DOCSLIB.ORG

Ccdc113 (NM 172914) Mouse Tagged ORF Clone – MR205868

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Ccdc113 (NM 172914) Mouse Tagged ORF Clone – MR205868 OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MR205868 Ccdc113 (NM_172914) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Ccdc113 (NM_172914) Mouse Tagged ORF Clone Tag: Myc-DDK Symbol: Ccdc113 Synonyms: 4933409I22; BC060957 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MR205868 representing NM_172914 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCTGAGGAAGACTCGGACAGCGTGATCACTGACTCCCAGGCGGAGGAGGAAGGCGAGCTGCCAGTCA TCCAACTGTGCGGGCTGGTAGAGGAGCTCAGCTATGGAAACTCTGCTCTCAAAACAGAAACAGAGATGTT CGAGAAATATTACTCTAGACTGGAACCCAGGGACCACCGAATGACACGGTTGTCAGATATTAAAATAACA GCAGCAGAATTTTCACAGTTACGATCCAGGCGTAAATCCAAGGCCCGTGGAGGTCTGGACCGTACGCTAG GCCTCACTGTAGAGCAAAAGCTCGAGCTTGTGCAGAAGGAGCTGGAAGACACGAGAGATGAAATACGGCA CATGCGGGCTAATGCGGAACGGGACCTGCAGCATCACGAGGCTATCATCGAGGAAGCCGACATTCGGTGG AATGAAGTTCAGAAAGCAGTGCACGAATTTGAAAAAGATATTCTGAAAACCATATCCAAGAAGAAAGGGA GCATTTTGGCCACTCAGAAAGTGATGAAATACATCGAGGACATGAACCGCCGCAGGGATAATATAAAGGA TAAATTGTGTTTGAAAAATGTTTCTCTCAAAGTTCAAAGGAAAAAGATGCTTTCACAATTGAGACAGAAG GAGGAGGTAGGCGAGGCCCTGCACGACGTGGACTTTCAGCAGCTGAAAATCGAGAACGCTCAGTTTTTGG AGACGATTGAAGCAAGGAACAAAGAACTGATCCAGCTGAAGCTGGCCTCTGGGAACACGCTGCAGGTTCT CAACACCTACAAAAACAAGCTTCATCGGGCAATGGAGATCTACGTCAATCTGGACAAGGAGATCTTGCTG AGAAACGAGCTACTTGGGAAAATTGAAAAAGAAACCATACAAGCAGAGGAGGACAGGGCCAAAGCCCATA TCTTGAACGATAAGTTACGGAAGCAGCTGGCTGAGTTCCGGGCCCCACAGGTAATGATGTACGTCAAGGA GAAGATCCTGAATGGGGAGCTAGAGAAGACCATCAAGATGTGGGAGCGGAAGGTGGAGATCGCAGAGATG TCTCTAAAAGGGTACCGGAAGGCCTGGAATAAGATGAAGACTTCGGATGAGCAGTTGCAGATAATCCGGC CCCCTGGGAAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Ccdc113 (NM_172914) Mouse Tagged ORF Clone – MR205868 Protein Sequence: >MR205868 representing NM_172914 Red=Cloning site Green=Tags(s) MSEEDSDSVITDSQAEEEGELPVIQLCGLVEELSYGNSALKTETEMFEKYYSRLEPRDHRMTRLSDIKIT AAEFSQLRSRRKSKARGGLDRTLGLTVEQKLELVQKELEDTRDEIRHMRANAERDLQHHEAIIEEADIRW NEVQKAVHEFEKDILKTISKKKGSILATQKVMKYIEDMNRRRDNIKDKLCLKNVSLKVQRKKMLSQLRQK EEVGEALHDVDFQQLKIENAQFLETIEARNKELIQLKLASGNTLQVLNTYKNKLHRAMEIYVNLDKEILL RNELLGKIEKETIQAEEDRAKAHILNDKLRKQLAEFRAPQVMMYVKEKILNGELEKTIKMWERKVEIAEM SLKGYRKAWNKMKTSDEQLQIIRPPGK myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mm9065_e07.zip Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Ccdc113 (NM_172914) Mouse Tagged ORF Clone – MR205868 ACCN: NM_172914 ORF Size: 1131 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_172914.2, NP_766502.1 RefSeq Size: 1271 bp RefSeq ORF: 1134 bp Locus ID: 244608 UniProt ID: Q8C5T8 MW: 44.2 kDa Gene Summary: Component of centriolar satellites contributing to primary cilium formation.[UniProtKB/Swiss- Prot Function] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • Prdm16 Is Required for the Maintenance of Neural Stem Cells in the Postnatal Forebrain and Their Differentiation Into Ependymal Cells
    Downloaded from genesdev.cshlp.org on September 29, 2021 - Published by Cold Spring Harbor Laboratory Press Prdm16 is required for the maintenance of neural stem cells in the postnatal forebrain and their differentiation into ependymal cells Issei S. Shimada,1,2 Melih Acar,1,2,3 Rebecca J. Burgess,1,2 Zhiyu Zhao,1,2 and Sean J. Morrison1,2,4 1Children’s Research Institute, 2Department of Pediatrics, University of Texas Southwestern Medical Center, Dallas, Texas 75390, USA; 3Bahcesehir University, School of Medicine, Istanbul 34734, Turkey; 4Howard Hughes Medical Institute, University of Texas Southwestern Medical Center, Dallas, Texas 75390, USA We and others showed previously that PR domain-containing 16 (Prdm16) is a transcriptional regulator required for stem cell function in multiple fetal and neonatal tissues, including the nervous system. However, Prdm16 germline knockout mice died neonatally, preventing us from testing whether Prdm16 is also required for adult stem cell function. Here we demonstrate that Prdm16 is required for neural stem cell maintenance and neurogenesis in the adult lateral ventricle subventricular zone and dentate gyrus. We also discovered that Prdm16 is required for the formation of ciliated ependymal cells in the lateral ventricle. Conditional Prdm16 deletion during fetal development using Nestin-Cre prevented the formation of ependymal cells, disrupting cerebrospinal fluid flow and causing hy- drocephalus. Postnatal Prdm16 deletion using Nestin-CreERT2 did not cause hydrocephalus or prevent the forma- tion of ciliated ependymal cells but caused defects in their differentiation. Prdm16 was required in neural stem/ progenitor cells for the expression of Foxj1, a transcription factor that promotes ependymal cell differentiation.
    [Show full text]
  • The Roles of Histone Deacetylase 5 and the Histone Methyltransferase Adaptor WDR5 in Myc Oncogenesis
    The Roles of Histone Deacetylase 5 and the Histone Methyltransferase Adaptor WDR5 in Myc oncogenesis By Yuting Sun This thesis is submitted in fulfilment of the requirements for the degree of Doctor of Philosophy at the University of New South Wales Children’s Cancer Institute Australia for Medical Research School of Women’s and Children’s Health, Faculty of Medicine University of New South Wales Australia August 2014 PLEASE TYPE THE UNIVERSITY OF NEW SOUTH WALES Thesis/Dissertation Sheet Surname or Family name: Sun First name: Yuting Other name/s: Abbreviation for degree as given in the University calendar: PhD School : School of·Women's and Children's Health Faculty: Faculty of Medicine Title: The Roles of Histone Deacetylase 5 and the Histone Methyltransferase Adaptor WDR5 in Myc oncogenesis. Abstract 350 words maximum: (PLEASE TYPE) N-Myc Induces neuroblastoma by regulating the expression of target genes and proteins, and N-Myc protein is degraded by Fbxw7 and NEDD4 and stabilized by Aurora A. The class lla histone deacetylase HDAC5 suppresses gene transcription, and blocks myoblast and leukaemia cell differentiation. While histone H3 lysine 4 (H3K4) trimethylation at target gene promoters is a pre-requisite for Myc· induced transcriptional activation, WDRS, as a histone H3K4 methyltransferase presenter, is required for H3K4 methylation and transcriptional activation mediated by a histone H3K4 methyltransferase complex. Here, I investigated the roles of HDAC5 and WDR5 in N-Myc overexpressing neuroblastoma. I have found that N-Myc upregulates HDAC5 protein expression, and that HDAC5 represses NEDD4 gene expression, increases Aurora A gene expression and consequently upregulates N-Myc protein expression in neuroblastoma cells.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • GINS1/2/3/4 Upregulation Predicts Poor Prognosis in Human Sarcoma
    GINS1/2/3/4 Upregulation Predicts Poor Prognosis in Human Sarcoma Gen Wu Department of Orthopedics, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011 Ziyuan Chen Department of Orthopedics, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011 Tong Wu Department of Orthopedics, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011 Jian Zhou Department of Orthopedics, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011 Qunyan Tian Department of Orthopedics, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011 Ren Wu Department of Orthopedics, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011 Pengcheng Dou Department of Orthopedics, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011 Shuo Jie Department of Orthopedics, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011 Wanchun Wang ( [email protected] ) Department of Orthopedics, The Second Xiangya Hospital, Central South University, Changsha, Hunan 410011, China Research Article Keywords: Sarcoma, Bioinformatics analysis, Prognosis, GEPIA, GINS Posted Date: January 22nd, 2021 Page 1/18 DOI: https://doi.org/10.21203/rs.3.rs-140815/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 2/18 Abstract Background: GINS family was reported to be highly expressed in many tumors. However, the association of GINS family with human sarcoma remained unknown. This study was undertaken to explore the expression and prognostic value of GINS family in human sarcoma. Methods: In terms of the expression levels of mRNA for GINS family members, a particular contrast in various cancers, especially human sarcoma, was conducted through ONCOMINE and GEPIA and CCLE databases.
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]
  • Whole Exome Sequencing in Families at High Risk for Hodgkin Lymphoma: Identification of a Predisposing Mutation in the KDR Gene
    Hodgkin Lymphoma SUPPLEMENTARY APPENDIX Whole exome sequencing in families at high risk for Hodgkin lymphoma: identification of a predisposing mutation in the KDR gene Melissa Rotunno, 1 Mary L. McMaster, 1 Joseph Boland, 2 Sara Bass, 2 Xijun Zhang, 2 Laurie Burdett, 2 Belynda Hicks, 2 Sarangan Ravichandran, 3 Brian T. Luke, 3 Meredith Yeager, 2 Laura Fontaine, 4 Paula L. Hyland, 1 Alisa M. Goldstein, 1 NCI DCEG Cancer Sequencing Working Group, NCI DCEG Cancer Genomics Research Laboratory, Stephen J. Chanock, 5 Neil E. Caporaso, 1 Margaret A. Tucker, 6 and Lynn R. Goldin 1 1Genetic Epidemiology Branch, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 2Cancer Genomics Research Laboratory, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 3Ad - vanced Biomedical Computing Center, Leidos Biomedical Research Inc.; Frederick National Laboratory for Cancer Research, Frederick, MD; 4Westat, Inc., Rockville MD; 5Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; and 6Human Genetics Program, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD, USA ©2016 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol.2015.135475 Received: August 19, 2015. Accepted: January 7, 2016. Pre-published: June 13, 2016. Correspondence: [email protected] Supplemental Author Information: NCI DCEG Cancer Sequencing Working Group: Mark H. Greene, Allan Hildesheim, Nan Hu, Maria Theresa Landi, Jennifer Loud, Phuong Mai, Lisa Mirabello, Lindsay Morton, Dilys Parry, Anand Pathak, Douglas R. Stewart, Philip R. Taylor, Geoffrey S. Tobias, Xiaohong R. Yang, Guoqin Yu NCI DCEG Cancer Genomics Research Laboratory: Salma Chowdhury, Michael Cullen, Casey Dagnall, Herbert Higson, Amy A.
    [Show full text]
  • Genome‐Wide Association Study for Age at Puberty in Young Nelore Bulls
    Received: 3 May 2019 | Revised: 12 August 2019 | Accepted: 13 August 2019 DOI: 10.1111/jbg.12438 ORIGINAL ARTICLE Genome‐wide association study for age at puberty in young Nelore bulls Nedenia Bonvino Stafuzza1 | Eliane Vianna da Costa e Silva2 | Rafael Medeiros de Oliveira Silva3 | Luiz Carlos Cesar da Costa Filho2,4 | Fernanda Battistotti Barbosa2,4 | Gustavo Guerino Macedo2 | Raysildo B. Lobo5 | Fernando Baldi6 1Centro de Pesquisa em Bovinos de Corte, Instituto de Zootecnia (IZ), Abstract Sertãozinho, Brazil Selection for bulls that would reach puberty early reduces the generation interval 2Laboratório de Reprodução and increases fertility and herd productivity. Despite its economic importance, Animal, Faculdade de Medicina Veterinária there are few QTL associated with age at puberty described in the literature. In e Zootecnia (FAMEZ), Universidade Federal de Mato Grosso do Sul (UFMS), this study, a weighted single‐step genome‐wide association study was performed Campo Grande, Brazil to detect genomic regions and putative candidate genes related to age at puberty in 3 Zoetis, Edifício Morumbi Corporate ‐ young Nelore bulls. Several protein‐coding genes related to spermatogenesis func- Diamond Tower, São Paulo, Brazil tions were identified within the genomic regions that explain more than 0.5% of 4PROCRIAR Assistência Veterinária, ADAM11, Campo Grande, Brazil the additive genetic variance for age at puberty in Nelore bulls, such as 5Associação Nacional dos Criadores e BRCA1, CSNK2A, CREBBP, MEIOC, NDRG2, NECTIN3, PARP2, PARP9, PRSS21,
    [Show full text]
  • Meta-Analysis of Transcriptomic Datasets Identifies Genes Enriched
    9860–9873 Nucleic Acids Research, 2017, Vol. 45, No. 17 Published online 18 August 2017 doi: 10.1093/nar/gkx714 Meta-analysis of transcriptomic datasets identifies genes enriched in the mammalian circadian pacemaker Laurence A. Brown1, John Williams2, Lewis Taylor1, Ross J. Thomson1,PatrickM.Nolan2, Russell G. Foster1,* and Stuart N. Peirson1,* 1Sleep and Circadian Neuroscience Institute (SCNi), Nuffield Department of Clinical Neurosciences, University of Oxford, Oxford, OX1 3RE, UK and 2MRC Harwell Institute, Harwell Campus, Oxfordshire OX11 0RD, UK Received September 07, 2016; Revised July 27, 2017; Editorial Decision July 30, 2017; Accepted August 04, 2017 ABSTRACT of an endogenous biological clock. In mammals, the site of the master circadian pacemaker is the suprachiasmatic The master circadian pacemaker in mammals is lo- nuclei (SCN) in the anterior hypothalamus (1). The SCN cated in the suprachiasmatic nuclei (SCN) which reg- receives light information from the retina via the retinohy- ulate physiology and behaviour, as well as coordi- pothalamic tract, synchronizing (entraining) SCN rhythms nating peripheral clocks throughout the body. In- to the external environment. SCN lesions result in loss of vestigating the function of the SCN has often fo- physiological and behavioural rhythms, and transplanta- cused on the identification of rhythmically expressed tion of foetal SCN can restore rhythmicity with a period genes. However, not all genes critical for SCN func- consistent with that of the donor tissue (2). The circa- tion are rhythmically expressed. An alternative strat- dian clock is the product of an intracellular transcriptional- egy is to characterize those genes that are selec- translational feedback loop (TTFL), comprised of a num- tively enriched in the SCN.
    [Show full text]
  • Epigenetic Mechanisms Are Involved in the Oncogenic Properties of ZNF518B in Colorectal Cancer
    Epigenetic mechanisms are involved in the oncogenic properties of ZNF518B in colorectal cancer Francisco Gimeno-Valiente, Ángela L. Riffo-Campos, Luis Torres, Noelia Tarazona, Valentina Gambardella, Andrés Cervantes, Gerardo López-Rodas, Luis Franco and Josefa Castillo SUPPLEMENTARY METHODS 1. Selection of genomic sequences for ChIP analysis To select the sequences for ChIP analysis in the five putative target genes, namely, PADI3, ZDHHC2, RGS4, EFNA5 and KAT2B, the genomic region corresponding to the gene was downloaded from Ensembl. Then, zoom was applied to see in detail the promoter, enhancers and regulatory sequences. The details for HCT116 cells were then recovered and the target sequences for factor binding examined. Obviously, there are not data for ZNF518B, but special attention was paid to the target sequences of other zinc-finger containing factors. Finally, the regions that may putatively bind ZNF518B were selected and primers defining amplicons spanning such sequences were searched out. Supplementary Figure S3 gives the location of the amplicons used in each gene. 2. Obtaining the raw data and generating the BAM files for in silico analysis of the effects of EHMT2 and EZH2 silencing The data of siEZH2 (SRR6384524), siG9a (SRR6384526) and siNon-target (SRR6384521) in HCT116 cell line, were downloaded from SRA (Bioproject PRJNA422822, https://www.ncbi. nlm.nih.gov/bioproject/), using SRA-tolkit (https://ncbi.github.io/sra-tools/). All data correspond to RNAseq single end. doBasics = TRUE doAll = FALSE $ fastq-dump -I --split-files SRR6384524 Data quality was checked using the software fastqc (https://www.bioinformatics.babraham. ac.uk /projects/fastqc/). The first low quality removing nucleotides were removed using FASTX- Toolkit (http://hannonlab.cshl.edu/fastxtoolkit/).
    [Show full text]
  • Engineered Type 1 Regulatory T Cells Designed for Clinical Use Kill Primary
    ARTICLE Acute Myeloid Leukemia Engineered type 1 regulatory T cells designed Ferrata Storti Foundation for clinical use kill primary pediatric acute myeloid leukemia cells Brandon Cieniewicz,1* Molly Javier Uyeda,1,2* Ping (Pauline) Chen,1 Ece Canan Sayitoglu,1 Jeffrey Mao-Hwa Liu,1 Grazia Andolfi,3 Katharine Greenthal,1 Alice Bertaina,1,4 Silvia Gregori,3 Rosa Bacchetta,1,4 Norman James Lacayo,1 Alma-Martina Cepika1,4# and Maria Grazia Roncarolo1,2,4# Haematologica 2021 Volume 106(10):2588-2597 1Department of Pediatrics, Division of Stem Cell Transplantation and Regenerative Medicine, Stanford School of Medicine, Stanford, CA, USA; 2Stanford Institute for Stem Cell Biology and Regenerative Medicine, Stanford School of Medicine, Stanford, CA, USA; 3San Raffaele Telethon Institute for Gene Therapy, Milan, Italy and 4Center for Definitive and Curative Medicine, Stanford School of Medicine, Stanford, CA, USA *BC and MJU contributed equally as co-first authors #AMC and MGR contributed equally as co-senior authors ABSTRACT ype 1 regulatory (Tr1) T cells induced by enforced expression of interleukin-10 (LV-10) are being developed as a novel treatment for Tchemotherapy-resistant myeloid leukemias. In vivo, LV-10 cells do not cause graft-versus-host disease while mediating graft-versus-leukemia effect against adult acute myeloid leukemia (AML). Since pediatric AML (pAML) and adult AML are different on a genetic and epigenetic level, we investigate herein whether LV-10 cells also efficiently kill pAML cells. We show that the majority of primary pAML are killed by LV-10 cells, with different levels of sensitivity to killing. Transcriptionally, pAML sensitive to LV-10 killing expressed a myeloid maturation signature.
    [Show full text]
  • POGLUT1, the Putative Effector Gene Driven by Rs2293370 in Primary
    www.nature.com/scientificreports OPEN POGLUT1, the putative efector gene driven by rs2293370 in primary biliary cholangitis susceptibility Received: 6 June 2018 Accepted: 13 November 2018 locus chromosome 3q13.33 Published: xx xx xxxx Yuki Hitomi 1, Kazuko Ueno2,3, Yosuke Kawai1, Nao Nishida4, Kaname Kojima2,3, Minae Kawashima5, Yoshihiro Aiba6, Hitomi Nakamura6, Hiroshi Kouno7, Hirotaka Kouno7, Hajime Ohta7, Kazuhiro Sugi7, Toshiki Nikami7, Tsutomu Yamashita7, Shinji Katsushima 7, Toshiki Komeda7, Keisuke Ario7, Atsushi Naganuma7, Masaaki Shimada7, Noboru Hirashima7, Kaname Yoshizawa7, Fujio Makita7, Kiyoshi Furuta7, Masahiro Kikuchi7, Noriaki Naeshiro7, Hironao Takahashi7, Yutaka Mano7, Haruhiro Yamashita7, Kouki Matsushita7, Seiji Tsunematsu7, Iwao Yabuuchi7, Hideo Nishimura7, Yusuke Shimada7, Kazuhiko Yamauchi7, Tatsuji Komatsu7, Rie Sugimoto7, Hironori Sakai7, Eiji Mita7, Masaharu Koda7, Yoko Nakamura7, Hiroshi Kamitsukasa7, Takeaki Sato7, Makoto Nakamuta7, Naohiko Masaki 7, Hajime Takikawa8, Atsushi Tanaka 8, Hiromasa Ohira9, Mikio Zeniya10, Masanori Abe11, Shuichi Kaneko12, Masao Honda12, Kuniaki Arai12, Teruko Arinaga-Hino13, Etsuko Hashimoto14, Makiko Taniai14, Takeji Umemura 15, Satoru Joshita 15, Kazuhiko Nakao16, Tatsuki Ichikawa16, Hidetaka Shibata16, Akinobu Takaki17, Satoshi Yamagiwa18, Masataka Seike19, Shotaro Sakisaka20, Yasuaki Takeyama 20, Masaru Harada21, Michio Senju21, Osamu Yokosuka22, Tatsuo Kanda 22, Yoshiyuki Ueno 23, Hirotoshi Ebinuma24, Takashi Himoto25, Kazumoto Murata4, Shinji Shimoda26, Shinya Nagaoka6, Seigo Abiru6, Atsumasa Komori6,27, Kiyoshi Migita6,27, Masahiro Ito6,27, Hiroshi Yatsuhashi6,27, Yoshihiko Maehara28, Shinji Uemoto29, Norihiro Kokudo30, Masao Nagasaki2,3,31, Katsushi Tokunaga1 & Minoru Nakamura6,7,27,32 Primary biliary cholangitis (PBC) is a chronic and cholestatic autoimmune liver disease caused by the destruction of intrahepatic small bile ducts. Our previous genome-wide association study (GWAS) identifed six susceptibility loci for PBC.
    [Show full text]
  • Analysis of the Impact of Pufas on Placental Gene Expression V2.28 Uploadx
    TECHNISCHE UNIVERSITÄT MÜNCHEN Lehrstuhl für Ernährungsmedizin Analysis of the Impact of Polyunsaturated Fatty Acids (PUFAs) on Placental Gene Expression Eva-Maria Sedlmeier Vollständiger Abdruck der von der Fakultät Wissenschaftszentrum Weihenstephan für Ernährung, Landnutzung und Umwelt der Technischen Universität München zur Erlangung des akademischen Grades eines Doktors der Naturwissenschaften genehmigten Dissertation. Vorsitzender: Univ.-Prof. Dr. M. Klingenspor Prüfer der Dissertation: 1. Univ.-Prof. Dr. J. J. Hauner 2. Univ.-Prof. Dr. H. Daniel Die Dissertation wurde am 17.10.2013 bei der Technischen Universität München eingereicht und durch die Fakultät Wissenschaftszentrum Weihenstephan für Ernährung, Landnutzung und Umwelt am 12.12.2013 angenommen. Table of contents Table of contents Table of contents ....................................................................................................... I Summary .................................................................................................................. VI Zusammenfassung ................................................................................................ VIII 1. Introduction ........................................................................................................ 1 1.1. Fetal programming - a strategy to prevent the obesity epidemic? ...........................................1 1.1.1. The obesity epidemic ........................................................................................................1 1.1.2. Fetal programming
    [Show full text]