) DIA. PUMP SUCTION CONNECTION K.O.'S 2 1 2 3" (76.2mm) DIA. PUMP DISCHARGE 32 1/4" CONNECTION K.O.'S 2 819mm 3 1 3 7/8" (22.2mm) DIA. ELECTRICAL K.O.'S

6 3/8" 4 5" (127mm) DIA. PUMP DISCHARGE 162mm 3 CONNECTION HOLE 5 5" (127mm) DIA. PUMP SUCTION 4 1/8" 105mm CONNECTION HOLE 15 7/8" 6 1/2" (12.7mm) DIA. HOLES FOR 403mm 2 7/8" 19" MOUNTING 73mm 483mm

8 3/4" 222mm 1 3/4" 12 1/4" 44mm 311mm

30" 23 3/4" 762mm 603mm PUMP PACKAGE MOUNTING ANGLES 27 1/4" 692mm 32" 6 813mm

DUAL PACKAGE 7.5 HP 3 6 32 3/8" 822mm 41 1/4" 1048mm 3/4" 19mm 4 C A 19 5/16" 491mm 4 5 5 B NOTE: ANGLES LOCATED INSIDE, BOTTOM 11 7/8" OF PUMP PACKAGE. VIEW USED FOR 302mm MOUNTING REFERENCE. 15 7/8" 403mm

33 3/16" 843mm 16 3/8" 416mm 29 3/16" 741mm

41" 1041mm 6 1/2" 165mm

DPN000328 Pg. 1 Rev. 1

Mounting-hole Dimensional Data, in. (mm) Pump package A B C Dual (0.75 M 5.0 HP) 30-1/4 (768) 2-1/2 (64) 22-1/2 (572) Dual (7.5 HP) 39-5/16 (999) 1-3/4 (45) 26-7/8 (683)

31 Liebert & Drycooler Technical Design Manual Overhead Electrical Busway System & Twistins

System to be manufactured by Universal Electric, Starline Busway 250T5 Series. System to be designed to have an “A” bus and a “B” bus above each row of IT racks in the server room. Each rack to have at least one (1) “A” twistin, and one (1) “B” twistin to connect to the power strips in each rack. 250T5 Systems

STRAIGHT SECTIONS

Product Description 7UDFN%XVZD\VWUDLJKWVHFWLRQFRQVLVWVRI DQH[WUXGHGDOXPLQXPVKHOOZLWKqVSULQJ pressure type copper channel busbars FRQWDLQHGLQDIXOOOHQJWKLQVXODWRUPRXQWHG RQWKHLQWHULRUZDOOV7KHDOXPLQXPH[WUXVLRQ DFWVDVDJURXQGSDWK(DFKKRXVLQJ has a continuous access slot over its entire OHQJWKIRUWKHLQVHUWLRQRIWXUQQORFNSOXJLQ XQLWV+RXVLQJFRQÞJXUDWLRQVLQFOXGHSROH varieties, optional isolated ground, optional RYHUVL]H QHXWUDO7KHKRXVLQJ sections join together using Bus connectors ZKLFKÞWLQWRWKHFKDQQHOVRIWKHDGMRLQLQJ +RXVLQJ6HFWLRQ r VHFWLRQ$Q,QVWDOODWLRQWRROLVXVHGWRIRUFH (111mm) WKHEODGHVLQWRWKHEXVEDUFKDQQHOVIRUD VROLGqVSULQJSUHVVXUHrHOHFWULFDOFRQQHFWLRQ

0$7(5,$/ ([WUXGHG$OXPLQXP (L2) / 5$7,1*6 *URXQG3DWK r $PSV PP 7&7&*9ROW (L1) 7&17&)9ROW (N)

/(1*7+ )W P )W P or custom lengths between )W P

92/7$*('523 GLVWULEXWHGORDG 6LQJOH3KDVH9SHUIW P 3) 7KUHH3KDVH9SHUIW P 3) +RXVLQJ&RXSOHU :(,*+7 US Metric IW P SROHOEVNJ L1 or Phase A (black) L1 or Phase A (brown) IW P SROHZJURXQGOEVNJ L2 or Phase B (red) L2 or Phase B (black) IW P SROHZ1OEVNJ /RU3KDVH& (blue) /RU3KDVH& (gray) IW P SROHZJURXQG 1OEVNJ Neutral (white) Neutral (blue) Ground (green) Ground (green/ yellow)

Bus Connector

Installation Tool

4.9 | StarlinePower.com 250T5 Systems

ABOVE FEED UNITS

Product Description 7KHDERYHIHHGSRZHUXQLWVXSSOLHVSRZHU 12 PP IURPWKHWRSVLGHRIWKH%XVZD\)DFWRU\ r DVVHPEOHGXQLWFRQVLVWVRID[[LQFK PP [[PP VWHHOMXQFWLRQER[WKDW LVPRXQWHGRQWRSRIDLQFK PP VHFWLRQRI%XVZD\

LQFKHV PP LVWKHPLQLPXPDQG VWDQGDUGOHQJWKRIEXVZD\WKDWDQDERYH IHHGLVSURYLGHGZLWK r PP $ERYHIHHGXQLWVFDQEHSODFHGDWWKHHQGRU anywhere along a Busway run. Connections to adjoining Busway sections are made by the standard means, requiring couplers and r bus connectors which are sold separately. PP busway section :(,*+7OEV NJ

*Isolated or dedicated ground is determined at the IHHGGXULQJLQVWDOODWLRQ)RUIXUWKHUGHWDLOVDERXW Dedicated Ground vs. Isolated Ground, please UHIHUHQFHRXUWHFKEULHIRQKWWSGRZQORDGVXHFRUS com/starline/

Standard (S) Reversed (R)

4.18 | StarlinePower.com T5 Series

ACCESSORIES: SUPPORT HARDWARE

Threaded Rod Part Number )RUPRXQWLQJWR81& PHWULF 868%5+7 0 WKUHDGHGURG7ZLVWLQGHVLJQ&DQEH 0HWULF0%5+70 LQVHUWHGDQ\ZKHUHDORQJWKHWRSIXOODFFHVV Available in plain zinc VORWRIEXVZD\0D[LPXPKDQJHUVXSSRUW or black (-BLK)

Weight OE NJ

Standard Part Number 868%+7 )RUPRXQWLQJWRVWUXWRURWKHUßDWVXUIDFHV 0HWULF0%+70 7ZLVWLQGHVLJQDOORZVLQVHUWLQJDQ\ZKHUH DORQJWKHWRSIXOODFFHVVVORWRQWKHEXVZD\ Available in plain zinc +DQJHUVXSSRUWLVUHTXLUHGHYHU\IW P or black (-BLK) PD[LPXP Weight OE NJ

Standard One-Piece(1200 only) Part Number )RUPRXQWLQJWRVWUXWRURWKHUßDWVXUIDFHV (1200 amp system only) 868%6+7 7ZLVWLQGHVLJQDOORZVLQVHUWLQJDQ\ZKHUH 0HWULF0%6+70 DORQJWKHWRSIXOODFFHVVVORWRQWKHEXVZD\ +DQJHUVXSSRUWLVUHTXLUHGHYHU\IW P Available in plain zinc PD[LPXP or black (-BLK)

Weight OE NJ

Raised Mounting Bracket Part Number For mounting the busway horizontally (with (for 250, 400 & 800 amp systems only) DFFHVVVORWIDFLQJWRWKHVLGH IRUXQGHUßRRU 8685)%7 0HWULF05)%7 applications. Available in plain zinc or black (-BLK)

Weight OE NJ

4.51 | StarlinePower.com T5 Series

ACCESSORIES: SUPPORT HARDWARE

Side Mount Brackets Part Number 0RXQWHGWRYHUWLFDOVXSSRUWV (for 250, 400 & 800 amp systems only) 868%667 0HWULF0%667

Available in plain zinc or black (-BLK)

Weight OE NJ

Lateral Brackets Part Number )RUPRXQWLQJWRWKUHDGHGURGZLWK (for 250, 400 & 800 amp systems only) H[WUDFURVVKRUL]RQWDOVXSSRUW 868/%7

Available in plain zinc or black (-BLK)

Recessed Suspended Ceilings Part Numbers For hanging busway into a recessed ceiling. (for 250 amp systems) *Hanger bolt must be ordered separately 6507 6507 (for 400 amp systems) 6507

(for 800 amp systems) 6507

(for 1200 amp systems) 650.7 6507 Available in plain zinc or black (-BLK)

6507

650.7

4.52 | StarlinePower.com T5 Series

ACCESSORIES: CONNECTION HARDWARE

bus Joint Kit Part Numbers connectors )RUWKHFRQQHFWLRQRIDGMDFHQWEXVZD\ housing (for 250 amp systems) couplers sections. One kit is required at each joint. 6-.7 (DFKNLWLVFRPSULVHGRIDKRXVLQJFRXSOHU 6-.7* pair and bus connector set. 6-.71 6-.7) Bus Connector: copper blades secured to an insulating mounting plate. This makes the (for 400 amp systems) electrical connection between sections. 6-.7 6-.7* 6-.71 DPSV\VWHPV Housing Couplers: FRQVLVWVRIWZRVFUHZ 6-.7) FRXSOHUVRQHIRUWKHWRSDQGRQHIRU the bottom. These make the mechanical (for hybrid (Cu/Al) 800 amp systems) connection between busway sections. 6-.7 6-.7* *Installation tool is required (see below) (for copper (Cu/Cu) 800 amp systems) 6-.7& 6-.7*&

(for 1200 amp systems) 6-..7 6-..7* DPSV\VWHP

Available in all standard and RAL colors

Installation Tool Part Number An installation tool is used to install the bus 67,7 FRQQHFWRUEHWZHHQWZRDGMDFHQWVHFWLRQVRI EXVZD\$MRLQWNLWZKLFKLVFRPSULVHGRIWZR No available colors housing couplers and a bus connector set, is required at every joint. Weight OE NJ Busway sections are butted together and the top housing coupler is installed. The bus connector is inserted, centered and seated LQWKHVORWRIWKHEXVZD\7KHLQVWDOODWLRQWRRO is inserted into the jointed intersection and URWDWHGGHJUHHVWRIRUPDVSULQJORDGHG secure electrical connection. The housing coupler is then positioned over the bottom joint and tightened.

4.54 | StarlinePower.com T5 Series

ACCESSORIES: CONNECTION HARDWARE

End Cap Part Numbers )RUFRYHULQJWKHHQGRI7EXVZD\V\VWHPV (for 250 amp systems) r 6(&7 PP

(for 400 amp systems) 6(&7 r r PP (for 800 amp systems) PP 6(&7

(for 1200 amp systems): r 6(&7 PP 6(&.7

6(&7 Available in all standard and RAL colors

Weight: OE NJ r PP r PP

r PP r PP 6(&7 6(&.7

Optional Closure Strip Part Numbers The Closure Strip snaps into the bottom (for 250, 400 & 800 amp systems) DFFHVVVORWRI7KRXVLQJWRFORVHRIIDFFHVV 6&67 WRSRZHUDURXQGWKHLQVWDOOHGSOXJLQXQLWV,W LVQRUPDOO\VKLSSHGLQIW P VHFWLRQV Aluminum closure strip: 6&67$/

7KH&ORVXUH6WULSLVRIIHUHGLQERWKQRQ conductive plastic material and aluminum (for 1200 amp systems) IRU DPSV\VWHPV,WLVRQO\ 6&67 DYDLODEOHLQSODVWLFIRUWKHDPSV\VWHP Available in all standard colors 7KHDOXPLQXP&ORVXUH6WULSDIÞ[HVZLWKDQ DGKHVLYHEDFNLQJWRWKHDFFHVVVORWRI7 housing.

4.55 | StarlinePower.com EPO Controller, Buttons, Button Covers, and Disabled Light

EPO Controller shall be manufactured by Panelworks

Each EPO Button location shall consist of one (1) Square D Pushbutton Model KR2RH5, one Square D button cover Model K6, and one (1) STI Cover Model STI-13030FR.

EPO Disabled light to be Federal Signal 141ST-120R Raised Access Floor

Equal to ASM FS200. Installer shall also be responsible for all ramps, steps, railing and handrails in the server room. Ultrasonic Humidification System

System shall be manufactured by Stulz and shall consist of one (1) Ultra Series Proportional Trim Control Box, and two (2) DRH-16 wall mount humidifiers. Include factory startup. MODEL: DRH-16 (wall mounted, direct room humidifier, 17.6 lbs./hr. each)

Retroﬁt & Conditioning

Humidiﬁcation STULZ Ultrasonic Humidiﬁcation Systems

Energy Efﬁcient Ultrasonic Humidiﬁers For Duct, AHU, Wall Mounted & Stand-Alone Applications

13.48” 7.40”

Mist Guide Tubes 4.0” Power Connection Mist Guide Cover 10.76” Data Connections Water Suppl y

Drain Fan Casing DRH Series - Technical Data & Dimensions 2X Mounting Foot L Air Filters

7.88”

P 6.6”

DRH Series Number of Dimensions Capacity Weight Rated (UL Listed, Stand-Alone Humidiﬁers) MODEL Nebulizer (Inches) (lbs / hr) (lbs) CFM Units L P DRH-04 4.4 19.8 4 14.20 13.31 59 DRH-06 6.6 24.3 6 18.51 17.63 82 DRH-08 8.8 30.9 8 22.83 21.94 91 DRH-16 17.6 50.7 16 40.07 39.19 182

DRH ROOM PLACEMENT DIAGRAM

3.0" Min. Smoke Ceiling Detector

18.0" Min. 12' Humidifier Path

1.63"

.88" CL Mounting Bracket Server (See Detail) Racks Ø .28"

10.82" 8.13"

14.07"

Mounting Bracket Detail

Ultra-Serieses Trim CControl Box (ULT)

18.00”

8.81” Controls - Ultra-Series Dimensional Drawings

15.75”

27.00” 30.66” Unit weight: 115 lbs

for housing DC power supplies for up to (2) DRH humidifiers

Ultra-Series Trim Auxiliary Box (UXT)

18.00”

8.81”

15.75”

Unit weight: 115 lbs 27.00” 30.66”

The DRH Series STULZ Ultrasonic Humidifiers are designed for stand-alone direct room applications. DRH humidifiers are typically mounted on a wall, column or suspended below the ceiling; serving such applications as printing houses, lithographic printing processes, bakeries, dair- ies, telephone exchanges, telecommunications rooms, electronics manufacturing, wood and textile processing, plus many more. • Follow all local, state and federal electrical and safety guidelines. General Application Parameters For All Types STULZ Ultrasonic Humidifiers • Humidifier must be installed in a level horizontal Application Parameters position. For Stand-Alone (direct in-space) Systems • The STULZ Ultrasonic Type DRH Ultrasonic Humidifier • The operating air temperature range of humidifier is is designed to be installed directly in a room or 34°F to 122°F. conditioned space. • The operating air relative humidity range of humidifier • Humidifier must be installed in a level, horizontal is <75%. position. • Optonal: 95% operating air relative humidity range • When selecting the installation location, attention available, consult factory. should be paid to the air flow in the room so that the • Water pressure operating range at the inlet of generated mist is not effected by HVAC system supply humidifier is 30 psi to 75 psi. or return air terminal devices. • Inlet water temperature operating range is 40°F to • Locate humidifier to allow unrestricted path for 104°F. absorption of mist into the room air. • For dust-free humidifier mist generation, inlet water • Humidifier to be installed using brackets mounted to is to be demineralized by mixed cation/anion resin wall/column or suspended from overhead structure by bed deionization to a water conductance of <5 hanger rods. Humidifier is designed to mount on top microsiemens (purity). of brackets. • DI water supply piping must be non-corrosive, i.e. • Install humidifier with mounting hardware and stainless steel or plastic rated for use with de-ionized attachment rated for weight of humidifier. water. Check building code requirements. • Install so the air intake opening is not restricted and air • Humidifier overflow / drain pipe is to be directed to filter is accessible for maintenance. condensate pan or drain. • Minimum distance from nozzle discharge to ceiling is

DRH Series - Application Parameters • Humidifier capacity rated at 48 VDC power supply via 18 inches. factory furnished control box. • Mount with sufficient space between humidifier and • Allowable voltage range at humidifier: 46 to 51 VDC. wall to allow for water and electrical connections. • Humidifier power source must be isolated with a circuit • Minimum distance from air terminal or smoke detector breaker. in front of humidifier is 12 feet. • Multiple humidifiers can be supplied and controlled by • To minimize mist blowing in the direction of personnel a single control box for larger capacity systems. Refer working in conditioned space, avoid humidifying to Controls Section for information regarding maximum directly over work areas. Install humidifier to discharge quantity of humidifiers possible per system based on between work stations. Minimum distance from nozzle options selected and system wiring requirements. discharge to seated personnel in front of humidifier is • To minimize voltage drop, wire gauge between 16 feet. control box and humidifier is dependent on model of • Absorption distance varies with temperature and humidifier and length of wire run. Refer to Controls relative humidity of room air. Conditioned space with Section for proper selection. greater than 50% RH set point may require additional absorption distance. 12

Humidifier Control The controller can accept the following proportional high limit signals from a Building Management System in lieu of the All STULZ Ultrasonic Humidifiers require a UL Listed control box for factory furnished sensor (Input 2): each system providing power, component electrical protection, humidifier operation and alarm indication. Two types of control boxes 0-5 VDC 0-1 VDC are offered: A-Series On/Off and Ultra-Series Proportional. All control 0-20 mA 4-20 mA (Standard) boxes have water quality monitoring as standard. The water quality 0-10 VDC with converter (Standard) monitoring is provided to ensure clean, mineral-free mist production. The control boxes are designed for indoor installation only. Options include: • Audible alarm • Averaging control board for 2-4 sensors Ultra-Series • Temperature compensated control Proportional Control Boxes • Capacity Assist control for groups of humidifiers • Duct Proximity control for multiple humidifiers • Serial port for remote BMS communication and

The STULZ Ultra-Series Proportional control boxes are provided for single Controls - Ultra-Series Proportional or multiple humidifiers per system. Each individual system is defined as control over ModBus RTU, BACnet MS/TP, BACnet the quantity of humidifiers controlled by one control input. over ethernet, BACnet over IP, HTTP, SNMP V1, V2c. • Air pressure proving switch. Ships loose. • Air velocity sensor • On/Off high limit humidistat (specify as wall or duct mount). Ships loose. • High RH limit sensor. Ships loose • Water leak detector / Condensate pan detector

The Ultra-Series controller is capable of controlling up to 16 STULZ Ultrasonic Humidifiers per system. The control output is fully proportional from 0% to 100% call for humidification. Through pulse width modulation, all humidifiers are switched on and off, as segments of approximately one second, simultaneously dependant on the level of the control (Input 1) and high limit (Input 2, when used) inputs. A run hour meter The Ultra-Series Proportional control systems are supplied as standard is provided as standard function of the Ultra-Series controller with: to provide a sum total of time segments the humidifiers have • Wall mount enclosure operated. In conjunction with the built-in drain solenoid valves, • Rotary main power disconnect with lockout feature the controller will drain the tank based on humidifier idle time. • Component circuit protection If a freeze alert condition exists, an automatic drain will initiate • 48 VDC power supply, one per humidifier to protect the tank from freezing. • Proportional output control • Microprocessor control board and backlit panel display/user Information displayed during normal operation includes: interface • Controller enabled via remote on/off • Password protected menus • General humidity production range: 0% - 100% • Weekly timer and night setback function • Room or return duct humidity level (when control • Remote start/stop sensor is used) • Dry contact for remote indication of shut-down alarms • Control signal level (when BMS control is used) • Time stamping event log for 100 events • Humidity set point (when control sensor is used) • Water conductivity probe. Ships loose. • Current alarm conditions • 4-20mA proportional humidity control sensor (specify as wall • Humidifier drain solenoid valve energized or duct mount). Ships loose. • Humidifier fill solenoid valve energized • Cabinet thermostat controlled fan • Air velocity in duct (if configured) • Proportional/Integral (P/I) control • Room temperature (if configured) • Duct temperature (if configured) The controller can accept the following proportional control signals from a Building Management System in lieu of the factory furnished sensor All shut-down alarms activate the standard, summary alarm dry (Input 1): contact for possibility of remote indication.

0-5 VDC 0-1 VDC 0-20 mA 4-20 mA (Standard) 0-10 VDC with converter (Standard)

Water treatment system (for the ultrasonic humidification system) shall be furnished and installed by Evoqua Water Technologies. Others to provide potable water source to this system, and provide the stainless steel piping from this system. System shall be mounted in an overflow pan (provided by others), and not located in the server room. Automatic Transfer Switches

ATS-1 & ATS-2: ASCO Series 7000, 480/277V, 600A, 3 pole, Nema 1, Closed Transition, Bypass Isolation

AC ATSs & Building Load ATS: ASCO Series 7000, 480/277V, 3 pole, Utility to Utility, Nema 1

Life Safety ATS: ASCO Series 300, 480/277V, 3 pole, Nema 1 Monitoring System

System shall be manufactured by Sensaphone, Inc., Model SCADA 3000, with the following:

Two (2) FGD-3000 Main Units Eight (8) FGD-3010 Universal Input Expansion Module Two (2) FGD-3110 Power Supplies Two (2) FGD-3200 Battery Backup Four (4) FGD-0102 Temperature Sensors Vendor Contact Information

Kohler Generators: Fidelity Power Generation; Lee Crenshaw [email protected] 804-677-8925

Generator Paralleling Switchboard: Richmond Electric Supply Company; Alan Herman [email protected] 804-640-5296

UPS: Eaton Corporation; Dave DeCook [email protected] 804-337-7552

Batteries: MK Battery; Peter Langdon [email protected] 484.345.1038

Battery Cabinets: DC Technology; Eric Layman [email protected] 804-539-6341

Static Transfer Switches: Liebert; Rich Bralley [email protected] 804-370-1118

Computer Room AC Units: Liebert; Matt Getridge [email protected] 804-347-0566

Starline Electrical Busway: Liebert; Rich Bralley [email protected] 804-370-1118

Raised Floor System: Specified Interior Systems, Inc.; Ken Emerson [email protected] 804-314-7277

Ultrasonic Humidification System: Advanced Enviro Solutions; Dan Santalucia [email protected] (804) 677-7752 Water Treatment System: Evoqua Water Technologies; Jon Nelson [email protected] 804-661-5762

ASCO Automatic Transfer Switches: ASCO; Jessica Ingram [email protected] 202-573-1903

EPO Controller: Panelworks; Bill Moran [email protected] 804-356-2101