DOCSLIB.ORG

August 2017 >Âlü°Vœ“Êuêüiãìià˜œÕÌ`œœÀ̈“Iã°Vœ“ a Publication of Arizona Boating & Watersports

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
August 2017 >Âlü°Vœ“Êuêüiãìià˜œÕÌ`œœÀ̈“Iã°Vœ“ a Publication of Arizona Boating & Watersports PHOTO COURTEST WWW.WAYNESWORDS.COM A Publication of Arizona Boating & Watersports Arizona Boating & Publication of A Western Outdoor Times A COOL IDEA Refresh Fish To To Fish Page 16 Page Western Wildlife & Target 8-12 Pages Tackle Boating 4-7 Pages Pages 14-15 Pages Cruising Land Watersports 13 Page August 2017 >âLÜ°VÊUÊÜiÃÌiÀÕÌ`ÀÌiðV BOAT I N G | CA M P I N G | F I S H I N G | RV I N G | S H O OT I N G S P O R T S | WAT E R S P O R T S | W I L D L I F E August 2017 / Vol. 13, No. 2 Southwest Summertime News And Views James Ammons Becomes Chairman Of Arizona Game And Fish Commission Ammons will bring extensive experience in business and wildlife issues to the role. James Ammons as- -XQH0DGGHQZLOOFRQWLQXHWRVHUYHRQ VHUYLFH VLQFH DQG VHUYHG DV D ERDUG Management recreation management plan- sumed the role of chair- the commission through the end of the year member of AEA Federal Credit Union. ning. He is a member of numerous organiza- man of the Arizona XQWLODVXFFHVVRULVDSSRLQWHGE\WKHJRYHU- He is a life member of the Yuma Valley tions, including the Arizona Antelope Foun- Game and Fish Commis- QRUDQGFRQ¿UPHGE\WKHVWDWH6HQDWH&RP- 5RGDQG*XQ&OXEZKHUHKHKDVVHUYHGDVD dation, the Arizona Mule Deer Association, sion on July 1. Charged PLVVLRQHUV¶ ¿YH\HDU WHUPV DUH VWDJJHUHG board member and president. Ammons was WKH $UL]RQD (ON 6RFLHW\ DQG WKH 5RFN\ ZLWK OHDGLQJ WKH ¿YH DQGHDFKFRPPLVVLRQHUWUDGLWLRQDOO\VHUYHV QDPHG WKH FOXE¶V ³6SRUWVPDQ RI WKH<HDU´ Mountain Elk Foundation. Ammons also is a member commission DVFKDLUGXULQJKLVRUKHU¿QDO\HDU in 2010 and played an instrumental role in OLIHPHPEHURIWKH:LOG6KHHS)RXQGDWLRQ IRUWKH¿VFDO implementing policy and bylaw changes that *UDQG 6ODP &OXE DQG WKH $UL]RQD 'HVHUW year, Ammons has been A Passion For The Outdoors allowed membership for women. %LJKRUQ6KHHS6RFLHW\ James “As chairman, I look forward to a con- VHUYLQJ RQ WKH FRPPLV- Ammons $ WKLUGJHQHUDWLRQ <XPD QDWLYH ZLWK D WLQXHG SURGXFWLYH ZRUNLQJ UHODWLRQVKLS sion since 2014 after passion for hunting and spending time in the A Member Of between the commission, department and EHLQJDSSRLQWHGWRD¿YH\HDUWHUPE\WKHQ JUHDWRXWGRRUV$PPRQVKDVH[WHQVLYHH[SH- Many Organizations public to ensure that Arizona’s wildlife is *RY-DQ%UHZHU rience in both business and wildlife issues. Ammons has worked on multiple water- SURWHFWHG FRQVHUYHG HQKDQFHG DQG PDQ- Ammons replaces Chairman Edward $PPRQVKDVRZQHGDQGRSHUDWHG5LYHU&LW- KROHGHYHORSPHQWSURMHFWVYDULRXVZLOGOLIH “Pat” Madden, whose term as chair expired ies Adjusters, a Yuma-based transportation FRQVHUYDWLRQLQLWLDWLYHVDQG%XUHDXRI/DQG See AMMONS, Page 19 Ty Gray Named Director Of Arizona Game And Fish Department The Arizona Game and Fish Commis- Gray began his career forward to continuing our tradition of inno- sion has appointed Ty Gray as director of the with the department as YDWLRQDQGGHGLFDWLRQWRPHHWWKHFRQVHUYD- Arizona Game and Fish Department. The ap- a research biologist in tion challenges and opportunities of the fu- SRLQWPHQWFDPHLQDXQDQLPRXVYRWHDW DQGZRUNHGKLVZD\ ture.” the commission’s June 11 meeting. up through the ranks. He Gray will lead an agency that employs Gray, of Phoenix, has been with Game has a unique familiar- more than 600 people and is funded at more and Fish for 24 years and is currently the LW\ DQG SHUVSHFWLYH RQ than $120 million per year, primarily from agency’s deputy director. He replaces outgo- department issues and WKH VDOH RI KXQWLQJ DQG ¿VKLQJ OLFHQVHV D LQJ 'LUHFWRU /DUU\ 9R\OHVZKR DQQRXQFHG RSHUDWLRQV KDYLQJ DOVR IHGHUDO H[FLVH WD[ RQ KXQWLQJ DQG ¿VKLQJ May 12 he would be retiring after a 43-year Ty Gray VHUYHG DV XUEDQ ¿VKLQJ JHDU DQG VHYHUDO RWKHU VRXUFHV VXFK DV WKH career with Game and Fish, the past nine as program specialist, a re- +HULWDJH )XQG ORWWHU\ SURFHHGV :LOGOLIH director. Gray will assume the role following JLRQDO¿VKSURJUDPVSHFLDOLVWKXPDQGLPHQ- &RQVHUYDWLRQ)XQG WULEDOJDPLQJUHYHQXH a transition period. VLRQVFRRUGLQDWRU¿HOGRSHUDWLRQVFRRUGLQD- watercraft licensing, OHV decals, and state WRU¿VKHULHVEUDQFKFKLHIHGXFDWLRQEUDQFK ZLOGOLIHJUDQWV7KHDJHQF\GRHVQRWUHFHLYH Brings Extensive Experience FKLHIDVVLVWDQWGLUHFWRU ,QIRUPDWLRQ(GXFD- Arizona general fund tax dollars. ON THE COVER “We’re thrilled to hire someone with Ty’s WLRQ5HFUHDWLRQ'LYLVLRQ DQGGHSXW\GLUHF- depth of experience and accomplishments,” tor, a position he has held since March 2013. Congratulations ‘Quality Of Life’ said Commission Chairman Pat Madden. From Voyles, Ducey ³+HEULQJVH[WHQVLYHH[SHULHQFHLQZLOGOLIH ‘A Great Honor’ ³,KDYHWKHXWPRVWFRQ¿GHQFHLQ7\DQG management, planning, budget, and exec- “This is truly a great honor,” said Gray. his ability to lead the agency into the future,” Includes ‘Cool’ XWLYHOHYHO DGPLQLVWUDWLRQ DQG OHDGHUVKLS “The Arizona Game and Fish Department said outgoing Director Voyles. “I commend as well as the respect of colleagues and the is recognized as one of the world’s leading BY CAROL L. ALLEN public.” wildlife management agencies, and I look See GRAY, Page 19 ,I\RXNQRZ:D\QH*XVWDYHVRQRI www.wayneswords.com \RX KDYH ‘IT WAS THIS BIG …’ heard him say, “[the] quality of life is measured by [the] amount of time Cast Your Lines In Roosevelt Lake And Create Your Own Fish Tales VSHQW¿VKLQJ´'XULQJWKH6RXWKZHVW )LVKLQJLVDVSRUWZLWKPDQ\YDULHWLHV)UHVK summer months, we would add this: ZDWHUVHDZDWHUULYHUVODNHVEDVVWURXWVROL- ³«VSHQW¿VKLQJRQRUQHDUFRROZD- tary or with the whole family. terways.” :KHWKHU \RX DUH DQ H[SHULHQFHG ¿VKHU- 2QSDJHRIWKLVLVVXH*XVWDYH- man or just want something the whole family son writes of the great angling oppor- FDQGR\RXFDQ¶WGRDQ\EHWWHUWKDQ¿VKLQJDW WXQLWLHVQRZDW/DNH3RZHOO³/DNH 5RRVHYHOW/DNH:LWKPRUHWKDQVXUIDFH 3RZHOOKDVORWVRI¿VKWRFDWFK´ DFUHV DQG QHDUUHFRUG ZDWHU OHYHOV 5RRVHYHOW Fishing — perhaps considered by /DNHLVWKDWODUJHVWPDQPDGHODNHLQ&HQWUDO PDQ\WKHXOWLPDWHDFWLYLW\LQZDWHU- Arizona — a water oasis just two hours away sports — offers us a chance to get to IURP3KRHQL[)LVKLQJHQWKXVLDVWVKDYHSOHQW\ cooler destinations and to recreate on RIVSDFHWRVWDNHWKHLUVSRWVRQWKHODNHRUHYHQ RUQHDUDUHDODNHVULYHUVSRQGVDQG ¿QG WKHLU RZQ VSHFLDO SULYDWH VSDFHV ZLWKRXW streams. KDYLQJWRFRPSHWHIRUSODFHV 6KRZQ RQ WKH FRYHU LV $XEU\ Calkins, who — with a friend Me- JDQ6SDUNV²UHDOO\HQMR\HG¿VKLQJ Big Cats And More IRUVWULSHUVZLWKEDLWDW%XR\ $W And the lake is stocked with largemouth and press time, the water temperature VPDOOPRXWKEDVVFKDQQHOFDW¿VKÀDWKHDGFDW- ZDVDUHODWLYHO\FRRO) ¿VKEOXHJLOOFUDSSLHDQGFDUS7KH86)RUHVW FOR THE FAMILY — Fishing is a sport with many varieties and can be enjoyed alone or 6HUYLFHUHSRUWVWKDWFDW¿VKZHLJKLQJPRUHWKDQ with the whole family. Whether you are an experienced fisherman or just want something the whole family can do, you can’t do any better than fishing at Roosevelt Lake — case in point: See QUALITY OF LIFE, Page 19 this young angler proves one is never too young to enjoy this wonderful watersport. See FISH TALES, Page 19 In This Month’s Issue Western Wildlife Watersports Downstream ..........................2 Nominations Open ASU Grad Swims Boating ...............................4-7 The Arizona Game and English Channel Tackle & Target ................8-12 Fish Commission is solic- On July 4, Willie Schulz, Watersports ........................ 13 iting nominations for its graduate of Arizona State 2017 Commission Awards. University, completed his RV/Land Cruising ..........14-15 The deadline for submis- dream of swimming the Western Wildlife ................. 16 sion is Aug. 24/Page 17 English Channel/Page 13 Recipients of 2008 and 2013 AZGFC THE CREW Media of the Year and 2009 National $= &$ www.azbw.com Water Safety Congress Award of Merit Linus www.westernoutdoortimes.com 2016 AZGF Writer Of The Year :HVHQGRXUKHDUWIHOWWKDQNVWRDOOWKH¿UH¿JKWHUVZKREUDYHO\¿JKWWKHPDQ\ZLOGODQG¿UHVEXUQLQJLQRXU6RXWKZHVW7KH\DUHFRQVWDQWO\FKDOOHQJHG E\WKHKHDWWKHZLQGDQGWKHGU\FRQGLWLRQV<HWWKH\FRQWLQXHWRSHUVHYHUHDQGVXFFHHG:HDUHJUDWHIXOWRWKHPDOO Publisher Special Features Editor AZBW News Service Don McDowell Mary Syrett The entire contents of WOT/AZBW are copyrighted © 2017 by Arizona Boating & Waters- Jim Allen John Koleszar AZ Tourist News Dwayne Cassidy Maxine Brookes SRUWV//&1RSDUW$XJXVWEHUHSURGXFHGLQDQ\IDVKLRQZLWKRXWH[SUHVVZULWWHQSHUPLVVLRQ BASS Ed Huntsman M.D.R. Proctor fom the publisher. Editor Galley Proof Editor Becky Thompson Mike Brookes Carol L. Allen Fur and Feather Henri Hurrier Bill Roecker Gloria Bryson Pyszka Mike Harris WOT/AZBW is published monthly. BoatU.S. Mike Rivkin Production Manager Henri Hurrier 32670$67(56HQGDGGUHVVFKDQJHVWR-LP$OOHQ(DVW%DVHOLQH5RDG Birding Editor Bruce Biddick National Park Service Angela Ogden The Late Margie Allen Jack Innis 7H PS H $ = Bureau of Reclamation Jackson Bridges NAU Athletics Marketing/Sales Capt. Ann Kinner Patrick Horning 68%6&5,37,2135,&(IRULVVXHVVLQJOHFRSLHVDUHSUHSDLG Distribution Jane Lemon Mott Subscriptions are transferable, non refundable. John Campbell Leslie Manes Caroline McWilliams Phoenix Power Squadron Catherine Miller Janet Bosley Rory Aikin, The Late Lisa Brookes-Haws LVGLVWULEXWHGIUHHLQ$UL]RQD6RXWKHUQ&DOLIRUQLD0H[LFR&DQGDWKH8.DQG Outdoors Editor Chelle Brookes Jay Williams Rose and Ron Werner WOT/AZBW Margie Anderson Jerry Tate other states and countries. Contributors Chris Cameron SAPC Christi Brookes John Campbell Superstition Search & Rescue Advertisers purchase space and circulation only. All property rights to any Shooting Sports Editor Arizona Game and Fish Kelsee Haws John Anderson Department Dan Pennell The Late Lisa Brookes-Haws advertisements produced for the advertiser by WOT/AZBW, using
Load more

Recommended publications
  • Arizona Fishing Regulations 3 Fishing License Fees Getting Started
    2019 & 2020 Fishing Regulations for your boat for your boat See how much you could savegeico.com on boat | 1-800-865-4846insurance. | Local Offi ce geico.com | 1-800-865-4846 | Local Offi ce See how much you could save on boat insurance. Some discounts, coverages, payment plans and features are not available in all states or all GEICO companies. Boat and PWC coverages are underwritten by GEICO Marine Insurance Company. GEICO is a registered service mark of Government Employees Insurance Company, Washington, D.C. 20076; a Berkshire Hathaway Inc. subsidiary. TowBoatU.S. is the preferred towing service provider for GEICO Marine Insurance. The GEICO Gecko Image © 1999-2017. © 2017 GEICO AdPages2019.indd 2 12/4/2018 1:14:48 PM AdPages2019.indd 3 12/4/2018 1:17:19 PM Table of Contents Getting Started License Information and Fees ..........................................3 Douglas A. Ducey Governor Regulation Changes ...........................................................4 ARIZONA GAME AND FISH COMMISSION How to Use This Booklet ...................................................5 JAMES S. ZIELER, CHAIR — St. Johns ERIC S. SPARKS — Tucson General Statewide Fishing Regulations KURT R. DAVIS — Phoenix LELAND S. “BILL” BRAKE — Elgin Bag and Possession Limits ................................................6 JAMES R. AMMONS — Yuma Statewide Fishing Regulations ..........................................7 ARIZONA GAME AND FISH DEPARTMENT Common Violations ...........................................................8 5000 W. Carefree Highway Live Baitfish
    [Show full text]
  • 2021 & 2022 Fishing Regulations Fishing Regulations
    ArizonaArizona Game and Fish DepartmentDepartment 20212021 & 2022 FishingFishing Regulations i Get a GEICO quote for your boat and, in just 15 minutes, you’ll know how much you could be saving. If you like what you hear, you can buy your policy right on the spot. Then let us do the rest while you enjoy your free time with peace of mind. geico.com/boat | 1-800-865-4846 Some discounts, coverages, payment plans, and features are not available in all states, in all GEICO companies, or in all situations. Boat and PWC coverages are underwritten by GEICO Marine Insurance Company. In the state of CA, program provided through Boat Association Insurance Services, license #0H87086. GEICO is a registered service mark of Government Employees Insurance Company, Washington, DC 20076; a Berkshire Hathaway Inc. subsidiary. © 2020 GEICO ii ARIZONA GAME AND FISH DEPARTMENT — AZGFD.GOV 2021 & 2022 ARIZONA FISHING REGULATIONS 1 AdPages2019.indd 2 12/11/2020 11:36:21 AM AdPages2019.indd 1 12/11/2020 11:35:54 AM Table of Contents Fishing License Fees GETTING STARTED Licenses available at all license dealers, Department offices and online at azgfd.gov. License Information and Fees .......................................................... 3 More information about the new licenses can be found under Commission Rules R12-4-207, R12-4-209 and R12-4-210. Regulation Changes .............................................................................4 All fishing and combo hunt/fish licenses listed are valid for the take of all aquatic wildlife, which includes legal fish species, crayfish, frogs, waterdogs and Douglas A. Ducey, Governor softshell turtles. How to Use This Booklet .................................................................... 5 Started Getting ARIZONA GAME AND FISH COMMISSION LICENSES PRIVILEGES RESIDENT NON-RESIDENT Kurt R.
    [Show full text]
  • Downloaded and Reviewed on the State Parks’ Webpage Or Those Interested Could Request a Hard Copy
    Governor of Arizona Janet Napolitano Arizona State Parks Board William Cordasco, Chair ting 50 ting 50 ra Y Arlan Colton ra Y b e b e a William C. Porter a le le r r e e s s William C. Scalzo C C Tracey Westerhausen Mark Winkleman 1957 - 2007 Reese Woodling 1957 - 2007 Elizabeth Stewart (2006) Arizona Outdoor Recreation Coordinating Commission Jeffrey Bell, Chair Mary Ellen Bittorf Garry Hays Rafael Payan William Schwind Duane Shroufe Kenneth E. Travous This publication was prepared under the authority of the Arizona State Parks Board. Prepared by the Statewide Planning Unit Resources Management Section Arizona State Parks 1300 West Washington Street Phoenix, Arizona 85007 (602) 542-4174 Fax: (602) 542-4180 www.azstateparks.com The preparation of this report was under the guidance from the National Park Service, U.S. Department of the Interior, under the provisions of the Land and Water Conservation Fund Act of 1965 (Public Law 88-578, as amended). The Department of the Interior prohibits discrimination on the basis of race, religion, national origin, age or disability. For additional information or to file a discrimination complaint, contact Director, Office of Equal Opportunity, Department of the Interior, Washington D.C. 20240. September 2007 ARIZONA 2008 SCORP ARIZONA 2008 Statewide Comprehensive Outdoor Recreation Plan (SCORP) Arizona State Parks September 2007 iii ARIZONA 2008 SCORP ACKNOWLEDGEMENTS The 2008 Statewide Comprehensive Outdoor Recreation Plan (SCORP) for Arizona was prepared by the Planning Unit, Resources Management
    [Show full text]
  • Summer 2016 3 Maricopa Audubon Society Field Trips
    The Cactus WrenNotes &•dition Announcements Volume LXXII, No. 2 Summer - 2016 Neon Skimmer Photo by Pierre Deviche New Children’s Pages Inside! HeaderNotes & Announcements Author Celebrate Pollinator Week by Meetings are held at: Papago Buttes Discovering Arizona’s Bees Church of the Brethren (northwest of 64th Saturday, June 20, 10 am – noon. White Street and Oak Street, which is between Mountain Nature Center, 425 S. Woodland Thomas Road and McDowell Road). You Road, Pinetop-Lakeside, (928) 358-3069. Following a cowboy breakfast, scientist may enter from either 64th Street, just and author Stephen Buchmann will north of Oak Street (if coming from the present an illustrated talk on the diversity south you will have to make a “U” turn), of Arizona’s bees from its southern deserts or Oak Street just west of 64th Street, by to the ponderosa pine forests of the White events & programs the Elks Lodge. Turn right into the gravel Prairie Falcon. Photo by Matt VanWallene Mountains. Learn how to identify your parking lot. Come and join us and bring local bees. Steve will also give a hands- Erratum on demonstration of how easy it is to use notes & announcements a friend! MAS holds a monthly meeting scrap lumber to make a “Bee Hotel” for leaf on the first Tuesday of the month from On page 15 of the Spring 2016 issue of the Wren•dition, the hawk depicted cutter and mason bees. Following his talk, September through April. The fall issue in the photograph labeled Ferruginous Steve will lead a short nature walk in search of The Cactus Wren•dition (published in Hawk is a Prairie Falcon.
    [Show full text]
  • A History of Duchesne County, Utah Centennial County History Series
    A HISTORY OF 'Duchesne County r>* '••'""•"•• l'j •:%*'•:•• John D. Barton UTAH CENTENNIAL COUNTY HISTORY SERIES A HISTORY OF (Duchesne County John D. Barton Duchesne County, in the Uinta Basin of northeastern Utah, was opened for home- steading in 1905, the last region in the state settled by Euro-Americans, and among the last settled areas in the continental United States. Its history is a microcosm of that of the West, featuring various groups of Native Americans, Spanish explorers, fur trappers, outlaws, cowboys, miners, and freighters. It was made part of the Uintah Ute Indian Reservation in 1861. Later, it was opened to homesteading, resulting in a land rush. County residents lived a pioneering lifestyle well into the twentieth century as they home- steaded the land and built communities. In more recent times, the county has faced booms and busts based on extractive economies, large government water projects, environ­ mental problems, and conflict between tradi­ tional and contemporary ideas about land use. In recent years, the Ute Tribe has claimed jurisdiction over the land, resulting in legal battles all the way to the U.S. Supreme Court. Located on the south slope of the Uinta Mountains, Duchesne County contains many spectacular natural resources, including the highest point in the state—Kings Peak—and is loved by thousands of outdoor enthusiasts and county residents. ISBN: 0-913738-41-7 A HISTORY OF 'Duchesne County A HISTORY OF 'Duchesne County John D. Barton 1998 Utah State Historical Society Duchesne County Commission Copyright
    [Show full text]
  • Environmental Change in Aravaipa, 1870 - 1970 an Ethnoecological Survey
    BUREAU OF LAND MANAGEMENT ARIZONA - Environmental Change in Aravaipa, 1870 - 1970 An Ethnoecological Survey Diana Hadley Peter Warshall Don Bufkin CULTURAL RESOURCE SERIES No. 7 1991 Environmental Change in Aravaipa, 1870 - 1970 An Ethnoecological Survey Prepared by Hadley Associates Diana Hadley, Historian Peter Warshall, Ph.D., Ecologist Don Bufkin, Cartographer Cultural Resource Series Monograph No. 7 Published by the Arizona State Office of the Bureau of Land Management 3707 N. 7th Street Phoenix, Arizona 85014 September 1991 EDITOR'S FORWARD The preface to this document expresses the hope that this ethnoecological survey of Aravaipa " . will provide local managers with a greater time- depth and feeling for the ways in which humans and natural events have intertwined to shape Aravaipa's present condition and the appearance of Aravaipa's resources. Wise future management cannot be divorced from the cumulative impacts and decisions of the past. Future management can benefit from the knowledge, the admitted mistakes, and beneficial decisions made by former residents." I cannot think of a clearer statement of the manner in which cultural resource information can be made relevant to our lives today. Archaeologists and historians are often asked to justify the usefulness of their efforts in relation to the realities of modern-day living. In response, we say that the lessons of the past can teach us how to live better in the present. By building on the successes of those who came before us, and avoiding mistakes that they have made, we can do a better job of managing our resources now and can plan more effectively for the future.
    [Show full text]
  • Bartlett Lake
    Statewide Fisheries Investigations Federal Aid Project FW-100-P-23 2013 Arizona Angler User Days, Fishing Economics and Angler Demographics Technical Report 15-02 Fisheries Branch Special Report 2015 PROJECT FUNDING Funding for this project was provided through fishing license revenues and the Sport Fish Restoration Act, a program administered by U.S. Fish and Wildlife Service, Division of Federal Aid. RECOMMENDED CITATION Fisheries Branch. 2015. 2013 Arizona Angler User Days, Fishing Economics and Angler Demographics, Federal Aid Project FW-100-P-23. Arizona Game and Fish Department, Phoenix Arizona. The Arizona Game and Fish Department prohibits discrimination on the basis of race, color, sex, national origin, age, disability in its programs and activities. If anyone believes they have been discriminated against in any of the AGFD’s programs or activities, including its employment practices, the individual may file a complaint alleging discrimination directly with the AGFD Deputy Director, 5000 W. Carefree Highway, Phoenix, Arizona 85086, (602) 942-3000 or U.S. Fish and Wildlife Service, 4040 N. Fairfax Dr., Ste. 130, Arlington, VA 22203. If you require this document in an alternative format, please contact the AGFD Deputy Director as listed above or by calling TTY at 1-800 367-8939. i TABLE OF CONTENTS Executive Summary....................................................................................................................... 1 Introduction ...................................................................................................................................
    [Show full text]
  • An Assessment of Fish Tissue Pollutants in Arizona Lakes by Jason Jones and Sam Rector
    An Assessment of Fish Tissue Pollutants in Arizona Lakes By Jason Jones and Sam Rector AN ASSESSMENT OF FISH TISSUE POLLUTANTS IN ARIZONA LAKES INTRODUCTION Purpose This study is the first systematic assessment of mercury, polychlorinated biphenyls (PCBs) and selenium in wild caught consumable fish in Arizona’s lakes. The study will outline the prevalence of these contaminants in Arizona’s lakes and will provide guidance for how to eat fish responsibly. Lakes were chosen using a probabilistic or random sampling design which allows statistical inferences to be made about fish tissue in all the states lakes. The Arizona Department of Environmental Quality (ADEQ) prepared this report for the U.S Environmental Protection Agency (EPA) as directed in the state fiscal year 2021 and 2022 work plan. Conducting state scale probabilistic assessments is a monitoring initiative in Arizona’s Comprehensive Water Quality Monitoring Strategy (ADEQ, 2020). Fish are Part of a Healthy Diet Fish are an important part of a healthy diet because they are a lean, low calorie source of protein. Fish have omega-3 polysaturated fatty acids which are beneficial to our overall health. The Arizona Department of Health Services estimates that approximately 451,980 Arizonans ate at least one fish meal per year from lakes and streams in Arizona (ADHS, 2009). Poor diets contribute to obesity which is estimated to kill 280,134 Americans a year (Allison, 1999). The rate of obesity has increased dramatically in the United States over the last 50 years. In 1960, 14 percent of American’s had a body mass index in the obese range (> 30).
    [Show full text]
  • The Economic Importance of Fishing and Hunting for Each Arizona County Are
    T HE E CONOMIC I MPORTANCE OF F ISHING AND H UNTING Economic data on fishing and hunting for the State of Arizona and for each Arizona County Study Prepared by Jonathan Silberman, PhD. School of Management A CKNOWLEDGEMENTS The author would like to acknowledge the special partnership that came together in the preparation of this report. This report was prepared for and funded by the Arizona Game and Fish Department. Many individuals at Arizona Game and Fish provided assistance in the data acquisition and analysis. Among those are Jeff Casper, Todd Pringle, Amber Munig, Ty Gray, Sherry Crouch, and Alan Silverberg. Lakshmanan Murugappan provided capable research assistance, especially entering the data from the 2002 Angler Survey. Angelita Dehe provided exceptional expertise and commitment producing the report. Without their help, this report would not be possible. The author remains solely responsible for the contents. 2 TABLE OF CONTENTS Executive Summary .......................................................................................... 4 Table 1: Data Requirements & Sources....................................................... 7 Table 2: 2001 Economic Importance .......................................................... 10 Table 3: 2001 Angler & Hunter Days ......................................................... 11 Table 4: 2001 Hunting & Fishing Expenditures........................................... 12 State of Arizona & County Reports State of Arizona ........................................................................................
    [Show full text]
  • Responsivemgmt2014azangler's Opinions Attitudes Expenditures
    ARIZONA ANGLERS’ OPINIONS, ATTITUDES, AND EXPENDITURES IN THE STATE Conducted for the Arizona Game and Fish Department by Responsive Management 2014 ARIZONA ANGLERS’ OPINIONS, ATTITUDES, AND EXPENDITURES IN THE STATE 2014 Responsive Management National Office Mark Damian Duda, Executive Director Martin Jones, Senior Research Associate Tom Beppler, Research Associate Steven J. Bissell, Ph.D., Qualitative Research Associate Andrea Criscione, Research Associate Patrick Doherty, Research Associate Gregory L. Hughes, P.E., Research Associate Eva Meadows, Survey Center Manager Alison Lanier, Business Manager 130 Franklin Street Harrisonburg, VA 22801 Phone: 540/432-1888 Fax: 540/432-1892 E-mail: [email protected] www.responsivemanagement.com Acknowledgments Responsive Management would like to thank Loren Chase, Todd Pringle, Chris Cantrell, and Marianne Cox of the Arizona Game and Fish Department for their input, support, and guidance on this project. Arizona Anglers’ Opinions, Attitudes, and Expenditures in the State i EXECUTIVE SUMMARY INTRODUCTION AND METHODOLOGY This study was conducted for the Arizona Game and Fish Department (hereinafter referred to as the Department) to determine anglers’ opinions on various regulations, their satisfactions and dissatisfactions with fishing in Arizona, their fishing locations and methods typically used, and their fishing-related expenditures in Arizona in 2013. The study entailed a multi-modal survey of Arizona anglers. The survey obtained data from a scientifically selected random sample, stratified by county, using telephone and Internet modes. The survey questionnaire was developed cooperatively by Responsive Management and the Department. Responsive Management conducted pre-tests of the questionnaire to ensure proper wording, flow, and logic in the survey. The database of Arizona anglers was obtained from the Department, from which the sample was randomly drawn, stratified by county.
    [Show full text]
  • Arizona Game and Fish Department Sport Fish Stocking Program
    Arizona Game and Fish Department Sport Fish Stocking Program Draft Environmental Assessment March 2011 Prepared by EcoPlan Associates, Inc., for the U.S. Fish and Wildlife Service and the Arizona Game and Fish Department HOW TO COMMENT ON THIS DRAFT ENVIRONMENTAL ASSESSMENT The Draft Environmental Assessment (EA) is available for review on-line at www.fws.gov/southwest/federal_assistance/index.html and www.azgfd.gov/fishea, or by CD via regular mail upon request to Ms. Brie Darr or Mr. Dave Weedman, as listed below. In addition, hard copies of the Draft EA may be viewed at the AGFD Phoenix Headquarters and AGFD field offices statewide. Phoenix Headquarters Office Region 2 - Flagstaff Office Region 5 - Tucson Office 5000 W. Carefree Highway 3500 S. Lake Mary Road 555 N. Greasewood Road Phoenix, AZ 85086 Flagstaff, AZ 86001 Tucson, AZ 85745 602-942-3000 928-774-5045 520-628-5376 Region 1 - Pinetop Office Region 3 - Kingman Office Region 6 - Mesa Office 2878 E. White Mountain Blvd. 5325 N. Stockton Hill Road 7200 E. University Drive Pinetop, AZ 85935 Kingman, AZ 86409 Mesa, AZ 85207 928-367-4281 928-692-7700 480-981-9400 Region 4 - Yuma Office 9140 E. 28th St. Yuma, AZ 85365 928-342-0091 Written comments may be submitted via mail, fax, or in person (Monday through Friday 8 a.m. to 5 p.m.). Comments may also be submitted by e-mail to [email protected] or [email protected]. Please refer to Arizona Game and Fish Department Sport Fish Stocking Draft EA in the Subject line.
    [Show full text]
  • Arizona Game and Fish Department Arizona Trout Challenge Where To
    Arizona Game and Fish Department Arizona Trout Challenge Where to Fish for Rainbow Trout in Arizona? Lees Ferry* Luna Lake Christopher Creek * Lynx Lake Upper East Verde River* Mormon Lake Tank East Clear Creek* Morton Lake West Clear Creek* Nelson Reservoir Black River* Oak Creek Apache Lake Pacific Avenue Athletic Complex Pond Ashurst Lake (Winter only) Bear Canyon Lake Parker Canyon Lake Becker Lake Patagonia Lake Big Lake Perkins Tank Black Canyon Lake Pratt Lake Bunch Reservoir Rainbow Lake Blue Ridge Reservoir Red Mountain Lake Canyon Creek Redondo Lake (Winter only) Canyon Lake Riggs Flat Lake Carnero Lake River Reservoir Cataract Lake Roper Lake Chevelon Creek Rose Canyon Lake Chevelon Lake Saguaro Lake City Reservoir Salt River Clear Creek Reservoir Scotts Reservoir Concho Lake Show Low Creek Council Avenue Pond (Winter only) Show Low Lake Crescent Lake Silver Creek Dead Horse Lake Tempe Town Lake Elk Hill Tank Tunnel Reservoir Fain Lake Watson Lake JD Dam Tank Wet Beaver Creek Kinnikinick Lake Willow Springs Lake Knoll Lake Woodland Reservoir Upper Lake Mary Woods Canyon Lake Lower Lake Mary Workman Creek* Mingus Lake Yuma West Wetlands Pond (Winter only) Santa Fe Lake Tonto Creek Verde River Cluff Ranch Ponds Dankworth Pond Dogtown Reservoir Fools Hollow Lake Fortuna Lake (Winter only) Francis Short Pond Goldwater Lake Haigler Creek* Hulsey Lake Kaibab Lake Long Tom Lake ‘*’ indicates that the waterbody is also eligible for the Wild Trout Challenge .
    [Show full text]