Supplemental Table S2
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Retinoic Acid Enhances the Expression of Interferon-Induced Proteins: Evidence for Multiple Mechanisms of Action
Oncogene (1997) 15, 2349 ± 2359 1997 Stockton Press All rights reserved 0950 ± 9232/97 $12.00 Retinoic acid enhances the expression of interferon-induced proteins: evidence for multiple mechanisms of action Luis Pelicano1, Fengsheng Li2, Christian Schindler2 and Mounira K Chelbi-Alix1 1CNRS-UPR 9051; 1, avenue Claude Vellefaux, HoÃpital St Louis, 75010 Paris, France; 2Division of Molecular Medicine, College of Physicians and Surgeons of Columbia University, New York, New York 10032, USA Retinoic acid (RA) and interferons (IFNs) are negative Tyk2, phosphorylate Stat1, Stat2 and Stat3. The IFN- regulators of cell proliferation. In vitro and in vivo, their stimulated gene factor 3 (ISGF3) is formed between combination leads to a more potent growth inhibition. Stat1 and Stat2 (Stat1 : 2) in association with the DNA- However, the molecular mechanisms by which RA and binding protein, p48, a member of the interferon IFNs potentiate each other are not fully understood. As regulatory factor (IRF) family (Fu et al., 1992; some IFN-induced gene products regulate cell growth Schindler et al., 1992). This complex binds to the and/or antiviral activity, we analysed the eects of RA IFN-stimulated response element (ISRE) found in on their expressions. RA increases the level of promoters of IFNa/b-stimulated genes. In addition, 2'5'oligoadenylate synthetase, p68 kinase, the promyelo- homo- and heterodimers of Stat1 and Stat3 (Stat1 : 1, cytic leukemia protein (PML) and Sp100 in both HL-60 Stat3 : 3 and Stat1 : 3) bind to a palindromic version of and WISH cells. Moreover, RA and IFN act coopera- the IFNg-activated site (GAS), regulating the expres- tively to increase the expression of these proteins. -
Antibody-Based Delivery of Cytokine Payloads to Carbonic Anhydrase IX
Published OnlineFirst June 18, 2019; DOI: 10.1158/1535-7163.MCT-18-1301 Large Molecule Therapeutics Molecular Cancer Therapeutics Antibody-Based Delivery of Cytokine Payloads to Carbonic Anhydrase IX Leads to Cancer Cures in Immunocompetent Tumor-Bearing Mice Barbara Ziffels1, Marco Stringhini1, Philipp Probst1, Tim Fugmann2, Theo Sturm2, and Dario Neri1 Abstract Antibody–cytokine fusion proteins can have the potential TNF, IL2, or IL12 as payloads cured all mice in their therapy to increase the density and activity of subsets of leukocytes groups, whereas only a subset of mice was cured by the within the tumor mass. Here, we describe the design, produc- antibody-based delivery of IFNa2. Although the antibody tion, and characterization of four novel antibody–cytokine fusion with TNF mediated a rapid hemorrhagic necrosis of fusion proteins directed against human carbonic anhydrase IX, the tumor mass, a slower regression of the neoplastic lesions a highly validated marker of hypoxia that is overexpressed in (which continued after the last injection) was observed with clear cell renal cell carcinoma and other malignancies. As the other fusion proteins, and treated mice acquired protective immunomodulatory payloads we used TNF, IL2, IFNa2 (cor- anticancer immunity. A high proportion of tumor-infiltrating þ responding to products that are in clinical use), and IL12 (as CD8 T cells was specific to the retroviral antigen AH1; this cytokine potently activates T cells and NK cells). Therapy however, the LGPGREYRAL peptide derived from human experiments were performed in BALB/c mice, bearing CT26 carbonic anhydrase IX was also present on tumor cells. The tumors transfected with human carbonic anhydrase IX, in results described herein provide a rationale for the clinical use order to assess the performance of the fusion proteins in an of fully human antibody–cytokine fusions specific to carbonic immunocompetent setting. -
Mechanism of Action Through an IFN Type I-Independent Responses To
Downloaded from http://www.jimmunol.org/ by guest on September 25, 2021 is online at: average * The Journal of Immunology , 12 of which you can access for free at: 2012; 188:3088-3098; Prepublished online 20 from submission to initial decision 4 weeks from acceptance to publication February 2012; doi: 10.4049/jimmunol.1101764 http://www.jimmunol.org/content/188/7/3088 MF59 and Pam3CSK4 Boost Adaptive Responses to Influenza Subunit Vaccine through an IFN Type I-Independent Mechanism of Action Elena Caproni, Elaine Tritto, Mario Cortese, Alessandro Muzzi, Flaviana Mosca, Elisabetta Monaci, Barbara Baudner, Anja Seubert and Ennio De Gregorio J Immunol cites 33 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription http://www.jimmunol.org/content/suppl/2012/02/21/jimmunol.110176 4.DC1 This article http://www.jimmunol.org/content/188/7/3088.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2012 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 -
P1382-Human Cellexp FLT-3 Ligand, Recombinant Mouse
FOR RESEARCH ONLY! Human CellExp™ FLT-3 Ligand, Mouse Recombinant CATALOG #: P1382-50 P1382-10 AMOUNT: 50 µg 10 µg FLT3LG, FL, FLT3L, Flt3 ligand ALTERNATE NAMES: MOL. WT. The protein has a calculated MW of 20.2 kDa. The protein migrates as 25-33 kDa under reducing (R) condition (SDS-PAGE) due to glycosylation. SOURCE: HEK 293 cells PURITY: >90% as determined by SDS-PAGE. ENDOTOXIN: Less than 1.0 EU per μg by the LAL method FORM: Lyophilized FORMULATION: Lyophilized from 0.22 μm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization. Centrifuge the vial prior to opening. Reconstitute in sterile deionized water to a concentration of 100 µg/ml. RECONSTITUTION: Do not vortex. It is recommended to store at -20°C. SPECIFIC ACTIVITY: Immobilized Mouse Flt-3 Ligand, His Tag at 1 μg/mL (100 μL/well) can bind Human Flt-3/Flk-2 Fc Chimera with a linear range of 1-5 ng/mL STORAGE CONDITIONS: Store at -20°C. After reconstitution, aliquot and store at -20°C and use within 3 months. Avoid repeated freezing and thawing cycles. DESCRIPTION: FMS-like tyrosine kinase 3 ligand (Flt-3 Ligand) is also known as FL, Flt3L and FLT3LG, is an α-helical cytokine that promotes the differentiation of multiple hematopoietic cell lineages. FLT3LG is expressed as a noncovalentlylinked dimer by T cells and bone marrow and thymic fibroblasts. Each 36 kDa chain carries approximately 12 kDa of N- and O- linked carbohydrates. FLT3LG is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). -
Flt3 Ligand (FLT3LG) (NM 001278637) Human Tagged ORF Clone Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG236103 Flt3 ligand (FLT3LG) (NM_001278637) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Flt3 ligand (FLT3LG) (NM_001278637) Human Tagged ORF Clone Tag: TurboGFP Symbol: FLT3LG Synonyms: FL; FLG3L; FLT3L Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG236103 representing NM_001278637. Sequence: Blue=ORF Red=Cloning site Green=Tag(s) GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC ATGGAGCGGCTCAAGACTGTCGCTGGGTCCAAGATGCAAGGCTTGCTGGAGCGCGTGAACACGGAGATA CACTTTGTCACCAAATGTGCCTTTCAGCCCCCCCCCAGCTGTCTTCGCTTCGTCCAGACCAACATCTCC CGCCTCCTGCAGGAGACCTCCGAGCAGCTGGTGGCGCTGAAGCCCTGGATCACTCGCCAGAACTTCTCC CGGTGCCTGGAGCTGCAGTGTCAGCCCGACTCCTCAACCCTGCCACCCCCATGGAGTCCCCGGCCCCTG GAGGCCACAGCCCCGACAGCCCCGCAGCCCCCTCTGCTCCTCCTACTGCTGCTGCCCGTGGGCCTCCTG CTGCTGGCCGCTGCCTGGTGCCTGCACTGGCAGAGGACGCGGCGGAGGACACCCCGCCCTGGGGAGCAG GTGCCCCCCGTCCCCAGTCCCCAGGACCTGCTGCTTGTGGAGCAC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC Protein Sequence: >Peptide sequence encoded by RG236103 Blue=ORF Red=Cloning site Green=Tag(s) MERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFS RCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQ VPPVPSPQDLLLVEH TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV -
Brain Sciences
brain sciences Article Differential Expression of Genes Related to Innate Immune Responses in Ex Vivo Spinal Cord and Cerebellar Slice Cultures Infected with West Nile Virus Parminder J. S. Vig 1,2,3,*, Deyin Lu 1, Amber M. Paul 4, Ram Kuwar 5, Maria Lopez 1, Dobrivoje S. Stokic 3,6 , A. Arturo Leis 6, Michael R. Garrett 7 and Fengwei Bai 1,4 1 Departments of Neurology, University of Mississippi Medical Center, Jackson, MS 39216, USA; [email protected] (D.L.); [email protected] (M.L.); [email protected] (F.B.) 2 Biochemistry, University of Mississippi Medical Center, Jackson, MS 39216, USA 3 Neurobiology & Anatomical Sciences, University of Mississippi Medical Center, Jackson, MS 39216, USA; [email protected] 4 Department of Biological Sciences, University of Southern Mississippi, Hattiesburg, MS 39406, USA; [email protected] 5 Virginia Commonwealth University, Richmond, VA 23284, USA; [email protected] 6 Methodist Rehabilitation Center, Jackson, MS 39216, USA; [email protected] 7 Experimental Therapeutics and Pharmacology, University of Mississippi Medical Center, Jackson, MS 39216, USA; [email protected] * Correspondence: [email protected]; Tel.: +1-601-984-5513; Fax: +1-601-984-6626 Received: 29 October 2018; Accepted: 18 December 2018; Published: 24 December 2018 Abstract: West Nile virus (WNV) infection results in a spectrum of neurological symptoms, ranging from a benign fever to severe WNV neuroinvasive disease with high mortality. Many who recover from WNV neuroinvasive infection present with long-term deficits, including weakness, fatigue, and cognitive problems. While neurons are a main target of WNV, other cell types, especially astrocytes, play an important role in promoting WNV-mediated central nervous system (CNS) damage. -
Delivering Type I Interferon to Dendritic Cells Empowers Tumor Eradication and Immune Combination Treatments
Author Manuscript Published OnlineFirst on November 29, 2017; DOI: 10.1158/0008-5472.CAN-17-1980 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. 1 Delivering type I interferon to dendritic cells empowers tumor eradication and immune combination treatments Anje Cauwels1†, Sandra Van Lint1†, Franciane Paul2, Geneviève Garcin2, Stefaan De Koker1,5, Alexander Van Parys1, Thomas Wueest3, Sarah Gerlo1, José Van der Heyden1, Yann Bordat2, Dominiek Catteeuw1, Elke Rogge1, Annick Verhee1, Bart Vandekerckhove4, Niko Kley3, Gilles Uzé2‡ & Jan Tavernier1,3‡* 1Cytokine Receptor Laboratory, Flanders Institute of Biotechnology, VIB-UGent Center for Medical Biotechnology, Faculty of Medicine and Health Sciences, Ghent University, A. Baertsoenkaai 3, 9000 Ghent, Belgium. 2CNRS UMR 5235, University Montpellier, Place Eugène Bataillon, 34095 Montpellier, France. 3Orionis Biosciences, Technologiepark 4, 9052 Zwijnaarde-Gent, Belgium; and Watertown, Boston, USA. 4Department of Clinical Chemistry, Microbiology and Immunology, Ghent University, UZ Gent, MRB2, De Pintelaan 185, 9000 Gent, Belgium 5Present address: eTheRNA Immunotherapies, Arthur de Coninckstraat 11, 3070 Kortenberg, Belgium *To whom correspondence should be addressed: Jan Tavernier, A. Baertsoenkaai 3, 9000 Ghent, Belgium. Phone +32.9.2649302, Fax +32.9.2649340, [email protected] †shared first authors, ‡shared last authors Downloaded from cancerres.aacrjournals.org on September 28, 2021. © 2017 American Association for Cancer Research. Author Manuscript Published OnlineFirst on November 29, 2017; DOI: 10.1158/0008-5472.CAN-17-1980 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. 2 The authors declare no potential conflicts of interest. Running title: Specific DC-targeted IFN allows nontoxic antitumor efficacy This work was supported by UGent Methusalem and Advanced ERC (CYRE, N° 340941) grants to J.T.; an FWO-V grant G009614N to J.T. -
Supplementary Materials
Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine -
IL6 Sensitizes Prostate Cancer to the Antiproliferative Effect of Ifna2
H H H Erb et al. IRF9 regulation by IL6 in 20:5 677–689 Research prostate cancer Open Access IL6 sensitizes prostate cancer to the antiproliferative effect of IFNa2 through IRF9 Holger H H Erb1, Regina V Langlechner1, Patrizia L Moser2, Florian Handle1, Tineke Casneuf3, Karin Verstraeten3, Bettina Schlick4, Georg Scha¨fer1, Brett Hall5, Kate Sasser5, Zoran Culig1 and Fre´de´ric R Santer1 Correspondence 1Division of Experimental Urology, Department of Urology 2Department of Pathology, Innsbruck Medical University, should be addressed 6020 Innsbruck, Austria to Z Culig or F R Santer 3Oncology Biomarkers, Janssen Research and Development, Beerse, Belgium Emails 4Oncotyrol, Center for Personalized Medicine, 6020 Innsbruck, Austria [email protected] or 5Oncology Biomarkers, Janssen Research and Development, Spring House, Pennsylvania, USA [email protected] Abstract Development and progression of prostate cancer (PCa) are associated with chronic Key Words inflammation. The cytokine interleukin 6 (IL6) can influence progression, differentiation, " IRF9 survival, and angiogenesis of PCa. To identify novel pathways that are triggered by IL6, we " IL6 performed a gene expression profiling of two PCa cell lines, LNCaP and MDA PCa 2b, treated " prostate cancer with 5 ng/ml IL6. Interferon (IFN) regulatory factor 9 (IRF9) was identified as one of the most " IFNa2 prevalent IL6-regulated genes in both cell lines. IRF9 is a mediator of type I IFN signaling and " inflammation acts together with STAT1 and 2 to activate transcription of IFN-responsive genes. The IL6 Endocrine-Related Cancer regulation of IRF9 was confirmed at mRNA and protein levels by quantitative real-time PCR and western blot respectively in both cell lines and could be blocked by the anti-IL6 antibody Siltuximab. -
The STING-IFN–Dependent Axis Is Markedly Low in Patients With
International Journal of Molecular Sciences Article The STING-IFN-β-Dependent Axis Is Markedly Low in Patients with Relapsing-Remitting Multiple Sclerosis 1, 1, , 1 2 1 Lars Masanneck y, Susann Eichler * y, Anna Vogelsang , Melanie Korsen , Heinz Wiendl , Thomas Budde 3 and Sven G. Meuth 1,2 1 Department of Neurology with Institute of Translational Neurology, University Hospital Münster, 48149 Münster, Germany; [email protected] (L.M.); [email protected] (A.V.); [email protected] (H.W.); [email protected] (S.G.M.) 2 Department of Neurology, Heinrich Heine University Düsseldorf, 40225 Düsseldorf, Germany; [email protected] 3 Institute of Physiology I, University of Münster, 48149 Münster, Germany; [email protected] * Correspondence: [email protected] These authors contributed equally to this work. y Received: 9 November 2020; Accepted: 2 December 2020; Published: 4 December 2020 Abstract: Cyclic GMP-AMP-synthase is a sensor of endogenous nucleic acids, which subsequently elicits a stimulator of interferon genes (STING)-dependent type I interferon (IFN) response defending us against viruses and other intracellular pathogens. This pathway can drive pathological inflammation, as documented for type I interferonopathies. In contrast, specific STING activation and subsequent IFN-β release have shown beneficial effects on experimental autoimmune encephalomyelitis (EAE) as a model for multiple sclerosis (MS). Although less severe cases of relapse-remitting MS (RRMS) are treated with IFN-β, there is little information correlating aberrant type I IFN signaling and the pathologic conditions of MS. We hypothesized that there is a link between STING activation and the endogenous production of IFN-β during neuroinflammation. -
Monoclonal Antibody to IFNA2 / Interferon Alpha-2 - Aff - Purified
OriGene Technologies, Inc. OriGene Technologies GmbH 9620 Medical Center Drive, Ste 200 Schillerstr. 5 Rockville, MD 20850 32052 Herford UNITED STATES GERMANY Phone: +1-888-267-4436 Phone: +49-5221-34606-0 Fax: +1-301-340-8606 Fax: +49-5221-34606-11 [email protected] [email protected] AM20794PU-S Monoclonal Antibody to IFNA2 / Interferon alpha-2 - Aff - Purified Alternate names: IFN-alpha 2, Interferon alpha-A, LeIF A Quantity: 0.1 mg Concentration: 1.0 mg/ml Background: A member of the type 1 IFN family of related proteins produced by leucocytes and fibroblasts. IFN alpha 1 has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Uniprot ID: P01563 NCBI: NP_000596.2 GeneID: 3440 Host / Isotype: Mouse / IgG1 Clone: KT5 Immunogen: Recombinant Human IFN-alpha 2a Format: State: Liquid purified Ig fraction Purification: Protein A Chromatography from mouse ascites. Buffer System: PBS containing 0.09% Sodium Azide as a preservative Applications: Indirect ELISA: 1 μg/ml. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user. Specificity: This antibody reacts with both Interferon alpha-2a and Interferon alpha-2b. Species: Human. Other species not tested. Add. Information: CHROMOSOMAL LOCATION Genetic locus: IFNA2 (human) mapping to 9p21.3 Storage: Store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch. General Readings: 1. Adolf, G.R. 1987. Antigenic structure of human interferon-ω1 (interferon-αII1): comparison with other human interferons. -
The MK2 Pathway Is Linked to G-CSF, Cytokine Production and Metastasis
Qeadan et al. J Transl Med (2020) 18:137 https://doi.org/10.1186/s12967-020-02294-z Journal of Translational Medicine RESEARCH Open Access The MK2 pathway is linked to G-CSF, cytokine production and metastasis in gastric cancer: a novel intercorrelation analysis approach Fares Qeadan1, Pranshu Bansal2, Joshua A. Hanson3 and Ellen J. Beswick4* Abstract Background: Gastric cancer is associated with chronic infammation, but there is still much to understand about the tumor microenvironment and the underlying tumor-promoting mechanisms. The Map kinase-activated protein kinase 2 (MK2) pathway is a regulator of infammatory cytokine production that we have been studying in gastrointes- tinal cancers. Here, we set out to determine the signifcance of this gene in gastric cancer along with its downstream mediators and if there were diferences in the primary tumors with and without metastasis. Methods: Human gastric cancer tissues with and without metastasis were examined for MK2 expression and cytokine profle in organ culture supernatants. Advanced statistical methods including a lower triangular correlation matrix, novel rooted correlation network, linear and logistic regression modeling along with Kruskal–Wallis testing with Sidak correction for multiple testing were applied to gain understanding of cytokines/chemokines linked to metastasis. Results: The MK2 pathway is strongly linked with metastasis and a panel of cytokines. Gene expression was able to classify gastric cancer metastasis 85.7% of the time. A signifcant association with a panel of cytokines was found, including G-CSF, GM-CSF, Mip-1β, IFN-α, MCP-1, IL-1β, IL-6, and TNF-α. Mip-1β was found to have the strongest asso- ciation with MK2 and metastasis after Sidak correction for multiple testing.