DOCSLIB.ORG

Comparison of Human ZFY and ZFX Transcripts (Sex Determination/"Zinc Rmgers"/X Chromosome/Y Chromosome/Polymerase Chain Reaction) MARK S

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Comparison of Human ZFY and ZFX Transcripts (Sex Determination/ Proc. Nati. Acad. Sci. USA Vol. 87, pp. 1681-1685, March 1990 Genetics Comparison of human ZFY and ZFX transcripts (sex determination/"zinc rmgers"/X chromosome/Y chromosome/polymerase chain reaction) MARK S. PALMER, PHILIPPE BERTA*, ANDREW H. SINCLAIR, BARBARA PYM, AND PETER N. GOODFELLOW Human Molecular Genetics, Imperial Cancer Research Fund, Lincoln's Inn Fields, London WC2A 3PX, United Kingdom Communicated by M. F. Lyon, November 16, 1989 ABSTRACT ZFY is a candidate for the primary sex- Southern Blotting. Endonuclease-digested DNA was elec- determining gene (TDF, testis-determining factor) on the hu- trophoresed in 0.8% agarose gels and transferred and fixed to man Y chromosome. We have isolated cDNA clones ofZFY and Hybond-N+ filters (Amersham) (10). its homologue on the X chromosome, ZFX. The transcripts of Hybridization. (i) Oligonucleotide probes. Oligonucleotide these genes are very similar to each other and encode predicted 1818 was labeled with 32P at its 5' end with phage T4 proteins of equal size. The conceptual amino acid sequence of polynucleotide kinase. Library filters were hybridized in 5 x both proteins contains an acidic domain, similar to the acti- SSC/20 mM sodium phosphate, pH 7.0/lOx Denhardt's vation domain of transcription factors, and a potential nucleic solution/10%o dextran sulfate/7% SDS containing oligonu- acid-binding domain of 13 "zinc ringers."' We have used the cleotide (106 cpm/ml) and heterologous DNA (100,ug/ml). polymerase chain reaction to demonstrate the expression of (ii) Plasmidprobes. Plasmid inserts were radiolabeled by the ZFY and ZFX in a wide range of adult and fetal human tissues random primer method (11). Filters were hybridized in 5X and to show that ZFX is expressed from the inactive X SSPE/5x Denhardt's solution/0.5% SDS containing 0.5 x chromosome present in human-mouse hybrids. 106 cpm/ml. Final wash conditions were 0.2x SSC at 650C. (SSC is 150 mM NaCl/15 mM sodium citrate, pH 7.0; The primary signal for male sex determination in mammals is Denhardt's solution is 0.02% Ficoll/0.02% polyvinylpyrroli- a testis-determining factor (1) encoded by TDF, a gene on the done/0.02% bovine serum albumin; SSPE is 180 mM NaCl/ Y chromosome. Genetic analysis of sex-reversed individuals 10 mM sodium phosphate, pH 8.0/1 mM EDTA.) been used refine the TDF Sequencing of cDNA Clones. cDNAs derived from Agtll has to chromosomal location of to libraries or by PCR were subcloned into pBluescript vectors an interval of 140 kilobases (kb) on the short arm ofthe human (Stratagene). Plasmids were sequenced as double-stranded Y chromosome (2-4). Sequences within this interval were DNA by using synthetic oligonucleotide primers and Seque- found to be conserved on the Y chromosome in a variety of nase (United States Biochemical). eutherian mammals and also cross-hybridized to sequences Preparation of RNA. Total cellular RNA was extracted on the X chromosome. The nucleic acid sequence of a Y from cell lines and human tissues by the guanidinium thio- chromosome genomic fragment encoded an open reading cyanate method (12), and poly(A)+ mRNA was isolated by frame whose predicted amino acid sequence was a tandem oligo(dT)-cellulose column chromatography. repeat of 13 "zinc-finger" domains. The Y chromosome gene Northern Hybridization. mRNA (5 ,g) was electropho- encoding this zinc-finger protein was called ZFY, and the resed in a 0.8% agarose gel with Mops buffer and 2.2 M homologous sequence on the normal X chromosome was formaldehyde and then transferred to Hybond-N. The filter called ZFX. The zinc-finger motif has been associated with was hybridized at 46°C in Sx SSPE/50% (vol/vol) formam- nucleic acid-binding proteins, and if ZFY is TDF this is ide/5x Denhardt's solution/0.5% SDS with probe at 0.5 X consistent with the proposed regulatory function of TDF. 106 cpm/ml. The filter was washed 15 min in 2x SSPE/0.1% Support for the equivalence ofZFYand TDFwas obtained by SDS, 30 min in lx SSPE/0.1% SDS at 42°C, and 15 min in studying the sex-determining region of mice (5-7). However, 0.1x SSPE/0.1% SDS at room temperature. the finding of homologous genes in marsupials solely on PCR Amplification of cDNA. (i) Specificfirst-strand cDNA autosomes, and not on the sex chromosomes, suggests that synthesis. RNA (5 ,ug) was reverse-transcribed (13), using ZFY might not be the primary signal for sex determination avian myeloblastosis virus reverse transcriptase and syn- (8). Alternatively, eutherians and metatherians may have thetic oligonucleotide primers. (ii) PCR. This was done evolved different mechanisms for sex determination. essentially as described (14) for 35 cycles, with annealing at We have isolated cDNA clones derived from transcripts of 600C. both ZFYand ZFX and we report their sequences here.t We Analysis ofPCR-Amplified cDNA. Amplified products were used the nucleotide sequences to design primers for the extracted in chloroform and then precipitated with spermi- polymerase chain reaction (PCR), which enabled us to look dine (15). Washed precipitates were digested with BamHI at their expression in different tissues and cell types. and run in a 1% agarose gel containing ethidium bromide. Oligodeoxynucleotides. The sequence of oligonucleotide 1818 (5'-AACAAGATGCATAAATGCAAATTCTGCGAA- MATERIALS AND METHODS TATGAGAC-3') is from a region of the published genomic cDNA Libraries. Adult testis cDNA and HeLa cell cDNA sequence ofthe ZFYzinc-finger domain (4) predicted to have libraries, both in bacteriophage Agtll, were obtained from minimum codon degeneracy; the sequence corresponds to Clontech. A cDNA library (pCD2Bassing) derived from a nucleotides 1560-1597 of the ZFY transcript reported here. human foreskin fibroblast line was kindly provided by H. Okayama in the vector pCD2 (9). Abbreviation: PCR, polymerase chain reaction. Cell Lines. These are described in Figs. 2 and 6. *Permanent address: Centre de Recherches de Biochimie Macro- moleculaire, Centre National de la Recherche Scientifique LP 8402/Institut National de la Santd et de la Recherche Medicale The publication costs of this article were defrayed in part by page charge U.249, rte de Mende, 34033 Montpellier Cedex, France. payment. This article must therefore be hereby marked "advertisement" tThe sequences reported in this paper have been deposited in the in accordance with 18 U.S.C. §1734 solely to indicate this fact. GenBank data base (accession nos. M30607 and M30608). 1681 Downloaded by guest on October 1, 2021 1682 Genetics: Palmer et al. Proc. Natl. Acad. Sci. USA 87 (1990) Oligonucleotide 5242 (5'-CCCGAATTCGCTGTGACTGAT- A B 8'9 GAGAATTAAAGGC-3') is identical with nucleotides 233- d9 X Y X Y H 9 X 4 X Y H 257 of ZFX plus an EcoRI linker at the 5' end. Oligonucle- 9.4 _ _ otide 3039 (5'-CCTCGACTTAAACTTCTTCC-3') is comple- 9.4 s mentary to nucleotides 1306-1325 of ZFY and 1550-1569 of ZFX. Oligonucleotide 3043 has the same sequence as oligo- nucleotide 3039 but has an EcoRI linker at the 5' end. 4A 4A Oligonucleotide 5245 (5'-CATGATAGTGTAGTGGAAG- Q 0 CAGAAA-3') is identical with nucleotides 486-510 of ZFY and 730-754 of ZFX. Oligonucleotide 5244 (5'-CCTC- is complementary to TCCTACGATCACTTCCATATA-3') 2.0 - 4S 2.0...- nucleotides 981-1005 of ZFY and 1225-1249 of ZFX. 40 -w_0,,0W. RESULTS 1.1 1.1 Identification of Partial Transcripts of ZFY and ZFX. An adult testis cDNA library was screened with oligonucleotide 06 Q68 1818. A positive phage plaque was isolated and found to contain a 2.3-kb EcoRI insert. This was subcloned into pBluescript and called pMF-1 (Fig. 1). pMF-1 includes at its 3' end a sequence that is identical (except for one base FIG. 2. Southern blot hybridizations. DNA was prepared from difference) with the nucleotide sequence of the genomic the following sources. Lanes 6, male cell line PGF (16); lanes 9, domain entered into the EMBL data base (acces- female cell line WT49 (17); lanes 4X, a 48XXXX cell line, GM1416B zinc-finger (Coriell Institute for Medical Research, Camden, NJ); lanes 4Y, a sion no. J03134) from nucleotide 73 of the genomic sequence 49XYYYY cell line, Oxen (18); lanes X, a hamster-human hybrid cell through to its 3' end. line containing the human X chromosome, C12D (19); lanes Y, a pMF-1 was used to screen a HeLa cDNA library (HeLa hamster-human hybrid containing the human Y chromosome, 853 cells carry no Y chromosome). The 1.3-kb EcoRI insert of a (20); lanes H, the hamster parent cell line, W3GH (19); lane 9, positive phage was subcloned into plasmid (pPB, Fig. 1). pPB hamster-human hybrid containing human chromosome 9p, CF11-4 must contain a transcript from ZFX or a related transcript (21). Filters were screened with pMF-1 (A) or pPB (B). Numbers at from an autosome. pPB lacks the zinc-finger domain but is left of autoradiographs are size markers (kb). Lanes do not all contain homologous to the 5' end of pMF-1. It also extends further 5' the same amount of DNA. than pMF-1 by about 400 bp. There is one continuous open reading frame in pPB with no evidence of a 5' untranslated Affara et al. (22) isolated a transcript that contained the region. Comparison of these sequences suggested that the zinc-finger region but whose 5' sequence was shown, by in first 52 bp at the 5' end of pMF-1 are inverted and probably situ hybridization, to be derived from the short arm of arose as an artifact during the construction of the library. chromosome 9 (9p).
Load more

Recommended publications
  • Zfyl Encodes a Nuclear Sequence-Specific DNA Binding
    View metadata, citation and similar papers at core.ac.uk brought to you byCORE provided by Elsevier - Publisher Connector FEBS 15213 FEBS Letters 360 (1995) 315-319 Zfyl encodes a nuclear sequence-specific DNA binding protein Pamela Taylor-Harris, Sally Swift, Alan Ashworth* CRC Centre of Cell and Molecular Biology, Chester Beatty Laboratories, The Institute of Cancer Research, 237 Fulham Road, London, SW3 6JB, UK Received 19 January 1995; revised version received 3 February 1995 sively to RNA and have functions in RNA storage or processes Abstract Zfyl is a mouse Y chromosomal gene encoding a zinc such as splicing. finger protein which is thought to have some function during In order to analyse the properties of the ZFY family of zinc spermatogenesis. Here we show that, when introduced into tissue finger proteins, we have raised specific antibodies to murine culture cells, Zfyl is targeted to the nucleus. Two independent signals are present within the protein for nuclear localization. Zfyl. These have been used to demonstrate that Zfyl protein This nuclear Zfyl protein is able to bind strongly to DNA-ceHu- localizes to the nucleus of transfected cells and to identify spe- lose and, using site-selection assays, we have identified specific cific DNA binding sites for Zfyl, suggesting a role for this Zfyl DNA binding sites. Taken together these results suggest protein as a transcription factor regulating gene expression that Zfyl is a nuclear-located sequence-specific DNA binding during spermatogenesis. protein which functions during spermatogenesis. Key words: Spermatogenesis; Zinc finger protein; 2. Materials and methods Y chromosome; Nucleus; DNA binding; Transcription factor 2.1.
    [Show full text]
  • Downloaded from Interpro Database (IPR013087)
    bioRxiv preprint doi: https://doi.org/10.1101/637298; this version posted May 15, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. Why Do Long Zinc Finger Proteins have Short Motifs? A case study of ZFY and CTCF reveals non-independent recognition of tandem zinc finger proteins. Zheng Zuo1*, Timothy Billings6, Michael Walker6, Petko Petkov6, Polly Fordyce1, 2, 3, 4, Gary D. Stormo5* 1. Department of Genetics, Stanford University, CA, USA 2. Chan Zuckerberg Biohub, San Francisco, CA, USA 3. Department of Bioengineering, Stanford University, CA, USA 4. Stanford CheM-H Institute, Stanford University, CA, USA 5. Department of Genetics, Washington University in St. Louis, MO, USA 6. The Jackson Laboratory, ME, USA Correspondence: [email protected] Summary The human genome has more than 800 C2H2 Zinc Finger-containing genes, and many of them are composed of long tandem arrays of zinc fingers. Current Zinc Finger Protein (ZFP) motif prediction models assume longer finger arrays correspond to longer DNA-binding motifs and higher specificity. However, recent experimental efforts to identify ZFP binding sites in vivo contradict this assumption with many having short reported motifs. Using Zinc Finger Y (ZFY), which has 13 ZFs, we quantitatively characterize its DNA binding specificity with several complementary methods, including Affinity-seq, HT-SELEX, Spec-seq and fluorescence anisotropy. Besides the previously identified core motif GGCCT recognized by fingers 12-13, we find a novel secondary irregular motif recognized by accessory fingers.
    [Show full text]
  • A Genetic Method for Sex Identification of Raccoons (Procyon Lotor) with Using the ZFX and ZFY Genes
    NOTE Wildlife Science A Genetic Method for Sex Identification of Raccoons (Procyon lotor) with Using the ZFX and ZFY Genes Minami W. OKUYAMA1), Michito SHIMOZURU1) and Toshio TSUBOTA1)* 1)Laboratory of Wildlife Biology and Medicine, Graduate School of Veterinary Medicine, Hokkaido University, Kita18, Nichi9, Kita-ku, Sapporo, Hokkaido 060–0818, Japan (Received 19 November 2013/Accepted 2 January 2014/Published online in J-STAGE 23 January 2014) ABSTRACT. A genetic method for sex determination in raccoons was developed based on nucleotide differences of the zinc finger protein genes ZFX and ZFY. Four novel internal primers specific for ZFX or ZFY were designed. PCR amplification using two primer sets followed by agarose gel electrophoresis enabled sex determination. 141-bp and 447-bp bands were in both sex, and 346-bp band was specific only in male with primer set I. 345-bp and 447-bp bands were in both sex, and 141-bp band was specific only in male with primer set II, which could distinguish raccoon’s electrophoresis pattern from three native carnivores in Hokkaido. This method will be useful for conservation genetics studies or biological analyses of raccoons. KEY WORDS: PCR, raccoons, sex identification, ZFX and ZFY genes. doi: 10.1292/jvms.13-0577; J. Vet. Med. Sci. 76(5): 773–775, 2014 Sex is one of the most important pieces of information between ZFX and ZFY in raccoons and to establish a new about an animal, as it is related to physiology, behavior and genetic method for sex determination of raccoons. reproduction. Thus, developing methods for sex identifica- Hair or whisker samples were collected from the carcasses tion are essential in many fields of study, including zoology of feral raccoons that were euthanized for eradication control and ecology.
    [Show full text]
  • ZFX Acts As a Transcriptional Activator in Multiple Types of Human Tumors by Binding Downstream from Transcription Start Sites at the Majority of Cpg Island Promoters
    Downloaded from genome.cshlp.org on October 6, 2021 - Published by Cold Spring Harbor Laboratory Press Research ZFX acts as a transcriptional activator in multiple types of human tumors by binding downstream from transcription start sites at the majority of CpG island promoters Suhn Kyong Rhie, Lijun Yao, Zhifei Luo, Heather Witt, Shannon Schreiner, Yu Guo, Andrew A. Perez, and Peggy J. Farnham Department of Biochemistry and Molecular Medicine and the Norris Comprehensive Cancer Center, Keck School of Medicine, University of Southern California, Los Angeles, California 90089, USA High expression of the transcription factor ZFX is correlated with proliferation, tumorigenesis, and patient survival in mul- tiple types of human cancers. However, the mechanism by which ZFX influences transcriptional regulation has not been determined. We performed ChIP-seq in four cancer cell lines (representing kidney, colon, prostate, and breast cancers) to identify ZFX binding sites throughout the human genome. We identified roughly 9000 ZFX binding sites and found that most of the sites are in CpG island promoters. Moreover, genes with promoters bound by ZFX are expressed at higher levels than genes with promoters not bound by ZFX. To determine if ZFX contributes to regulation of the promoters to which it is bound, we performed RNA-seq analysis after knockdown of ZFX by siRNA in prostate and breast cancer cells. Many genes with promoters bound by ZFX were down-regulated upon ZFX knockdown, supporting the hypothesis that ZFX acts as a transcriptional activator. Surprisingly, ZFX binds at +240 bp downstream from the TSS of the responsive pro- moters. Using Nucleosome Occupancy and Methylome Sequencing (NOMe-seq), we show that ZFX binds between the open chromatin region at the TSS and the first downstream nucleosome, suggesting that ZFX may play a critical role in pro- moter architecture.
    [Show full text]
  • Normal Structure and Expression of Zfy Genes in XY Female Mice Mutant in Tdy
    Development 109, 647-653 (1990) 647 Printed in Great Britain ©The Company of Biologists Limited 1990 Normal structure and expression of Zfy genes in XY female mice mutant in Tdy JOHN GUBBAY1, PETER KOOPMAN1, JEROME COLLIGNON1, PAUL BURGOYNE2 and ROBIN LOVELL-BADGE1* [ Laboratory of Eukaryotic Molecular Genetics, National Institute for Medical Research, The Ridgeway, Mill Hill, London NW71AA, UK 2MRC Mammalian Development Unit, Wolfson House, 4 Stephenson Way, London NWI 2HE, UK •To whom correspondence should be addressed Summary Zfy-1 and Zfy-2 are candidate genes for Tdy, the testis- show a normal structure and expression pattern in mice determining gene in mice. We have analysed these genes with a Y chromosome known to carry a mutation in Tdy in a line of XY female mice that have been shown to be and that mutant embryos develop into females despite mutated in Tdy. We have used Southern blot analysis to Zfy-1 expression, strongly supports other recent evi- show that the Zfy genes have not undergone any major dence that Zfy genes are not directly involved in primary structural alterations, and have also demonstrated that testis determination. both genes are transcribed normally from the mutant Y chromosome (¥) in both adult XY¥ testis and X¥ Key words: sex determination, Tdy, Zfy, zinc finger genes, female embryonic gonads. The fact that these genes polymerase chain reaction, gene expression. Introduction conservation and cell autonomous action of the testis- determining gene (Burgoyne et al. 1988). Sex determination in mammals is dependent upon the However, theories of the mode of action of ZFY in action of a Y-linked testis-determining gene termed testis determination have to take into account the TDF in humans and Tdy in mice (Goodfellow and presence of a highly homologous gene (ZFX) present Darling, 1988; McLaren, 1988).
    [Show full text]
  • Prenatal Sex Differences in the Human Brain
    Molecular Psychiatry (2009) 14, 988–991 & 2009 Nature Publishing Group All rights reserved 1359-4184/09 $32.00 www.nature.com/mp LETTERS TO THE EDITOR Prenatal sex differences in the human brain Molecular Psychiatry (2009) 14, 988–989. doi:10.1038/ development. These genes are not only expressed in mp.2009.79 the brain before birth but some of them are also known to have sex differences in adult brain,1,4 whereas others are expressed during infancy, but The presence of genetic sex differences in the adult reduced later on during their lifetime.5 human brain is now recognized.1 We hypothesized Intriguingly, SRY, a well-known determinant of that the basis of this sex bias is already established in testicle development during midgestation,6 showed the brain before birth. Here, we show that several no evidence of expression in any of the brain regions genes encoded in the Y-chromosome are expressed in analyzed (Figure 1b, and Supplementary Figure 1), many regions of the male prenatal brain, likely having suggesting that the main somatic sex determinants functional consequences for sex bias during human may be different for the brain and gonads during brain development. human gestation. The marked sex differences in age at onset, In humans, all 11 genes described here are encoded prevalence and symptoms for numerous neuropsy- in the male-specific region of the Y-chromosome,7 chiatric disorders2 indicate the importance to study with RPS4Y1 and ZFY located in the p-arm very close the emergence of a sex bias during human brain to SRY and most of the remaining genes located in the development.
    [Show full text]
  • Quantitative Analysis of Y-Chromosome Gene Expression Across 36 Human Tissues 6 7 8 9 Alexander K
    Downloaded from genome.cshlp.org on September 26, 2021 - Published by Cold Spring Harbor Laboratory Press 1 2 3 4 5 Quantitative analysis of Y-Chromosome gene expression across 36 human tissues 6 7 8 9 Alexander K. Godfrey1,2, Sahin Naqvi1,2, Lukáš Chmátal1, Joel M. Chick3, 10 Richard N. Mitchell4, Steven P. Gygi3, Helen Skaletsky1,5, David C. Page1,2,5* 11 12 13 1 Whitehead Institute, Cambridge, MA, USA 14 2 Department of Biology, Massachusetts Institute of Technology, Cambridge, MA, USA 15 3 Department of Cell Biology, Harvard Medical School, Boston, MA, USA 16 4 Department of Pathology, Brigham and Women’s Hospital, Harvard Medical School, Boston, MA, USA 17 5 Howard Hughes Medical Institute, Whitehead Institute, Cambridge, MA, USA 18 19 20 21 *corresponding author: 22 Email: [email protected] 23 24 25 Running title: 26 Human Y-Chromosome gene expression in 36 tissues 27 28 29 Keywords: 30 Y Chromosome, sex chromosomes, sex differences, EIF1AY, EIF1AX 31 Downloaded from genome.cshlp.org on September 26, 2021 - Published by Cold Spring Harbor Laboratory Press 32 ABSTRACT 33 Little is known about how human Y-Chromosome gene expression directly contributes to 34 differences between XX (female) and XY (male) individuals in non-reproductive tissues. Here, 35 we analyzed quantitative profiles of Y-Chromosome gene expression across 36 human tissues 36 from hundreds of individuals. Although it is often said that Y-Chromosome genes are lowly 37 expressed outside the testis, we report many instances of elevated Y-Chromosome gene 38 expression in a non-reproductive tissue.
    [Show full text]
  • Differential Expression of ZFX Gene in Gastric Cancer
    Differential expression of ZFX gene in gastric cancer 1 2,3, 1 PARVANEH NIKPOUR , MODJTABA EMADI-BAYGI *, FAEZEH MOHAMMAD-HASHEM , MOHAMAD REZA MARACY4 and SHAGHAYEGH HAGHJOOY-JAVANMARD5 1Department of Genetics and Molecular Biology, Faculty of Medicine, Isfahan University of Medical Sciences, Isfahan, Iran 2Department of Genetics, Faculty of Basic Sciences, 3Research Institute of Biotechnology, Shahrekord University, Shahrekord, Iran 4Department of Community Medicine, Faculty of Medicine, 5Applied Physiology Research Center, Isfahan University of Medical Sciences, Isfahan, Iran *Corresponding author (Fax, +98-311-7753480; Email, [email protected]) Gastric cancer accounts for 8% of the total cancer cases and 10% of total cancer deaths worldwide. In Iran, gastric cancer is the leading cause of national cancer-related mortality. Most human cancers show substantial heterogeneity. The cancer stem cell (CSC) hypothesis has been proposed to reconcile this heterogeneity. ZFX encodes a member of the krueppel C2H2-type zinc-finger protein family that is required as a transcriptional regulator for self-renewal of stem cells. A total of 30 paired tissue gastric samples were examined for ZFX gene expression by quantitative real-time RT-PCR. Although the relative expression of the gene was significantly high in 47% of the examined tumour tissues, its expression was low in the others (53%). There was a statistically significant association between the ZFX gene expression and different tumour types and grades. This is the first report that shows ZFX was differentially expressed in gastric cancer. Of note, it was overexpressed in diffused-type and grade III gastric tumoural tissues. Due to this, ZFX may have the potential to be used as a target for therapeutic interventions.
    [Show full text]
  • Genetics of Azoospermia
    International Journal of Molecular Sciences Review Genetics of Azoospermia Francesca Cioppi , Viktoria Rosta and Csilla Krausz * Department of Biochemical, Experimental and Clinical Sciences “Mario Serio”, University of Florence, 50139 Florence, Italy; francesca.cioppi@unifi.it (F.C.); viktoria.rosta@unifi.it (V.R.) * Correspondence: csilla.krausz@unifi.it Abstract: Azoospermia affects 1% of men, and it can be due to: (i) hypothalamic-pituitary dysfunction, (ii) primary quantitative spermatogenic disturbances, (iii) urogenital duct obstruction. Known genetic factors contribute to all these categories, and genetic testing is part of the routine diagnostic workup of azoospermic men. The diagnostic yield of genetic tests in azoospermia is different in the different etiological categories, with the highest in Congenital Bilateral Absence of Vas Deferens (90%) and the lowest in Non-Obstructive Azoospermia (NOA) due to primary testicular failure (~30%). Whole- Exome Sequencing allowed the discovery of an increasing number of monogenic defects of NOA with a current list of 38 candidate genes. These genes are of potential clinical relevance for future gene panel-based screening. We classified these genes according to the associated-testicular histology underlying the NOA phenotype. The validation and the discovery of novel NOA genes will radically improve patient management. Interestingly, approximately 37% of candidate genes are shared in human male and female gonadal failure, implying that genetic counselling should be extended also to female family members of NOA patients. Keywords: azoospermia; infertility; genetics; exome; NGS; NOA; Klinefelter syndrome; Y chromosome microdeletions; CBAVD; congenital hypogonadotropic hypogonadism Citation: Cioppi, F.; Rosta, V.; Krausz, C. Genetics of Azoospermia. 1. Introduction Int. J. Mol. Sci.
    [Show full text]
  • ZFX Rabbit Polyclonal Antibody – TA343385 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA343385 ZFX Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for Anti-ZFX antibody is: synthetic peptide directed towards the C-terminal region of Human ZFX. Synthetic peptide located within the following region: TTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSEKNQHIMRHHKEVGLP Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 83 kDa Gene Name: zinc finger protein, X-linked Database Link: NP_003401 Entrez Gene 7543 Human P17010 Background: The function of this protein remains unknown. Synonyms: ZNF926 Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% Protein Families: Transcription Factors This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 ZFX Rabbit Polyclonal Antibody – TA343385 Product images: Host: Rabbit; Target Name: ZFX; Sample Tissue: ACHN Whole cell lysates; Antibody Dilution: 1.0 ug/ml This product is to be used for laboratory only.
    [Show full text]
  • Distinct Prophase Arrest Mechanisms in Human Male Meiosis
    bioRxiv preprint doi: https://doi.org/10.1101/195321; this version posted September 28, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Distinct prophase arrest mechanisms in human male meiosis Sabrina Z. Jan1, Aldo Jongejan2, Cindy M. Korver1, Saskia K.M. van Daalen1, Ans M.M. van Pelt1, Sjoerd Repping1 and Geert Hamer1,* 1 Center for Reproductive Medicine, Amsterdam Research Institute Reproduction and Development, Academic Medical Center, University of Amsterdam, Amsterdam, The Netherlands 2 Bioinformatics Laboratory, Department of Clinical Epidemiology, Biostatistics and Bioinformatics, Academic Medical Center Amsterdam, The Netherlands * Correspondence: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/195321; this version posted September 28, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. To prevent chromosomal aberrations to be transmitted to the offspring, strict meiotic checkpoints are in place to remove aberrant spermatocytes. However, in about 1% of all males these checkpoints cause complete meiotic arrest leading to azoospermia and subsequent infertility. We here unravel two clearly distinct meiotic arrest mechanisms that act during the prophase of human male meiosis. Type I arrested spermatocytes display severe asynapsis of the homologous chromosomes, disturbed XY-body formation and increased expression of the Y-chromosome encoded gene ZFY and seem to activate a DNA damage pathway leading to induction of p63 mediated spermatocyte elimination. Type II arrested spermatocytes display normal chromosome synapsis, normal XY-body morphology and meiotic crossover formation but have a lowered expression of several cell cycle regulating genes and fail to properly silence the X-chromosome encoded gene ZFX.
    [Show full text]
  • Measurement by Quantitative PCR of Changes in HPRT, PGK-1, PGK-2, APRT, Mtase, and Zfy Gene Transcripts During Mouse Spermatogenesis
    NucleicNRlAcids Research, Vol. 18, No. 5 1990 Oxford University Press 1255 Measurement by quantitative PCR of changes in HPRT, PGK-1, PGK-2, APRT, MTase, and Zfy gene transcripts during mouse spermatogenesis Judith Singer-Sam, Murray O.Robinson', Anthony R.Bellve2, Melvin l.Simon' and Arthur D.Riggs Division of Biology, Beckman Research Institute of the City of Hope, Duarte, CA 91010, 'Caltech, Division of Biology, Pasadena, CA 91125 and 2Departments of Anatomy and Cell Biology, Urology and the Center for Reproductive Sciences, College of Physicians and Surgeons, Columbia University, New York, NY 10032, USA Received October 12, 1989; Revised and Accepted February 6, 1990 ABSTRACT A reverse transcriptase-polymerase chain reaction genes, PGK-1 and HPRT, the Y-linked Zfy genes were also assay (RT-PCR) was used quantitatively to measure included in the study because they may be involved in accumulated levels of RNA transcripts in total mouse spermatogenesis (12). RNAs derived from male germ cells at various Three other genes were investigated. The autosomal gene for spermatogenic stages. RNA levels for two X-linked adenine phosphoribosyltransferase (APRT), was included in the enzymes, phosphoglycerate kinase (PGK-1) and study because, like HPRT, APRT is part of the purine salvage hypoxanthine phosphoribosyl transferase (HPRT), both pathway and is expressed ubiquitiously at low levels. decrease during spermatogenesis, although the Phosphoglycerate kinase-2 (PGK-2), an autosomal, testis-specific transcript levels decrease much more rapidly for isozyme of PGK-1, was included as a control because it is known PGK-1. RNA for the Y-linked ZFY (zinc finger protein) to be expressed only in meiotic and post-meiotic male germ cells is elevated in all spermatogenic cell fractions tested, (13).
    [Show full text]