www.PaloAltoOnline.com Palo 6°Ê888]Ê ÕLiÀÊÓÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊN xäZ Alto Palo Alto dollars lean right in governor’s race Page 3
The debate over Measure heats up Firefi ghters, offi cials square off
page 17 Inside this issue 'BMM3FBM&TUBUF A PUBLICATION OF THE ALMANAC AND PALO ALTO WEEKLY20 10
Pulse 12 Transitions 13 Spectrum 14 Movies 28 Eating Out 32 Puzzles 57 2010 G N Arts UN fi lm festival takes on environment Page 24 N Sports Stanford football has a lot of Luck Page 34 N Home Rethinking a mature garden Page 45 Perinatal Obstetric Diagnostic Anesthesia Center
Packard Center for Stanford Children’s Fetal Health School of Hospital Medicine
TOGETHER WHAT DREW US HERE AS DOCTORS, DRAWS US BACK AS PATIENTS.
Obstetricians Karen Shin and Mary Parman spend their days caring for pregnant patients and delivering babies. Now that each doctor is pregnant with her fi rst child, the choice of where to deliver is clear: right here where they deliver their patients’ babies, at Lucile Packard Children’s Hospital. “At Packard, every specialist you could ever need is available within minutes, around the clock. When you’ve seen how successfully the physicians, staff and nurses work, especially in unpredictable situations, you instinctively www.lpch.org want that level of care for you and your baby.” To learn more about the services we provide to expectant mothers and babies, visit lpch.org
Page 2ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ 1ST PLACE BEST LOCAL NEWS COVERAGE California Newspaper Publishers Association
UpfrontLocal news, information and analysis Valley execs support Whitman’s ‘independent’ campaign Despite area’s political leanings, Atherton Republican In Menlo Park, another Silicon debate at the Dominican College in Brown countered that in addition enjoys local fundraising edge over Democrat Jerry Brown Valley city that normally favors San Rafael. Whitman, a billionaire to Whitman’s own contributions, Democrats, Whitman had raised who has invested about $140 million she has received millions from “the by Gennady Sheyner $272,749 from local donors by the into her campaign, said her personal kind of corporate executives who end of September, compared to contributions allow her to be inde- would benefit directly from her alo Alto may be a Democratic has raked in more contributions $134,865 raised by Brown. pendent from special interests and key economic plank.” Whitman’s bastion, but it’s the Republi- from Palo Alto donors than her Whitman’s hometown advantage accused Brown of being beholden to proposals include eliminating the P can candidate for governor Democratic opponent, Attorney has exaggerated the fundraising public-employee unions, who con- capital-gains tax and imposing a who is leading the race for local General Jerry Brown, despite the difference in Atherton, where she tributed heavily to his campaign. one-year moratorium on Assembly campaign cash, records show. city’s heavy Democratic leanings. enjoyed a nearly eightfold lead over “The expenditure of my own Bill 32, a 2006 law that restricts Meg Whitman, the former eBay By Sept. 30, Whitman has received Brown — $738,131 versus $97,143. money allows me to be independent, greenhouse-gas emissions. CEO who constantly portrays her- $526,111 compared to the $328,553 The topic of campaign finance re- to go to Sacramento with no strings self as an independent outsider, raised by Brown. emerged at this week’s gubernatorial attached,” Whitman said. (continued on page 11)
BUSINESS AT&T to open tech center in Palo Alto Multi-million-dollar center to generate new products by Sue Dremann T&T is setting up a multimil- lion-dollar technology-devel- A opment center in Palo Alto in a race to snag the Bay Area’s braini- est mobile-technology developers’ ideas. The collaborative work center could launch a wave of financial support for local businesses and in- ventors, as entrepreneurs, equipment providers, businesses, employees and venture capitalists join to work on new mobile-communications products. AT&T is not alone in its efforts
Michelle Le to capture innovative ideas locally. Sprint Nextel has planned a grand opening for its tech-development center in Burlingame on Oct. 25; Verizon expects to open a center Holding a gift from students, the Dalai Lama chats with Costano Elementary School student Rudy Rivera, left, while Belle Haven student in San Francisco in mid-2011, Adagio Lopeti looks on, at Costano in East Palo Alto on Wednesday. spokespersons for the companies said. “You belong to the new centu- on race, nationality, and we sacri- AT&T’s Palo Alto headquarters COMMUNITY ry,” the Dalai Lama told Tatyana fice fundamental human values,” will focus on consumer products Spears, a 13-year-old McNair the Dalai Lama responded. and mobile applications, such as for Middle School eighth-grader who “First we must realize nearly 7 Apple’s iPhone and Google’s An- Dalai Lama tells students asked how young people can find billion human beings are the same. droid, according to Peter Hill, vice peace in their lives. Everyone wants a happy life. Rac- president of ecosystem and innova- “You have nine decades to make ism, discrimination based on faith tion. to live ‘from their hearts’ it become peaceful, compassion- or point of view is a total mistake Using a “speed dating” model, For East Palo Alto students, ‘new century’ ate and friendly — or more de- — very backward thinking.” software developers can pitch structive. It’s entirely up to you,” The Dalai Lama sat in an over- ideas in 8 to 12 minutes to compa- is on their shoulders, Tibetan leader says the Dalai Lama said. stuffed chair on the gym stage and ny executives. Selected ideas will by Chris Kenrick “Education — development of spoke in what he described as “bro- receive backing and assistance to the brain — is not sufficient. You ken English,” frequently conferring get the products developed and to he Dalai Lama told 400 his childhood memories to meth- must pay more attention to your with a translator sitting to his left. market quickly, spokesman John East Palo Alto students that ods he uses to cheer himself up own heart, to what we learn from Students from the independent Britton said. The company hopes T responsibility for the 21st after a “sad day.” our mothers at a very young age.” Living Wisdom School of Palo to review as many as 400 propos- century rests on their shoulders Eleven of the students, from Vanessa Tostado, an eighth- Alto — who last year mounted als per year. — and that they should manage it East Palo Alto middle schools grader at Willow Oaks School, a pageant about the Dalai Lama Local venture capitalists hailed from their hearts. as well as Menlo-Atherton and asked about racism. — recited poems and sayings and AT&T’s move. In a meandering, hour-plus dis- Sequoia high schools, earned the “We have different races, dif- helped in Tibetan cultural perfor- Silicon Valley venture-capital cussion Wednesday afternoon in chance to personally address the ferent faiths, nationalities, posi- mances before the monk’s arrival, firms Kleiner Perkins Caufield and a school gym, the exiled Tibetan world-famous 75-year-old monk tions, rich families, poor families teaching the audience to sing the Byers and Sequoia Capital will part- Buddhist leader responded to after submitting essays on what — sometimes in the past and even ner with AT&T to help identify po- questions on topics ranging from constitutes a “meaningful life.” today, we have too much emphasis (continued on page 9) (continued on page 6) *>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 3
Upfront FREE iPad with QUOTE OF THE WEEK your Invisalign 450 CAMBRIDGE AVE, PALO ALTO, CA 94306 * (650) 326-8210 ‘‘ Treatment PUBLISHER William S. Johnson EDITORIAL Call (650) 324-4900 Jay Thorwaldson, Editor Jocelyn Dong, Managing Editor to schedule your FREE consultation Carol Blitzer, Associate Editor Keith Peters, Sports Editor ,IMITED TO l RST TO RESPOND ™ This is putting a hole in the canoe *16 GB Wifi iPad. Tyler Hanley, Express and Online Editor Ask offi ce for details. Offer Rebecca Wallace, Arts & Entertainment Editor .O -ETAL OR 7IRES 1UICK 2ESULTS expires 10/22/10 Rick Eymer, Assistant Sports Editor while we’re bailing water. Chris Kenrick, Gennady Sheyner, Staff Writers —Karen Holman, Palo Alto City Councilwoman, Sue Dremann, Staff Writer, Special Sections Editor SAVE MONEY: INTEREST FREE FINANCING Karla Kane, Editorial Assistant on why she opposes Measure R, the firefighters’ ini- Veronica Weber, Staff Photographer tiative. See story on page 17. Palo Alto Advanced Dentists Dale Bentson, Colin Becht, General, Cosmetic, Implant & Orthodontic Dentists Peter Canavese, Kit Davey, Iris Harrell, ‘‘ Sheila Himmel, Kevin Kirby, Jack McKinnon, s %L #AMINO 2EAL 0ALO !LTO Renata Polt, Jeanie Forte Smith, WWW)NVISALIGN0ALO!LTOCOM Susan Tavernetti, Robert Taylor, Contributors Cigna, Metlife, Aetna, Delta Dental; most insurance accepted. Sally Schilling, Georgia Wells, Editorial Interns DESIGN Shannon Corey, Design Director Raul Perez, Assistant Design Director Linda Atilano, Diane Haas, Scott Peterson, Around Town Paul Llewellyn, Senior Designers Gary Vennarucci, Designer FOR THE FRANCOPHILES ... FILL ‘ER UP ... Palo Alto’s Public James Franco, Palo Alto’s fa- Works staff has a new proposal PRODUCTION Jennifer Lindberg, Production Manager vorite homegrown Renaissance for the city’s landfill in the Bay- Dorothy Hassett, Samantha Mejia, Blanca Yoc, man, recently took some time off lands: Let’s fill it up as fast as Sales & Production Coordinators from his films, his General Hos- possible. Garbage has been ADVERTISING pital shoots, and his Ivy League trickling into the landfill at a slow Walter Kupiec, Vice President, Sales & Marketing classes to release a collection Judie Block, Esmeralda Flores, Janice rate of late following the City Hoogner, Gary Whitman, Display Advertising Sales of stories about the city of his Council’s January 2009 decision Neil Fine, Rosemary Lewkowitz, youth. The collection, “Palo Alto to ban commercial waste at the Real Estate Advertising Sales Stories,” hit the bookstores this David Cirner, Irene Schwartz, landfill. The ban was intended Inside Advertising Sales week, and it’s filled with referenc- to keep a 9-acre portion of the Cathy Norfleet, Display Advertising Sales Asst. es to the titular city. Franco, now landfill open so that the site could Diane Martin, Real Estate Advertising Assistants a Yale University student, studied Alicia Santillan, Classified Administrative Asst. house a waste-to-energy plant the writing craft at Brooklyn Col- in the future. But the policy went EXPRESS, ONLINE AND VIDEO SERVICES lege and Columbia University Rachel Palmer, Online Operations Coordinator further than expected, dramati- Rachel Hatch, Multimedia Product Manager and wrote these stories for his cally shrinking garbage loads and creative-writing classes, as he BUSINESS making it harder for the city to Penelope Ng, Payroll & Benefits Manager told NPR in a recent interview. close the landfill by 2012 or 2013, Elena Dineva, Mary McDonald, Though the book alludes to a as was previously planned. A Cathy Stringari, Susie Ochoa, Doris Taylor, myriad of local landmarks — Business Associates delay would force the city to run Stanford Hospital, the old Print- afoul of its state permit, which re- ADMINISTRATION er’s Inc. bookstore and Jordan Amy Renalds, Assistant to the Publisher quires the city to stop accepting & Promotions Director Middle School to name a few garbage by late 2011. And then Janice Covolo, Receptionist — the stories are less about the Palo Alto would have to seek Ruben Espinoza, Courier city than about the dark thoughts extensions to its closure plan. EMBARCADERO MEDIA and frequent indiscretions of lo- So now city staff want to fill the William S. Johnson, President cal youths (story titles include Michael I. Naar, Vice President & CFO landfill by fall 2011. This would Walter Kupiec, Vice President, Sales & Marketing “Headless,” “Killing Animals” and entail diverting garbage from the Frank A. Bravo, Director, Information Technology “I Could Kill Someone.”). & Webmaster SMaRT Station in Sunnyvale Connie Jo Cotton, Major Accounts Sales Manager (the current destination for local CHALLENGING THE AUTHOR- Bob Lampkin, Director, Circulation & Mailing garbage) to the Palo Alto dump. Services ITY ... Palo Alto’s leading high- A new report by Public Works Alicia Santillan, Circulation Assistants speed-rail watchdogs will receive Chris Planessi, Chip Poedjosoedarmo, Senior Engineer Matthew Ra- an award Friday night for their Computer System Associates schke recommends that the city efforts to promote more ac- “quickly fill the remaining landfill countability from the California The Palo Alto Weekly (ISSN 0199-1159) is pub- capacity” and “convert the area lished every Friday by Embarcadero Media, 450 High-Speed Rail Authority. The to parkland as soon as possible.” Cambridge Ave., Palo Alto, CA 94306, (650) 326- Committee for Green Foothills 8210. Periodicals postage paid at Palo Alto, CA The council’s Finance Committee will present “Citizen Advocacy and additional mailing offices. Adjudicated a news- is scheduled to discuss the pro- paper of general circulation for Santa Clara County. Awards” Friday to the four co- The Palo Alto Weekly is delivered free to homes founders of Californians Advo- posal Tuesday night. in Palo Alto, Menlo Park, Atherton, Portola Valley, cating Responsible Rail Design East Palo Alto, to faculty and staff households on WELCOME TO THE TREE the Stanford campus and to portions of Los Altos (CARRD): Elizabeth Alexis, Sara The Bowman program builds Hills. If you are not currently receiving the paper, Armstrong, Nadia Naik and Rita HOUSE ... Palo Alto is well you may request free delivery by calling 326-8210. Wespi. The four Palo Altans have known for its astronomic prop- confidence, creativity and POSTMASTER: Send address changes to Palo erty values, but when it comes Alto Weekly, P.O. Box 1610, Palo Alto, CA 94302. been promoting public aware- academic excellence. Copyright ©2010 by Embarcadero Media. All ness of the controversial rail to affordable housing, the city’s rights reserved. Reproduction without permission is project; tracking rail legislation supply is widely known to be strictly prohibited. Printed by SFOP, Redwood City. grossly inadequate. Palo Alto +"#' $) The Palo Alto Weekly is available on the Internet via and flagging problems with the Palo Alto Online at: rail authority’s projections and officials hope the “Tree House” www.PaloAltoOnline.com plans. Gilroy resident Yvonne will improve the situation a little $$"#' $) Our e-mail addresses are: [email protected], Sheets-Saucedo is also sched- bit. The 35-unit housing complex [email protected], [email protected]. will soon be developed at 488 Missed delivery or start/stop your paper? uled to pick up an award for par- $$*-$)%$#$(& Call 650 326-8210, or e-mail circulation@paweekly. ticipating in the planning of the West Charleston Road, at a leafy com. You may also subscribe online at Central Valley portion of the rail site between El Camino Real and www.PaloAltoOnline.com. Subscriptions are $60/yr. !#'$#**)*$) line. “Citizens’ voices are a criti- Alma Street. The City Council is cal component in the discourse scheduled to consider on Oct. ))((#' SUBSCRIBE! on urban planning, especially in 18 whether to provide the Hous- Support your local newspaper by becoming today’s discussions of providing ing Corporation a $2.5 million a paid subscriber. $60 per year. $100 for High Speed Rail for our region loan for the new development "%'%#, two years. and our state,” the Committee (which would bring the council’s Name: ______announced in a statement. “CGF total financial assistance for the +)*$#' Address: ______feels it important to recognize Tree House to $5.3 million). If the City/Zip: ______these local citizens for their will- council approves the loan, con- www.bowmanschool.org Mail to: Palo Alto Weekly, ingness, tenacity, and fervor with struction would commence later P.O. Box 1610. Palo Alto CA 94302 which they have taken on this this fall. N task.”
Page 4ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Upfront
TRANSPORTATION CITY HALL Utilities tries to inform Schwarzenegger vetoes powerless customers City to revise policy so it spells out how much outage rail-accountability measure information is too much — or too little Budget provisions would have required rail authority by Gennady Sheyner to respond to the critical reports before receiving funding by Gennady Sheyner ours after Palo Alto’s an automated call warning them Utilities Department un- about a gas leak and urging them ith a stroke of his line- would not require a public subsidy cant risks of the project.” H veiled a new Web page to to evacuate. veto pen, Gov. Arnold for operations. The Institute for Transportation update residents about service The call, which came from W Schwarzenegger Monday The subcommittee, chaired by Studies at University of California, disruptions Tuesday, a power the San Mateo County Office of killed a budget provision that would Simitian, also called for the au- Berkeley, reviewed the authority’s outage hit downtown Palo Alto, Emergency Services, was a false have forced the California High- thority to respond to a long list of ridership projections and found leaving City Hall and about 180 alarm. The automatic message Speed Rail Authority to improve management deficiencies uncovered them “unreliable.” customers in the dark. was supposed to inform resi- its business plan and strengthen its by the Office of State Auditor. The This week, three financial experts The outage, which utilities dents about an Oct. 19 commu- outreach efforts by Feb. 1 or have auditor’s office found that the au- from the Peninsula released an anal- officials attributed to an equip- nity meeting on the city’s pend- about a quarter of its annual budget thority’s program manager, the firm ysis of the authority’s financial data ment failure, began at about ing update of its “water master withheld. Parsons Brinckerhoff, filed monthly and concluded that the authority’s 8:34 p.m. and lasted about an plan.” Instead, it was an old Schwarzenegger’s veto deals a blow reports filled with errors. The office “financial promises can’t be kept.” hour. But if any of the 180 af- — and misdirected — message to efforts by Sen. Joe Simitian, D- reviewed 22 invoices and identified The report was reviewed and en- fected customers used their about the Sept. 9 gas explosion Palo Alto, and other state legislators problems in 20. dorsed by 70 Silicon Valley econo- smartphones to get information in San Bruno. to hold the rail authority accountable In May, after hearing a presenta- mists and CEOs. from the city’s new outage Web About three hours after the after a sequence of audits revealed a tion on the report from State Audi- Simitian, whose Midpeninsula page, they found themselves initial call, the office called myriad of flaws in the agency’s rev- tor Elaine Howle, members of Simi- constituency includes some of the in the dark. The information back to revoke its evacuation or- enue and ridership plans. tian’s subcommittee said they were most vocal critics of the voter-ap- wasn’t updated until Wednes- der and apologize. “While the Administration sup- deeply concerned about the author- proved project, called Schwarzeneg- day morning, much to the con- In Palo Alto, CANS is only ports these reporting requirements, ity’s mismanagement. ger’s veto of the accountability mea- sternation of some utility cus- used for major emergencies, making the (budget) appropriation Sen. Alan Lowenthal, D-Long sures “regrettable.” tomers, who quickly pointed Kinnear said. Smaller incidents, contingent upon receipt and approval Beach, said he found the litany of On Oct. 2, Simitian hosted a Town out the system’s failings on such as Tuesday’s brief power of this report by the Legislature could poor management practices identi- Hall meeting in Palo Alto, where he Palo Alto Online’s community outage, require a lighter touch. result in project delays, jeopardize the fied by the auditor “astounding.” lauded the budget provisions as an forum Town Square. Kinnear said utilities officials Authority’s ability to meet already The authority “doesn’t have at this important step to holding the au- The minor episode is emblem- are trying to improve their noti- tight federal deadlines and result in point a coherent program,” he said. thority accountable. He alluded to atic of the Goldilocks dilemma fication procedures for outages increased state costs,” Schwarzeneg- “Anybody who has read this audit the Feb. 1 deadline and said “the facing the Utilities Department. by immediately informing cus- ger wrote in his veto message. report cannot help but be disheart- clock is ticking” on the authority to Palo Alto officials want to in- tomer-services representatives The penalty for missing the Feb. ened by the authority’s misman- get its house in order. form utilities customers about about any service disruptions, so 1 deadline would have been $55.32 agement, or at least some folks’ Simitian has persistently said he outages in their areas without that they can relay this informa- million in state funding. mismanagement of scarce public supports the rail project — but only having to issue major citywide tion to customers. The provision, which was inserted resources,” Lowenthal said. “if it’s done right.” The authority, announcements for every little The Utilities Department also into the budget by the Senate Budget The auditor’s report is one of sev- he told the crowd at the Town Hall incident. sends mass e-mails to custom- Subcommittee No. 2 on Resources, eral recent studies exposing flaws in meeting, has yet to make a success- They want the alert system to ers who want to be alerted about Environmental Protection, Energy the rail project. The state Legislative ful transition from a small advocacy be just right. power outages. and Transportation, gave the author- Analyst’s Office found major flaws group to the builder of a mega-project To that effect, the city’s Utili- The department’s new Web ity until Feb. 1 to update its busi- in the authority’s business plan. One currently estimated at $42.6 billion. ties Department is now revising page, at www.cityofpaloalto. ness plan and provide an analysis analysis said the plan “superficially its notification policies to deter- org/outageinfo, is part of this demonstrating that the rail project addresses many of the most signifi- (continued on page 6) mine which types of incidents effort, she said. The department should trigger an automatic alert also created two other pages to customers and how many — www.cityofpaloalto.org/sa- people should be notified, Joyce feutility (for safety advisories) Kinnear, manager of the Utili- and www.cityofpaloalto.org/ ties Marketing Service, told the depts/utl/service_disruptions Weekly Wednesday. (a front page for both planned Several residents expressed and unplanned service disrup- frustration with the city’s notifi- tions). Though customers who cation system for power outages lose their power might have a after a Sept. 24 outage in the hard time turning on their per- Barron Park neighborhood. The sonal computers, residents with outage affected about 1,700 cus- smartphones can still view the tomers and Gunn High School. outage page for a quick up- Many of them tried in vain to date. find information about the out- Tuesday’s power failure age online, while some tried to showed one hiccup in the new call dispatch but ran into busy system, however, in that it took signals. place in the evening, after regu- Kinnear said the department lar business hours. tries to update outage data as “In the off hours, the page soon as it can, particularly for doesn’t always get updated im- larger power failures. Palo Alto mediately,” Kinnear said. also uses a Community Alert and She said the department’s Notification System (CANS), revised policy on notification which calls or texts residents will address the subject of during major emergencies. The timeliness: that is, how long it Vivian Wong system merged with Santa Clara should take utilities officials, County’s AlertSCC system last once the outage begins, to post month. information about it on the new But as East Palo Alto residents Web page. N learned Tuesday, automatic- A taste of Japan calling systems also have their Staff Writer Gennady Volunteer Ariko Komoda teaches community members how to use chopsticks at the Japan Tsuchiura disadvantages. At about 5 p.m., Sheyner can be e-mailed at Festival at the Lucie Stern Community Center on Sunday, Oct. 10. Held in honor of Palo Alto’s sister about 1,700 customers received [email protected]. city Tsuchiura, Japan, the festival celebrated all things Japanese, including origami, anime, bonsai and sudoku.
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 5 Upfront
EDUCATION COMMUNITY Anti-stress group holds annual conference this weekend Stanford’s Denise Clark Pope advocates for pre-break final exams by Chris Kenrick
igh schools around the coun- considered a national expert, was pre- 2012 and 2012-2013. try that have shifted their paring this week for her seventh an- Superintendent Kevin Skelly has H first-semester exams to be- nual conference on youth well-being, recommended shifting first-semes- fore the December break “will not which opens tonight (Friday). It runs ter finals to before winter break and go back,” according to Denise Clark through the weekend. beginning the school year in the Pope, a Stanford University senior Pope’s Stanford-based organiza- third week of August rather than the lecturer widely known for her ad- tion, Challenge Success, seeks to fourth. Skelly also proposes to end vocacy of stress-reduction efforts broaden what it calls the “conven- the school year earlier — May 31 in in schools. tional, high-pressure and narrow 2012 and May 30 in 2013. As the Palo Alto school district path to success and (to) offer practi- The theme of the Challenge Suc- debates whether to hold first-semes- cal alternatives to pursue a broader cess conference is “Walking the Veronica Weber ter finals before winter break start- definition.” Talk: Aligning Actions and Values ing in 2011, Pope said anecdotal Students and teachers from Gunn for Youth Well-Being.” evidence from other schools that High School will join their coun- Speaking at tonight’s kickoff in have done so is overwhelmingly terparts from more than 20 other Stanford’s 1,700-seat Memorial positive. schools from around the country Auditorium will be Los Angeles Annette Glanckopf, a Citizen Corps Council member and organizer of Yet little formal research exists on in weekend workshops aimed at writer Wendy Mogel, author of “The an event to honor individuals who have made a difference in emergency the subject, she said. finding ways to reduce stress and Blessing of a Skinned Knee” and the preparedness, stands outside Palo Alto Fire Station No. 6. “There hasn’t been hard-core re- increase engagement with learning, soon-to-be-published “The Blessing search where you have a control group, Pope said. of a B Minus.” do follow-up and check stress levels. Moving finals to before winter Also speaking will be Marin clin- Emergency preparedness That hasn’t happened,” she said. break is one of many strategies ad- ical psychologist Madeline Levine, Pope, who became interested in vocated by Pope’s organization. author of “The Price of Privilege.” is a do-it-yourself challenge the subject of stress in high-achieving The Palo Alto Board of Education RSVPs are required and can be high schools through her 1999 Stan- is slated to vote Nov. 9 on the dis- made at http://csplenary2010.event- Volunteers will be crucial to survival ford doctoral dissertation and is now trict’s academic calendars for 2011- brite.com/. N and recovery from disaster, city leaders say High-speed rail California High-Speed Rail to comply with the legislators’ man- by Sue Dremann (continued from page 5) Authority CEO Roelof van Ark date, he said in an e-mail. he public face of disaster dinator of Homeland Security and released a statement this week af- “We had already alerted the Legis- preparation might be police, public outreach, underlined the ne- firming his commitment to “trans- lature that because of the historically T fire and city officials, but Palo cessity of trained volunteers. He said the agency has been doing parency and accountability” and late budget and therefore our inability Alto officials have said many times “If we fail to engage with the “just barely enough” to retain legis- pledging to update the Legislature to hire any additional risk manage- they won’t be able to handle a disas- community neighborhoods we will lative support and pointed to a series and the public. ment, oversight, and financial staff ter without residents’ help. fail in everything we do,” he said at of critical audits as indications that “Such reporting is appropriate as outlined in the budget, it would It will be a family-by-family, one city policy meeting. the authority “has come up short in and necessary. Based on my expe- be impossible to meet the reporting block-by-block “do it yourself” ef- Block-preparedness coordinators terms of its work to date.” rience in the private sector, regular deadlines that were originally out- fort, officials warn. have spent thousands of dollars of The state Legislature as a whole and accurate reporting is routine, lined in the budget,” Barker said. Palo Alto’s response has bal- their own money to buy equipment, approved the subcommittee’s ac- and I am committed to ensuring But Simitian said the governor’s looned in the past year, involving such as fluorescent vests, radios, countability provisions for high- that the same principles apply for veto will make it even more difficult scores of volunteers, neighborhood outreach and teaching materials. speed rail before Schwarzeneg- this project,” he stated. for the agency to restore its credibil- groups and city officials collaborat- They produced their own disaster- ger vetoed the section of the Jeff Barker, deputy director for ity with the public. ing on how to add a sense of urgency preparedness manual and held three budget outlining these measures. the rail authority, told the Weekly “The High-Speed Rail Author- to emergency preparation. citywide drills that involved radio Schwarzenegger said while he sup- that meeting the deadlines would ity desperately needs to rebuild On Thursday, Oct. 21 — the 21st communications and search-and- ports the reporting requirements have been impossible given how its credibility and public support,” anniversary of the 1989 Loma Prieta rescue drills by PANDAs. he opposes tying them to funding long it took lawmakers to pass the Simitian said. “A failure to require earthquake — city leaders and the Block coordinators developed cur- because that could cause possible state budget. Without a budget, the accountability measures only makes recently resurrected Citizen Corps riculum (including radio communi- delays in the overall project. authority didn’t have the resources that task more difficult.” N Council will present achievement cations) and have taught a three-ses- awards to individuals whose efforts sion class to hundreds of residents. have helped the city prepare for a The three-part classes have been Tech center On Wednesday, he said a pared- us enhance collaboration and dra- major emergency. The council is a adapted to train organizations such (continued from page 3) down version of the innovation matically accelerate the velocity of group of city officials, businesses, as businesses in Stanford Research center has been operating out of a innovation, taking ideas from con- hospitals and residents’ groups. Park, said Dueker, who is working temporary location since August. cept to reality in mere months as op- The award recipients, who will to coordinate and train all sectors tential developers and might invest AT&T is in the process of signing posed to years,” Donovan said. not be identified beforehand, will be within the city. in the firms. a lease on a 10,000 square-foot un- Silicon Valley companies Cisco honored at 7 p.m. in a ceremony at Awareness efforts have been di- “This isn’t something we’ve seen disclosed location in Palo Alto. The Systems of San Jose and Juniper Palo Alto City Hall. The free public verse and creative. from AT&T in the past. ... It reflects new center is scheduled to open by Networks of Sunnyvale plan to event will feature a public unveiling On Sept. 11, nearly 60 people took a positive shift in thinking that will early 2011. provide infrastructure and will col- of the city’s new mobile emergency- part in “Quakeville,” an overnight be a strategic advantage,” Matt In addition to Palo Alto, AT&T laborate in the centers, according to operations center at 5 p.m. evacuation drill at Juana Briones Murphy, partner at Menlo Park- will open “innovation centers” in Britton. Annette Glanckopf, Citizen Corps Park, where residents lived under based Kleiner Perkins Caufield and Plano, Texas, and Tel Aviv, Israel. Hill’s background includes lead- Council member and awards orga- the stars and volunteers conducted Byers, said. The three sites together will pro- ing the development of three-screen nizer, said years of awareness-rais- an injured-missing-person search. Jim Goetz, general partner at vide AT&T with a nearly 24-hour applications (integration of televi- ing seem to be paying off. Lydia Kou, the emergency-pre- Sand Hill Road venture firm Se- workday for development, John sion, personal computer and wire- “We will be so much better pre- paredness coordinator for Barron quoia Capital, agreed. Donovan, AT&T’s chief technology less devices) for AT&T and its U- pared. Our citizenry wouldn’t go Park, organized the event. “Through the innovation centers, officer, said. verse TV. into some kind of psychic shock” Al Dorsky, co-chair of the block- AT&T is embracing the ‘valley’ cul- AT&T wants to tap into the AT&T has also created a virtual because of several key programs, preparedness program, and high- ture. They’re positioning themselves strengths of each area: Palo Alto’s innovation center, where develop- she said. Those include the Palo Alto end radio volunteers had a real-life where ideas are being generated,” he focus will be on applications and ers can test their products on the Neighborhoods Block Preparedness experience on Feb. 17, when Palo said. consumer-products development; AT&T network. The website offers Coordinator program, Palo Alto Alto was left powerless after a small In Palo Alto, initially more than Plano will focus on industry-ap- open-source product-development Neighborhoods Disaster Activities plane hit a utility tower in the Bay- a dozen full-time employees will plication prototypes from auto- technologies and a way to share (PANDA) volunteers and Amateur lands. work with developers on three to motive to education services and ideas. Developers can build, test and Radio Emergency Services/Radio So many people called the city’s five projects. Fifteen to 20 tempo- Tel Aviv will work on back-office certify applications without having Amateur Civil Emergency Services public-information line the system rary employees will be required for systems. to travel to an outside facility, Hill (ARES/RACES) program. each project, Hill said. “The innovation centers will help said. N Kenneth Dueker, the city’s coor- (continued on page 11)
Page 6ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Upfront Upcoming Events How to Make the Most of Yelp, Facebook and Other Social Media Websites for Your Local Business +RVWHGE\+REHHVDQG&RPHULFD%DQN CityViewA round-up of Palo Alto government action this week &RPHULFD%DQN&RQIHUHQFH5RRP/\WWRQ$YHQXH3DOR$OWR :HGQHVGD\2FWREHU ±DP Board of Education (Oct. 12) 6SRQVRUHGE\ Enrollment: The board heard a report on district-wide 2010-11 enrollment, which stands at 12,024, up 3 percent over last year, with most of the growth coming in the )5(( 0XVW5693OLPLWHGVSDFHDYDLODEOH elementary grades. Action: None Kindergarten readiness: The board heard a presentation on the first year of the EPIC (Young Professionals Mixer) three-year, foundation-funded pilot Springboard to Kindergarten program. Action: None 6FRWW\¶V(PHUVRQ6WUHHW7XHVGD\2FWREHU ±SP)5(( High school academic achievement: The board heard that Gunn and Palo Alto high schools are among the top six schools statewide in average SAT scores. Action: ATHENA International Awards Luncheon None +RVWHGE\*DUGHQ&RXUW+RWHO&RZSHU6WUHHW3DOR$OWR Council Appointed Officer Committee (Oct. 12) :HGQHVGD\1RYHPEHU ± SP Interim city attorney: The committee recommended appointing Assistant City At- torney Don Larkin to serve as the city’s interim city attorney after Gary Baum’s retire- ment on Oct. 30. Yes: Klein, Schmid, Espinosa Absent: Scharff 5HJLVWHUIRU$OO(YHQWVDWZZZ3DOR$OWR&KDPEHUFRP1HZVDQG(YHQWV Policy and Services Committee (Oct. 12) Project Safety Net: The committee heard a report on Project Safety Net, the com- munity effort to promote youth well-being, and recommended that the council ap- prove the proposed Suicide Prevention Policy. Yes: Unanimous Planning & Transportation Commission (Oct. 13) Green building: The commission discussed and approved zoning revisions pro- posed by staff to amend the city’s Green Building regulations and to create a new pi- Palo Alto Chamber of Commerce 122 Hamilton Avenue Palo Alto (650) 324-3121 www.PaloAltoChamber.com design by harrington lot program to encourage sustainable neighborhood development. The commission recommended some revisions to ensure staff reports back to the commission about the results from the pilot program. Yes: Unanimous
Public Agenda A preview of Palo Alto government meetings next week
CITY COUNCIL ... The council plans to hold a joint meeting with the Utilities Advisory Commission; continue its discussion of the concept plans for East Meadow Circle/Fabian Way and California Avenue; hold a public hearing on the Community Development Block Grant Citizen Participation Plan; and consider a contract for Palo Alto Municipal Golf Course maintenance. The joint meet- ing with the UAC will begin at 6 p.m. Monday, Oct. 18, in the Council Conference Room at City Hall (250 Hamilton Ave.). Regu- lar meeting will begin at 7:30 p.m. or as soon as possible thereaf- ter in the Council Chambers at City Hall.
FINANCE COMMITTEE ... The committee plans to discuss plans for the city’s landfill operation and a new business plan by R. A. Wiedmann & Associates for the Palo Alto Airport. The meeting is scheduled for 7 p.m. Tuesday, Oct. 19, in the Council Conference Room at City Hall (250 Hamilton Ave.).
PLANNING AND TRANSPORTATION COMMISSION ... The com- mission plans to discuss possible revisions to the Housing Element chapter of the city’s Comprehensive Plan. The meeting is sched- uled for 7 p.m. Wednesday, Oct. 20, in the Council Chambers at City Hall (250 Hamilton Ave.).
HIGH-SPEED RAIL COMMITTEE ... The committee plans to dis- cuss recent correspondence between the California High-Speed Rail Authority and Caltrain about the possibility of building high- speed rail in phases; hear an update on rail-related legislation and discuss the city’s lobbying efforts. The meeting is scheduled for 8 a.m. Thursday, Oct. 21, in the Council Conference Room at City Hall (250 Hamilton Ave.).
ARCHITECTURAL REVIEW BOARD ... The board plans to discuss proposed upgrades to the Stanford University School of Medicine, which are part of Stanford Hospital’s expansion and renovation project. The meeting is scheduled for 8:30 a.m. Thursday, Oct. 21, in the Council Chambers at City Hall (250 Hamilton Ave.).
PUBLIC ARTS COMMISSION ... The commission plans to elect its officers; hear a presentation on temporary public art near the Palo Alto Art Center; hear an update about the recent relocation of the Filaree statue to Greer Park; and discuss replacing a fountain near the California Avenue Caltrain station. The meeting is scheduled for 7 p.m. Thursday, Oct. 21, in the Council Conference Room at City Hall (250 Hamilton Ave.).
LET’S DISCUSS: Read the latest local news headlines and talk about the issues at Town Square at www.PaloAltoOnline.com
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 7 Upfront
LET’S DISCUSS: Read the latest local news headlines News Digest and talk about the issues at Town Square at www.PaloAltoOnline.com Cat burglars drive off with family car comprise about 11 percent of high school enrollment. July 2010, the Washington Post reported. In the third burglary of an occupied home in Palo Alto This year, 46 percent of African-American graduates and Before assuming the role of treasury secretary, Geithner in recent months, one or more persons entered a home in 50 percent of Hispanic graduates met the UC/CSU entrance helmed the Federal Reserve Bank of New York. He worked the 1100 block of Hamilton Avenue between Friday night, requirements — up from 43 percent and 34 percent in 2009. in three presidential administrations for five secretaries of Oct. 8, and Saturday morning in the Crescent Park neigh- However, the 2009 numbers were worse than those for the the treasury. He served as under-secretary of the treasury borhood. class of 2008. for international affairs from 1999 to 2001 for secretaries The burglar entered by a side window, stole a purse and Palo Alto lags behind several high-achieving California Robert Rubin and Lawrence Summers and was director of wallet and drove off with a family vehicle while the two high schools on the college-readiness measure, including the Policy Development and Review Department at the In- residents were asleep upstairs, police Agent Brian Philip San Francisco’s Lowell High School and San Marino High ternational Monetary Fund from 2001 until 2003. reported this week. School, where more than 90 percent of 2008 graduates met Tickets for the event range from $10 for students to $50 for The car was found a short time later by Menlo Park po- UC/CSU requirements. premium seating and are available by calling 800-847-7730 lice, abandoned along Woodland Avenue — indicating the SAT scores for the class of 2010 averaged 1,947 — 1,942 or visiting tickets.commonwealthclub.org. burglar or burglars either walked into Palo Alto or had been at Gunn and 1,951 at Paly. The Oshman Family Jewish Community Center is located dropped off. District-wide, the average score was 635 in critical read- at 3921 Fabian Way, Palo Alto. N An earlier home burglary occurred in the 1500 block of ing; 672 in math; and 640 in writing. — Palo Alto Weekly staff Hamilton, where burglars stole a large flat-panel television Those compare with statewide averages of 501 in critical and drove off with the family minivan while the family reading; 516 in math and 500 in writing, and slightly lower Working group formed on high-speed rail slept upstairs. The minivan was later recovered in East Palo averages for the nation as a whole. A high-level federal “working group” that meets weekly to Alto, Philip said. This means that a student who ranked in the bottom quar- discuss California’s high-speed rail project has been created Another occupied-home burglary occurred in the 100 ter in Palo Alto would still rank in the top 25 percent of in response to growing concerns about the viability of the block of Waverley Street in early September. One person students when compared with their statewide or nationwide California project, Congresswoman Anna Eshoo announced was arrested in that case following an early morning man- peers. N Monday, Oct. 11, in an interview with the Weekly. hunt. N — Chris Kenrick Eshoo said the working group was created by U.S. Sec- — Palo Alto Weekly staff retary of Transportation Ray LaHood following a Sept. Treasury’s Geithner to speak in Palo Alto 30 meeting of six Congress members from California and Nearly two years after being tasked with bringing the several high-level federal officials. The 90-minute meeting Gunn, Paly among top six in SAT scores U.S. economy out of the Great Recession, Secretary of the covered growing concerns about the rail project, currently Gunn and Palo Alto high schools rank in the top six Cali- U.S. Treasury Timothy Geithner will talk about the nation’s estimated to cost $43 billion, which will link San Francisco fornia high schools in average SAT scores, according to financial health at the Oshman Family Jewish Community to Los Angeles in its initial phase. data reviewed at the Palo Alto Board of Education meeting Center in Palo Alto Monday (Oct. 18) at 1 p.m. Eshoo said the congressmembers expressed concerns Oct. 12. Geithner will address the Obama administration’s propos- about the viability of the project and leadership of the Cali- But the schools fall short of their goals in boosting col- als to help get more Americans back to work and help rein- fornia High-Speed Rail Authority, based on several authori- lege-prep rates for minority students. force long-term growth at home as well as efforts to build tative studies that questioned basic cost, design, process and The board reviewed charts and statistics on high school a more stable financial system and to strengthen the global ridership studies of the authority. academic achievement prepared by William Garrison, the economy, according to the Commonwealth Club of Silicon Eshoo said her own position is that some federal funds district’s director of assessment and evaluation. Valley, the event organizer. need to be freed up and applied directly to upgrading and Garrison measured statistical progress against two of the Geithner, 49, will be joined by moderator Michael Moritz, electrifying the Caltrain commute service, struggling to district’s “strategic plan goals” — making sure at least 85 managing member of Sequoia Capital and former San Fran- fill a $2.3 million budget gap. Federal funding is from the percent of all graduates meet entrance requirements for cisco bureau chief for Time magazine. Federal Railroad Administration under the Department of California’s public universities by 2012; and boosting the When Geithner became the treasury secretary in January Transportation. percentage of minority graduates who meet those require- 2009, he was charged with deciding which banks and other She said the federal officials at the meeting include Roy ments by at least 50 percent. financial companies to rescue and under what conditions Kienitz, undersecretary for policy at the Department of The district has met the first goal. the funding would be given, according to the Washington Transportation, who was raised in the Palo Alto/Mountain Garrison’s data shows that 85 percent of the district’s 2010 Post. View/Sunnyvale area. graduates met UC/CSU entrance requirements, compared Within his first month on the job, he played a key role in Members of Congress at the meeting included Mike Hon- with only 76 percent of 2009 graduates. creating the administration’s $787 billion economic-stimu- da, Jackie Speier, George Miller, John Garamendi, Mike Results are mixed on the second goal of upping college lus package. More recently, he helped shape the Dodd-Frank Thompson and Eshoo. N readiness for Hispanic and African-American students, who financial regulation overhaul package, which took effect in — Jay Thorwaldson
Operated by the City of Palo Alto for the East Palo Alto Sanitary District, Los Altos, Los Altos Hills, The Jean and Bill Lane Mountain View, Palo Alto and Stanford. Lecture Series 2010–2011 Palo Alto Wastewater Long Range Facilities Planning Presents Deborah Eisenberg Reading PUBLIC MEETINGS Monday, October 18, 2010, 8:00 p.m. October 27, 2010 Cubberley Auditorium Stanford Campus Locations: Lucie Stern Community Center Colloquium Fireside Room, 2pm–4pm Tuesday, October 19, 2010, 11:00 am Terrace Room Palo Alto Art Center Margaret Jacks Hall (Building 460) Meeting Room, 7pm–9pm
FREE and OPEN TO THE PUBLIC For more information call (650) 329-2598 or visit Information: 650.723.0011 http://creativewriting.stanford.edu www.cityofpaloalto.org/wastewaterplanning Sponsored by Stanford University’s Creative Writing Program
Page 8ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Upfront
peer at the donor group. village and educated for future He answered that at times, dur- vid Montenegro asked whether world Dalai Lama “They are politicians, doctors, leadership from the age of 6 — if ing his teens, he had been a “lazy peace is “ever really achievable.” (continued from page 3) lawyers, business people, school he ever wished to live like an “or- student,” and urged students to take The Dalai Lama launched into his board members, volunteers, com- dinary person,” with a family and advantage of their school years. view on the importance of maternal traditional Dalai Lama welcoming munity leaders, church members. children of his own. “You must play for physical health love early in a child’s life. He said song, “Thamchey Khenpa.” They believe every child in the Ra- The monk recalled sitting with and growth, but to study is very, a combination of “human intellect Sitting in the rear of the gym were venswood School District deserves his tutor as a child and seeing local very important,” he said. and compassion” can bring about a dignitaries, including U.S. Rep. Anna a first-class education. people returning their animals from M-A student Leslie Cisneros more peaceful world. Eshoo, D-Palo Alto, and donors to “You are worth that investment.” pasture. asked the monk how he cheers him- “So we have to work for that,” he the Ravenswood Education Founda- Adagio Lopeti, 13, of Belle Haven “They were ordinary boys and girls, self up after a “sad day.” said. “I myself have dedicated my tion, which raises funds for the Ra- School said he won the essay contest singing, and sometimes I wished I “If you think negative, it brings life to bringing a more peaceful venswood City School District. by writing that “sometimes you have were one of them, so occasionally I sadness,” he replied. “But if you world, more compassionate world. With Ravenswood Superintendent to suffer to get peace. had such feelings,” he said. look for a wider perspective, there “In my case, just talk. In your Maria De La Vega hospitalized after “Peace can be like an old married “But eventually I realized my own are some positive things. case, action,” the monk said, emergency surgery, foundation ex- couple walking in a park,” Adagio responsibility, and that was an op- “The same event — even some- sparking laughter from the stu- ecutive director Charley Scandlyn said he wrote. “They know how a portunity to do something meaning- thing very unbearable — can be dents, and breaking out into took over welcoming duties. relationship takes so long, they nev- ful.” negative from one dimension, and laughter himself. N “The adults are here because er break a promise, they stay mar- Sequoia High School student So- from another dimension may be Staff Writer Chris Kenrick can they’ve been friends and supporters ried for a lot of years.” fia Duenas wondered whether the positive.” be e-mailed at ckenrick@paweek- of your schools,” Scandlyn told stu- Adagio asked the Buddhist leader Dalai Lama has any regrets. Sequoia High School student Da- ly.com. dents, as they turned their heads to — who was plucked from a rural
COMMUNITY Can higher consciousness be measured? Dalai Lama talks about connection between spirituality, science Tibetan leader urges compassion, brotherhood in Stanford talk by Nick Veronin
he crowd at Maples Pavilion, “us versus them” mentality they buzzing with the sound of might have. He said that humans are T 6,300 voices, hushed in an in- social animals who seek compan- stant and rose in unison to greet the ionship, compassion, altruism and guest of honor Thursday morning. nurturing from each other. At ITP we are asking the important questions. Join us and earn your degree. Tenzin Gyatso, better known as He told an anecdote from his the 14th Dalai Lama and an interna- childhood that showed that the seeds tionally recognized religious schol- of compassion in him were planted Psy.D. | Ph.D. | M.A. | Certificate ar, took the stage at Stanford Uni- by his mother. Though he was a Online and On Campus Learning versity, continuing a Bay Area visit spoiled child, when he was “naugh- Spiritually-oriented Clinical Psychology that included a meeting with East ty” his mother always showed him Palo Alto students Wednesday. compassion. He encouraged parents Transpersonal Psychology r Counseling (MFT) The audience, composed of uni- in the audience to lead by example. Women’s Spirituality r Education and Research versity students, faculty and staff, as He also called upon the youth in Coaching r Spiritual Guidance r Creative Expression well as young and old people from the room to make their generation beyond the Bay Area, filled the one that favors dialogue over vio- ŅŅŅĶłĽIJıŃr bleachers and chairs on the gym- lence to resolve conflict. nasium floor to listen to the Dalai In the half-hour long discussion Graduate Education at the Frontier Lama speak on topics that revolved between Doty and the Dalai Lama, of Psychology and Spirituality around the event’s title — “The the two touched upon the science that Centrality of Compassion in Human shows a healthy mindset can lead to a Life and Society.” healthier physical brain and body. Sipping out of white tea cups, the “Inner peace must develop religious leader sat with Stanford through the mental process,” the neuroscientist Dr. James Doty and Dalai Lama said. discussed the connections between “I thought it was incredible,” Lu- a healthy body and a healthy mind ana Dias, a freshman at Stanford, and explored the ways in which said of the event. “I think I agreed spirituality and religion might in- with him on every level.” Grand Opening! form science and vice versa. Louis Marion, another university The effects of kindness, giving, freshman, said he was especially In Palo Alto nurturing, empathy and a host of enthralled with the Dalai Lama’s other human traits that previously ability to merge concepts of science have been considered scientifically and religion so fluidly and believes immeasurable are actually quantifi- that the spiritual leader was right in able and yield valuable data, accord- his analysis of consciousness and its ing to research by Stanford’s Center ability to impact physical health. for Compassion and Altruism Re- Gayle Downs, who drove in from search and Education (CCARE). Cayucos, near Moro Bay, said she CCARE, which hosted the event, also believed that the mind is inex- READYMADE was created after a 2005 visit from tricably linked to the health of the the Dalai Lama. His talks with body. Doty inspired the spiritual leader Scott Wainner, from Walnut FRAME to make a donation of $150,000 — Creek, said that he enjoyed the revenues from his book sales — to Dalai Lama’s ideas overall and his Doty. Doty, in turn, founded and middle-of-the-road approach to sci- now directs CCARE, which in- ence and religion. But he also found COLLECTION cludes neuroscientists, physicians certain points that the monk made $ and religious leaders. to be too idealistic. www.photographandframe.com The Dalai Lama spoke for about “I kind of felt like the world isn’t 2086 El Camino Real, Palo Alto $ an hour, occasionally turning to his a place where dialogue can solve ev- 650.857.0687 49 translator for help finding the right ery problem,” Wainner said. N word. Nick Veronin is a staff writer 1/2 mile North of Page Mill Road 10- “We are the same human being; at the Mountain View Voice, the next to Starbucks Sizes 5x7 up to 24x36 mentally, emotionally, physically Weekly’s sister paper, and can be we are the same,” he told the crowd, e-mailed at nveronin@mv-voice. calling on everyone to give up any com. *>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 9 Answers to this week’s puzzles, which can be found on page 57 Upfront 6 3 2 5 4 1 9 7 8 7 5 4 8 9 3 6 2 1 8 1 9 7 6 2 5 4 3 9 2 7 6 3 8 4 1 5 Online This Week These and other news stories were posted on Palo Alto Online throughout 3 4 6 2 1 5 7 8 9 the week. For longer versions, go to www.PaloAltoOnline.com/news 1 8 5 4 7 9 3 6 2 or click on “News” in the left, green column. 4 9 1 3 2 6 8 5 7 5 7 3 1 8 4 2 9 6 Remodels, Additions & Chamber celebrates its past — and future New Homes The Palo Alto Chamber of Commerce celebrated its 100-year his- 2 6 8 9 5 7 1 3 4 We take care of all residential tory and took stock of its future at the headquarters of Tesla Motors work, large or small, Thursday, blending past innovations with a high-tech future. (Posted for your home. Oct. 14 at 9:30 a.m.) Fresh news Call for your FREE estimate today. Fifth indecent exposure reported in Palo Alto delivered daily HammondHomes7.com Another case of indecent exposure — the fifth since Sept. 21 — has Lic. #703822 Sign up today 408-255-9994 been reported in Palo Alto. A man walked up to four women Tuesday www.PaloAltoOnline.com (Oct. 12) at 8:30 a.m. near Park Boulevard and Oxford Avenue and “exposed himself to them,” Palo Alto police Lt. Sandra Brown stated in a press release. (Posted Oct. 13 at 4:26 p.m.) F. Marland Chancellor, III, MD Humane Society honors Giants with orange cats The Peninsula Humane Society & SPCA is honoring the San Fran- Concierge Family Medicine Specialist cisco Giants’ National League Division Series victory with a special adoption promotion for cats with black or orange fur. (Posted Oct. 13 at FULL-TIME ACCESS, FULL-TIME CARING 2:23 p.m.) “The heart, the Art, of medical practice lies in s !DULT AND 0EDIATRIC PRIMARY CARE Thirty teens dropped from Palo Alto school rolls the strength of the doctor-patient relationship. s 3AME DAY APPOINTMENTS Thirty students were dropped from Palo Alto public school rolls The time spent listening to my patients is the s (OUSE CALLS this fall when their parents were unable to verify their residency in the most important aspect of the care I provide. school district. In a crackdown on non-residents trying to sneak in, Having a physician who knows you well can s DIRECT ACCESS Palo Alto required all incoming ninth-graders to submit fresh docu- help to guide your care in directions that s #ONVENIENT DOWNTOWN LOCATION mentation proving residency. (Posted Oct. 13 at 9:27 a.m.) might otherwise be overlooked in this era of s &AMILY RATES AVAILABLE depersonalized, ‘by-the-numbers’ medicine.” Contact Dr. Chancellor by email or phone to Finding the ‘friendliest’ family biking routes F. Marland Chancellor, III, M.D. schedule an Introductory Consultation Ellen Fletcher, a former Palo Alto City Council member who has spent decades advocating bicycling, safe bike routes and bike lockers, DOCTOR CHANCELLOR IS BACK IN PALO ALTO! was introduced by Mayor Pat Burt and Councilman Yahweh Yeh at a “bike friendly” event Sunday (Oct. 10) sponsored by the Barron Park F. Marland Chancellor, III, MD, 512 Hamilton Ave, Palo Alto, CA 94301 and College Terrace Green Teams. About 300 people, mostly families, s WWWDRCHANCELLOR FAMILYMEDCOM s INFO DRCHANCELLOR FAMILYMEDCOM attended. (Posted Oct. 13 at 12:16 a.m.) Power outage darkens region of north Palo Alto A power outage of unknown origin darkened a large area of north Palo Alto for about an hour Tuesday evening, the city Utilities Depart- ment reported. (Posted Oct. 12 at 10:35 p.m.) NO Oops! East Palo Alto ‘evacuation’ alarm was false East Palo Alto residents received an alarming phone call at 4:59 p.m. Tuesday after the city’s automated dial-up alert system told residents to WORRIES. evacuate. But it was a false alarm. (Posted Oct. 12 at 7:19 p.m.) Critics slam high-speed rail business plan Carefree living at Peninsula critics of California’s proposed high-speed rail system released a new report Monday night challenging the economics be- The Forum Retirement hind the controversial, voter-approved project and accusing the agency charged with building the rail system of deceiving the public. (Posted Community. Oct. 12 at 9:58 a.m.) Carjacking at Lytton Plaza lands suspect in jail A woman waiting for her husband to chat with band members at Lyt- ton Plaza in downtown Palo Alto about 4 a.m. Sunday had her silver Toyota Prius carjacked by a man wielding a gun, Agent Brian Philip reported. A suspect was later arrested in San Mateo, walking away from the car. (Posted Oct. 10 at 10:45 p.m.) Middle College engages restless teens’ minds Ask about our high-level amenities and low monthly fees. Middle College is a publicly funded alternative secondary school 650-944-0190. program that allows local students to simultaneously earn a high Call today to schedule a personal tour. school diploma and college credit in community college classes. The school has shrunk, due to funding cuts in recent years, but the teachers and students remain passionate. (Posted Oct. 10 at 10:09 p.m.) Now is the time to relax and Palo Alto murder-arson trial set for November enjoy life. As a resident-owned The trial for Bulos Zumot, the hookah-shop owner charged with killing his girlfriend and setting their rental cottage on fire, will begin community, The Forum offers Nov. 8, a Santa Clara County judge said Friday (Oct. 8). (Posted Oct. 8 unique equity ownership and at 4:42 p.m.) continuing care that allows you to 23500 Cristo Rey Drive Bicyclist hit by car on University Avenue plan for a secure future. You can Cupertino, CA 95014 A bicyclist was taken to the hospital Thursday afternoon (Oct. 7) 650-944-0100 after being hit by a car on University Avenue in Palo Alto, Palo Alto retire in style with luxury living in police Lt. Sandra Brown said. (Posted Oct. 8 at 12:06 p.m.) a vibrant, carefree environment at www.theforum-seniorliving.com No worries. RCFE# 435200344 COA# 174 Want to get news briefs e-mailed to you every weekday? The Forum. A Smoke Free Community Sign up for Express, our new daily e-edition. Go to www.PaloAltoOnline.com to sign up.
Page 10ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Upfront Commitment To Excellence $500 Governor Meg Whitman’s top Palo Alto contributors Discount Coupon (continued from page 3) (with purchase of new roof) (As of Sept. 30, 2010): Original Ownership Since 1975 Thomas Siebel, chairman, First Virtual Group ...... $51,800 Campaign finance reports show All Types of Roofi ng & Gutters Stacey Siebel, homemaker ...... $51,800 that while Whitman’s gubernatorial Residential & Commercial S.C.L#785441 John Gunn, chairman and CEO, Dodge & Cox ...... $51,800 run is largely self-funded, she has 1901 Old Middlefi eld Way, Mtn. View 650-969-7663 also won the confidence and finan- Judith Koch, retired ...... $35,900 cial support of dozens of the area’s Stratton Sclavos, investment partner, Radar Partners ...... $25,900 leading venture capitalists and Donald Dixon, partner, Trident Capital ...... $25,900 CEOs. Many of Whitman’s Mid- James Breyer, venture capitalist, Accel Partners ...... $25,900 peninsula donors gave $25,900, the Laura Arrillaga, founder and chair, maximum allowed per contribution, Silicon Valley Social Venture Fund...... $25,900 to her campaign in the last reporting Marc Andreessen, chairman, Ning...... $25,900 period. Hewlett-Packard Company...... $25,900 In Palo Alto, that list includes Donald Dixon, partner in Trident Capital; John Gunn, chairman of Jerry Brown’s top Palo Alto contributors Dodge & Cox; James Breyer, a ven- (As of Sept. 30, 2010): Join us at our beautiful Albert & Janet ture capitalist with Accel Partners; George Marcus, chairman, Marcus & Millichap...... $52,700 Schultz Cultural Arts Hall for our second Marc Andreessen, chairman of Hewlett Packard Company ...... $51,800 Ning; Laura Arrillaga, founder of Silicon Valley Social Venture Fund; Mary Jane Marcus, homemaker ...... $30,500 scintillating season! Thomas Siebel, chairman of First Susan Orr, business executive, Telosa Software ...... $25,900 Virtual Group; and Stratton Scla- Nancy Kukkola, real estate, Marcus & Millichap ...... $15,000 vos, a partner at Radar Partners. William A. Millichap, real estate, Marcus & Millichap ...... $14,500 UPCOMING EVENTS In Menlo Park, Whitman’s top John W. Danner, co-founder and CEO, Rocketship Education ...... $10,000 donors include venture capitalists John McNellis, developer, McNellis Partners ...... $10,000 Geoff Yang of Redpoint Ventures; Ed Bugnion, vice president, Cisco Systems ...... $10,000 William Bowes, Jr., of U.S. Venture Ann Doerr, homemaker ...... $10,000 Capital; Ravi Mhatre of Lightspeed Venture Partners; David Marquardt Source: Cal-Access, California Secretary of State of August Capital; and Brion Apple- gate of Spectrum Equity Investors. In Atherton, her donors include At Tuesday’s debate, Whitman ac- received $52,700 from developer Doug Leone of Sequoia Capital; cused Brown of being beholden to George Marcus of the firm Marcus Nersi Nazari of Pacific General public labor unions and said Brown & Millichap Co., and $10,000 from Ventures; and Jesse Rogers of Alta- has been “joined in the hip” with Alma Plaza developer John McNel- mont Capital Partners. unions for 40 years. If Brown is elect- lis. Ed Bugnion, a vice president at Whitman also received the en- ed, Whitman said, he would convene a Cisco Systems, contributed $10,000 dorsement earlier this month from meeting with union bosses who would to Brown’s campaign, while attor- the San Jose/Silicon Valley Cham- “collect IOUs for having funded Jerry ney Chris Kelly contributed $5,000 ber of Commerce, which lauded her Brown’s entire campaign.” and developer Charles “Chop” Trio Jubilee Chamber Group local roots and managerial know- Brown disputed Whitman’s al- Keenan gave $1,500. how. legation that union bosses funded Brown also received smaller 10/17, 3:00 PM “Of course, Meg comes from Sili- his entire campaign and alluded to checks from Santa Clara County Su- con Valley and in her years at eBay the support he received from the pervisor Liz Kniss and former Palo Sit back and relax as this local trio brings the displayed the kind of leadership business community and individual Alto Mayor Peter Drekmeier. sounds of Haydn, Bloch and Dovrak to life with we need in Sacramento,” chamber contributors. Brown ended the last reporting their unusual and exotic sound. President Pat Dando said in a state- Campaign finance data shows period with $22.6 million in his ment. that Brown actually received funds campaign chest, compared to Whit- Between Jan. 1 and Sept. 30, from more contributors in Palo Alto man’s $9.2 million. N Whitman outspent Brown $120.6 than Whitman, but these contribu- Staff Writer Gennady Sheyner million to $10.7 million, campaign tions tended to be smaller than the can be e-mailed at gsheyner@ finance data shows. ones Whitman collected. Brown paweekly.com. Preparedness (continued from page 6) jammed. But Dorsky and amateur radio operators worked out of the city’s Emergency Operations Cen- ter beneath City Hall to get block- preparedness coordinators to check on the elderly and people with med- ical needs. Tito Gonzalez y su Trio In the past couple of years, the Part of the Singles Arts Café PANDAs have built up a strong command structure to assemble re- 11/4, 7:30 PM sources and dispatch people to the field, PANDA district coordinators Enjoy a cornucopia of Cuban music with this Doug Kalish said. authentic, high energy band. Rumba, guaracha, PANDA volunteer Annette Ross son montuno and more! said the volunteer group provides “a predetermined and methodical way Co-sponsored by Congregation Beth Am and the Haverim Connection of avoiding chaos.” N for Jewish Singles Staff Writer Sue Dremann can be e-mailed at sdremann@paweek- ly.com. To purchase tickets, visit Corrections www.paloaltojcc.org/arts In the article “Same price, different house” in today’s Fall Real Estate or call (650) 223-8699. special section, the middle school for 421 Hamilton Ave. is the K-8 Belle Haven Elementary School, not Hillview Middle. To request a correction, contact Managing Edi- Oshman Family JCC tor Jocelyn Dong at 650-223-6514, 3921 Fabian Way | Palo Alto, CA | (650) 223-8699 [email protected] or P.O. Box 1610, Palo Alto, CA 94302. *>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 11 PulseA weekly compendium of vital statistics
Palo Alto Shoot at occupied dwelling ...... 1 Oct. 5-Oct. 8 Trespassing ...... 1 Violence related Warrant arrest...... 7 Battery ...... 1 Atherton Domestic violence ...... 1 Oct. 5-Oct. 11 Terrorist threats...... 1 Violence related Theft related Battery ...... 1 Checks forgery...... 1 Robbery ...... 1 Grand theft...... 4 Theft related Petty theft...... 3 Petty theft...... 3 Embezzlement ...... 1 Residential burglaries...... 1 Vehicle related Vehicle related Abandoned auto...... 1 Hit and run ...... 4 Auto recovery...... 1 Parking/driving violation ...... 5 Auto theft ...... 1 Suspicious vehicle ...... 11 Misc. traffic...... 3 Vehicle accident/minor injury ...... 2 Vehicle accident/major injury ...... 1 Vehicle code violation...... 2 Vehicle accident/minor injury ...... 4 Alcohol or drug related Vehicle accident/property damage.....2 Drunken driving...... 1 Vehicle tow ...... 2 Miscellaneous Alcohol or drug related Animal call...... 9 Drunk in public ...... 1 Attempt to contact ...... 1 Drunken driving...... 1 Be on the lookout...... 1 Possession of drugs...... 1 Construction...... 4 Miscellaneous Disturbance ...... 3 Found property...... 1 Fire call ...... 3 Lost property ...... 1 Found property...... 3 HAPPY 4 YEAR ANNIVERSARY TO Psychiatric hold ...... 2 Hang up ...... 5 Suspicious circumstances ...... 1 Hazard ...... 1 EQUINOX PALO ALTO Vandalism...... 1 Juvenile problem...... 3 Warrant/other agency...... 2 Medical aid...... 4 Meet citizen ...... 1 Menlo Park Outside assistance...... 4 JOIN “AMERICA’S HEALTHIEST GYM” FOR ONLY $4 INITIATION* Oct. 5-Oct. 11 Perimeter check ...... 4 Violence related Special detail ...... 1 Armed robbery...... 1 Suspicious circumstance ...... 3 Assault ...... 1 Suspicious person ...... 6 TUESDAY, OCTOBER 19 Battery ...... 1 Town ordinance violation ...... 4 Domestic violence ...... 1 Tree down...... 1 Theft related Vandalism...... 2 Commercial burglaries ...... 1 Warrant arrest...... 1 PLEASE CALL 650.319.1700 FOR MORE INFORMATION, 440 PORTAGE AVE. Fraud ...... 1 Water main break ...... 2 Grand theft...... 2 Petty theft...... 9 VIOLENT CRIMES Palo Alto 6:00pm-9:00pm Residential burglaries...... 7 WINE, APPETIZERS, CHAIR MASSAGE, AND MORE Vehicle related 400 block Emerson Street, 10/6, 10:30 6:00PM PUSH/PULL UP A-THON TO BENEFIT LPCH Hit and run ...... 2 a.m.; terrorist threats. 6:00PM-8:00PM KETTLEBELL AND VIPR DEMOS W/ EQUINOX TRAINERS Suspended license...... 1 400 block Cesano Court, 10/6, 8:20 p.m.; domestic violence/battery. 7:40PM-8:40PM Theft from auto...... 2 U-JAM FITNESS CLASS WITH SUZY C. Vehicle accident/minor injury ...... 1 Amarillo Avenue, 10/7, 6:29 p.m.; simple Vehicle accident/property damage.....6 battery. Vehicle tow ...... 1 Alcohol or drug related Menlo Park YOU AND YOUR FRIENDS CAN ENJOY COMPLIMENTARY ACCESS TO THE CLUB ALL DAY Drunken driving...... 1 1500 block San Antonio Street, 10/6, 5:17 Possession of drugs...... 1 p.m.; assault. SAVE 20% AT THE SPA AND 25% AT THE SHOP* Miscellaneous 1900 block Menalto Avenue, 10/9, 10:42 Disturbing phone calls ...... 1 p.m.; battery. Found property...... 2 10 block El Camino Real, 10/10, 1:10 a.m.; Gang validation...... 1 domestic disturbance. Info. case ...... 1 1100 block Carlton Avenue, 10/11, 11:30 Information ...... 2 p.m.; brandishing/attempt armed robbery. Located missing person...... 1 Lost property ...... 2 Atherton Missing person...... 1 Unit block Stevenson Lane, 10/8, 2:34 Noise ordinance violation ...... 1 p.m.; theft of purse. Probation arrest ...... 1 Unit block Nora Way, 10/10, 4:06 a.m.; Psychiatric hold ...... 1 sexual battery. *Health Magazine. Valid at Equinox palo alto on 10.19.10 only. Valid on select memberships. Certain restrictions apply. Shop discount not valid on Kiehl’s products. Resisting arrest...... 1
450 San Antonio Road FEF Gideon Hausner Palo Alto, CA 94306 LANDSCAPE SERVICES www.hausner.com Jewish Day School & MAINTENANCE Is your home ready for winter? Please Join Us For Our Open Houses Drainage Problems? RSVP Repair before the rain comes. Aileen Mitchner Call Today For Free Estimate Director of Admission – Residential & Commercial – 650.494.8200 x 104 – Full Landscape Services – [email protected] – Design & Construction – Middle School Lic. #835173 CAIS and WASC Accredited Kindergarten “Serving The Peninsula Since 1983” Sunday Confidential Scholarships Available Thursday October 31st November 18th (650) 465-4629 1:00 - 3:30 pm 7:00 - 8:30 pm www.FEFLandscapeServices.com
Page 12ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ of choice. HELLER IMMIGRATION LAW GROUP Employment-based, Family/Marriage & Investor Visas Laurel Hiatt A Full-Service Immigration Law Firm Laurel Ann Hiatt, 65, a longtime Serving the SF Bay Area & Silicon Valley for 25+ years resident of Menlo Park and Ather- PERM Labor Certifi cation N EB1/NIW Self-Petitions ton, died Sept. 18, Green Cards, H1B and Work Permits Born in southern California and Engineers, IT/Computer fi elds, Scientists/Researchers Transitions HR/Corporate, Business & Individual Clients raised in Los Altos, she received of Shore- her bachelor’s degree from Principia Free Attorney Consult! Deaths line Park in College in Illinois. She went on to 650.424.1900 N greencard1.com N [email protected] Mountain graduate from Stanford Business Victor Calvo View and School in 1967 as one of only two Former Assemblyman Victor while chair- women in the graduating class. 4(%/$/2% ! *%.+%, Calvo, 68, a resident of Mountain man of the That same year, she married 5.% #4/"%2 View, died Sept. 26. Assembly James A. Hiatt, who became known * / He was born in Mountain View Committee as a local real estate developer. She and graduated from Mountain on Resourc- worked for IBM, then dedicated Ted was raised in Burlingame and resided in Saratoga and View High School as valedictorian es, Land Use, her time to raising four daughters Lake Tahoe for more than fifty years. He had lived in Palo Alto in 1942, the same year that he vol- and Energy he led the defense of and being active in the local com- at Classic Residence by Hyatt since 2008. Brother of John unteered for the Army Air Corps. environmental quality laws in Cali- munity. Twenty years later, she re- During World War II, he served as a Jenkel of Sebastopol and father of Theodore III, John and Anne fornia. He authored legislation on established herself in the workforce combat pilot in the Army Air Force. coastal conservation, nuclear safety, as a financial planner. Jenkel; grandfather of Colin, Daniel, Amalie, Rosalie and Lillian. He attended Stanford University and farmland preservation, solar energy, As a lifelong Christian Scien- He was preceded in death by his wife of more than 50 years, graduated with a degree in political and clean water and air. tist, she served the First Church of science. He married Nellie Catherine Eileen. Ted was a member and supporter of the San Jose and His 32 years of public service to Quintero in 1948 and they had five Christ, Scientist, Menlo Park, in Saratoga Rotary Clubs, past president of the California Jeweler’s the state of California began in 1957 children: Suzanna, Victor, Peter, many capacities. She is survived by her four daugh- Association, and member of the Saratoga Men’s club. He when he was first appointed to the Theodore and Mary. enjoyed a wide circle of family and friends who will miss him Mountain View Planning Commis- He was a businessman and owned ters, Emily Vesely of Menlo Park, sion. He was twice elected to the and ran the De Anza Lumber Com- Chelsea Hiatt Farley of Pacifica, deeply. Private family services to be held. In lieu of flowers, Mountain View City Council and pany from 1959 to1985. He was an Mindy Castle of Martinez, Jamie donations may be made to The Leukemia and Lymphoma Society Hiatt of Donner Summit; three served three terms as mayor. He was avid golfer and played weekly at his www.rollerhapgoodtinney.com beloved Shoreline golf course. He grandchildren; her father Edgar a Santa Clara County Supervisor PAID OBITUARY from 1968 to 1974. In 1974 he was was also an avid bird watcher and Fuller; and half-sister Tracy Fuller, elected to the State Assembly, rep- nature enthusiast. of Palos Verdes. resenting the 21st District. He was He is survived by his wife Nellie; Donations in her honor may be appointed to the California Public their five children and spouses; and contributed to The Christian Science Utilities Commission and the Cali- 12 grandchildren. He will be dearly Peninsula Visiting Nurse Service fornia Coastal Commission. missed, loved ones said. A memorial (CSPVNS), P. O. Box 7141, Menlo Park 94026; First Church of Christ, *!.% "!6%,!3 He was a crusader for the preser- service will be held Mon., Oct.18, at vation of California’s forests, green- 1 p.m. at Rengstorff House, Shore- Scientist, 201 Ravenswood Ave., Jane Bavelas, a resident of Palo Alto for over half a century, died of belts, and wetlands and had the line Park, 3070 North Shoreline Menlo Park, 94025; or Bear Valley heart failure at Stanford Hospital on October 8, 2010. reputation of not giving in to lobby- Blvd., Mountain View. In lieu of Search & Rescue (or BVSAR), 477 ists, loved ones said. He was instru- flowers, the family is requesting Summit Blvd., PO Box 2083, Big Jane was born Catherine Jane Lawson in Michigan in 1917, attended mental in the funding and creation that donations be sent to a charity Bear Lake, CA 92315. Vassar College. She worked for a time at the Highlander Folk School in Tennessee, then moved to New York and worked in the publishing business on the east coast where she did manuscript reading for Book 5$'% 4!.,%9 /33 6!.3 of the Month Club, wrote copy for Publisher’s Weekly, and did script * 3 2 % reading for Universal Pictures and Twentieth Century Studios, eventually Judge Stanley Ross law practice with the law firm Moerdyke, Anderson, becoming a fiction editor for Knopf. Evans, who served Evans & Rhodes from 1950 through 1961. He served on Jane began her career at Knopf as a telephone operator, rising to more than 22 years on the Palo Alto Planning Commission and City Council. the role of fiction editor at a time when women did not generally hold the Santa Clara County Evans served as Superior Court Judge for 22 years, those positions. One book Jane rejected was George Orwell’s “Animal Superior Court, passed retiring in 1984. Following retirement, he was active as Farm.” She was in good company; TS Eliot also rejected the novel. She away September 29, an arbitrator and mediator, and was appointed to serve 2010 at the age of 90 as justice pro tem on the Sixth District Court of Appeal redeemed herself in 1951, after she moved to Little, Brown and Co. where in Menlo Park from in San Jose. she edited “The Catcher in the Rye.” While Jane championed this book, complications of Throughout his life, Evans played violin and viola she never met its perennially reclusive author, J.D. Salinger. She did Alzheimer’s. in local symphony orchestras, the Manzanita Quartet, however, keep up a long-term friendship and correspondence with author Evans was born in Pittsfield, MA, the second son of and other chamber music groups. He served on the Jessica Mitford. Clarence and Louise Murchison Evans. He was raised boards of The Fortnightly Club and the Music Guild at In 1955, she married Alex Bavelas, and they moved to Palo Alto where in Evanston, IL, and studied violin and viola with the Stanford. Colleagues, friends, and family enjoyed his he took a position in the Stanford psychology department and she worked intention of joining the Chicago Symphony Orchestra, generous spirit and warm sense of humor that sparkled as an assistant for Dr. Paul Ehrlich in the population biology department. where his father was principal violist for many years. with wit. Jane remained at Stanford when she and Alex divorced in 1969 and During WWII, he joined the Marines, serving as First After retiring, Evans enjoyed playing golf and tennis, continued to work in the biology department until her retirement in 1982. Lieutenant aboard the USS Kenton, an attack transport and he and Betty traveled to Europe and Elderhostels, She assisted in the creation of the community health manual “Where ship in the South Pacific that was attacked by Japanese among other destinations. Evans was a Charter member There is No Doctor” for the Hesperian Foundation. After retirement, she Banzai planes in the battle at Okinawa. When the war and officer of the University Club of Palo Alto, where his was active in Avenidas, the non-profit senior assistance community, and ended, he decided to go to law school, and studied at two daughters swam and played tennis. she was an enthusiastic and talented supporter of Gallery House, the Palo Harvard Law School on the G.I. bill, earning his J.D. in He is survived by his wife of 66 years, Betty; by his 1948. daughters Elizabeth Evans Levy (Robert) of Soquel, Alto arts co-op. She managed the gallery and worked on their behalf for Evans met his college sweetheart Betty Stober at and Nancy Evans Devine (Bill) of Palo Alto; and by his over thirty years, with a wonderful knack for engaging the public over the Northwestern University, where they both attended. grandchildren David Ross Levy and Amanda Evans artwork with a gracious but direct manner. They were married in Quantico, VA, before his Devine. He will be deeply missed by all who knew him. Jane is survived by a daughter of Sunnyvale, Cate Nelson and assignment overseas. After graduating from Harvard At his request, no services are planned. Donations an older sister, Carol Booth of Birmingham, Michigan. A memorial Law School the couple moved to Palo Alto, CA, and may be made in his memory to the San Francisco service is planned for October 16 at the Unitarian Universalist Church resided in Palo Alto ever since. He engaged in private Symphony and Save the Redwoods League. of Palo Alto. Donations may be made in Jane’s memory to Avenidas,
450 Bryant St., Palo Alto 94301. PAID OBITUARY PAID OBITUARY
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 13 Editorial Measure R deserves overwhelming defeat Amending the Palo Alto City Charter to build a budget wall around any department is wrong-headed and would hurt other city services and programs SpectrumEditorials, letters and opinions hen the Palo Alto firefighters union began circulating peti- tions to place a protectionist measure on the Nov. 2 election Train vs. education 2008, 92.4 percent of those students tography, audio and video produc- W ballot last spring, we called it a terrible idea. It still is. Editor, graduated. The dropout rate was 4.9 tion, animation and Web design. The union leadership claims Measure R is a simple matter of Economist Robert Gordon of percent (compared to the 38 percent The Woodside staff is very fo- assuring that a basic level of public safety is maintained in the Northwestern University points out dropout rate implied in the film). cused on qualifying students for face of tight city budgets, and says it “gives residents a voice” in in the Oct. 10 issue of Business Week The other 3 percent of students ei- admittance to college. The school such decisions. It would require a citywide vote on any proposal to that between 2005 and 2027 the U.S. ther moved out of the area, changed hosts “College Day” in October reduce staffing or close a fire station. gross domestic product will grow at schools or were reassigned to special with special events for each grade Opponents, which include every member of the City Council the slowest pace of any 20-year pe- programs. The film should have used level. It holds several “March into and a wide array of community leaders, frame it as a “power grab” riod in U.S. history, going back to just the graduation rate and drop-out College” workshops for parents and by the union that would violate the principles of representative George Washington’s presidency. data, but that would have inconve- students to learn together about col- democracy and place one city department on a protectionist island, He attributes that to a stalling of niently disproved its thesis. lege choices, the application process immune from budget-balancing by elected officials. productivity driven by stalled in- As for tracking, the film is flat- and financial aid. It also has an While we have nothing but respect for the work of our crease in education levels. out wrong. Woodside does not track. AVID program that prepares first- firefighters, they have regrettably been led down a self-destructive It seems that California, already Students are given opportunities to generation college students, or those path by their union leadership. And the campaign being waged by near the bottom in education nation- advance in subjects if teachers and students in the academic middle, for the union — attempting to scare Palo Alto residents and make them wide, is destined to accelerate that students think they will succeed. college. “Waiting for Superman” sug- “Waiting for Superman” paints an believe that there is a secret plan to close fire stations and lay off trend as we balance our budget by gests that Woodside is “living in inaccurate picture and has regretta- firefighters — is insulting and disingenuous. further reducing our education ex- penditures — while claiming to lead the past.” This could not be more bly tarnished the school’s reputation. Firefighters are already protected through their labor contract wrong. Woodside is not only keep- Again, had the filmmakers actually with required minimum staffing, a mistake made by a past council the nation by spending one tenth of $1 trillion to build a shiny, whizzy, ing up with the world around it but is visited the school, this mischarac- when the city was flush (and which we hope will be eliminated in high-speed train toy. an innovative leader, offering many terization would never have hap- future contracts). Unlike with other unions, both in Palo Alto and Don Barnby great programs that are essential in pened. Unfortunately, there is no other cities, the Palo Alto firefighters have chosen to fight against Spruce Avenue today’s world. These include an ex- way for those of us who know the any budget, wage and benefit reductions. Their union is completely Menlo Park tensive offering of advanced-place- truth about Woodside to reach every out of touch with today’s economic environment and the dawning of ment courses, robotics and engineer- person who sees the film. We ap- a new age in compensation and benefits for government employees. ‘Waiting for Superman’ ing classes, environmental (green) preciate this opportunity to shine a But more importantly, the firefighters have the same rights as Editor, education classes, and a Mandarin- light on a wonderful school and set any other citizen to referend any council decision and place it on We had an opportunity to see language program. the record straight. the ballot. If a future council, after input from citizens, decides to “Waiting for Superman” recently. In addition, Woodside is about Sarah Blatner, Donna Habeeb reduce the fire department budget, the union has demonstrated it This powerful documentary presents to break ground on a state-of-the- Woodside High parents can generate the signatures needed to place it on the ballot. many of the problems in our educa- art digital- and media-arts building Measure R inappropriately preempts that process by creating an tion system, suggestions to fix it and where students will learn about pho- (continued on page 16) automatic referendum, incurring both great expense and delay. some success stories. No one is currently advocating that any Palo Alto fire station Unfortunately, the information be closed or that the number of firefighters be reduced, but those presented about Woodside High YOUR TURN options should be on the table for debate if studies now underway School in Redwood City, left an im- show that we can deploy our firefighters more efficiently. pression that Woodside does not do The Palo Alto Weekly encourages comments on our coverage or on The firefighters union is looking for special treatment that puts a good job educating its students — issues of local interest. the police, public works and other city departments with public- when in fact it is an outstanding high safety responsibilities at greater risk of cuts. school where students receive a top What do you think? Are you concerned about Palo Alto schools sur- Measure R is bad policy and a cynical and self-serving attempt notch education. passing 12,000 total enrollment? The filmmakers were offered an by the firefighters union to insulate and protect itself from economic Submit letters to the editor of up to 250 words to [email protected]. realities. We urge a NO vote on Measure R. opportunity to learn more about Include your name, address and daytime phone number so we can reach you. Woodside, but regretfully, they de- We reserve the right to edit contributions for length, objectionable content, libel clined. Had they visited Woodside and factual errors known to us. Anonymous letters will generally not be ac- and talked with staff, students, ad- cepted. Yes on S for election savings ministrators or parents, they likely You can also participate in our popular interactive online forum, Town would have avoided some of the mis- Square, at our community website at www.PaloAltoOnline.com. Read easure S would amend the Palo Alto City Charter to move City blogs, discuss issues, ask questions or express opinions with you neighbors any Council elections from the traditional odd-year time to even characterizations and misrepresenta- time, day or night. years, lining up with state and national elections. tions in the film. Submitting a letter to the editor or guest opinion constitutes a granting of per- M The information presented in the Former Councilwoman and Mayor Liz Kniss, now on the Santa mission to the Palo Alto Weekly and Embarcadero Publishing Co. to also publish Clara County Board of Supervisors, raised the issue last summer as film about graduation rates and col- it online, including in our online archives and as a post on Town Square. lege acceptances is very misleading. a cost-saving efficiency move, and the council majority subsequently For more information contact Editor Jay Thorwaldson or Online Editor Tyler Those statistics came from a UCLA endorsed the change and placed it on the Nov. 2 ballot. Kniss Hanley at [email protected] or 650-326-8210. study that uses data that tracks stu- initially estimated the city could save up to $200,000 per election dents from 9th to 12th grades. The by consolidating the local vote with state or national elections. That study does not take into account the figure may be high, depending on other local ballot measures that number of incoming freshmen who can’t wait for the next general election. But even at half that it would are enrolled at Woodside and decide be a big contribution to a cash-stretched community: $1 million over to attend a private or charter school, 10 years fills a lot of potholes or saves many city services. or move out of the area, without no- Supporters also cite statistics indicating that up to twice as many tifying the school before the school people vote in general elections. year begins. Nor does the study in- But there’s a cost, opponents such as Councilman Greg Schmid clude the number of students who contend. Keeping local votes in odd years, Schmid argues, is move out of the area during their not only a century-old Palo Alto tradition but allows candidates, high-school years. supporters, the media and voters to focus on local issues and Even more inaccurate, the study candidates without the distractions of state or national campaigns. only includes the seniors who go on He believes the higher-turnout estimates are exaggerated. to attend California colleges, and While we agree that the current odd-year schedule focuses leaves out the 10 to 20 percent who more attention on the local races, we believe the higher turnout choose to attend private universities, and cost-savings of switching more than offsets this benefit. Other vocational schools and out-of-state communities, such as Menlo Park and Mountain View, are on an public universities and community even-year schedule, and Palo Alto should join them. colleges. In fact, looking at Woodside’s We recommend a YES vote on Measure S. entering freshmen class of 2004 through the graduating class of Page 14ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Check out Town Square! Hundreds of local topics are being discussed by local residents on Town Square, a reader forum sponsored by the Weekly on our com- munity website at www.PaloAltoOnline.com. Post your own comments, ask questions, read the Editor’s blog or just stay up on what people are talking about around town!
Editorial A mixed bag of state propositions Array of proposals confront voters with good choices and special-interest scams, some undoing important programs for California’s future
ollowing is the Weekly’s analysis of of legalization, including tax-revenue the purview of the Citizens Redistricting projects. major state propositions, with recom- generation. Commission, as well. F mendations. Proposition 27, meanwhile, is a In its farcical triage of annual budget Proposition 20: Yes proposal to throw out the Citizens balancing decisions, California often Proposition 19: Yes Removes elected representatives from Redistricting Commission altogether shifts funds away from their intended Legalizes marijuana under establishment of congressional districts and stick with the old ways for both the local targets to help pay for things the California but not federal law. and gives that authority to a bipartisan state Legislature and U.S. congressional state deems more pressing. For instance, 14-member redistricting commission. districting. cities’ transportation and redevelopment- Proposition 19 would legalize the It’s no brilliant political insight to project funds have been unilaterally possession and transport of an ounce Proposition 27: No suggest that it’s probably not the best idea raided during fiscal crises to help meet of marijuana, as well as the cultivation Eliminates 14-member state to have legislators influencing their own other state budget needs. Proposition 22, of cannabis on up to 25 square feet per redistricting commission and returns district’s boundaries — or those of their among other things, would eliminate the private residence. Local governments redistricting authority to elected fellow party members. state’s ability to use fuel-tax revenue for would have the option to regulate any representatives. non-transportation purposes, and prohibit related commercial sales and, as with Proposition 21: Yes the state from borrowing local property- any business, those activities would be Propositions 20 and 27 are about how Establishes $18 annual vehicle- tax funds to pay for schools. While we subject to applicable sales and other state and federal legislative districts license fee to help fund state parks and don’t like the trend toward protecting an taxes and fees. According to the FBI, ever-growing list of services from cuts 60 percent of drug cartel revenue comes in California should be drawn up — wildlife programs. by a bipartisan independent panel through ballot initiatives, we also object from illegal marijuana sales in the United to the Legislature seizing local funds or by incumbent politicians? Voting California’s state parks are the frequent States. And in 2008, more than 61,000 instead of legitimately balancing the state districts are redrawn after every 10- target of funding cuts — and last year Californians were arrested for possession budget through tax increases or reduced of less than an ounce of pot. Combine year census. In 2008, California voters park-goers felt it in a big way: as 150 of expenses. the law-enforcement time-and-money passed Proposition 11, which took the our 246 state-operated parks suffered savings with the Board of Equalization’s redistricting of the state Assembly, deep reductions in services and hours of Proposition 23: No, No, No! estimated $1.4 billion in tax revenue for Senate and Board of Equalization out of operation. This $18 vehicle-registration Suspends air-pollution-control law the state, and it’s clear from a crime- the hands of the Legislature and gave it “surcharge” would create about $500 AB 32 until unemployment drops to 5.5 and-money standpoint that Proposition to a 14-member Citizens Redistricting million in revenue for the parks. Of that percent for a full year. 19 makes sense, economically and Commission to be established once amount, 85 percent would go to park morally. Criticism that the measure is every 10 years with five Democrats, five operations and most of the rest toward What do the companies Valero Energy, not well-crafted are valid, but it allows Republicans and four others to redraw wildlife protection programs. In return, Occidental Petroleum, Tesoro Corp., for amendment by the Legislature to the districts based on the latest census — all registered vehicles would receive free Tower Energy Group and World Oil address any issues that arise. And while while keeping the integrity of geographic daytime parking at all state parks. Corporation all have in common? recent passage of a law making marijuana boundaries and respecting city, county They’re all big oil companies based in possession a mere infraction (like a traffic and neighborhood limits. Proposition 22: Yes Texas. ticket) in California accomplishes the But Proposition 11 didn’t affect the Prohibits the state from diverting decriminalization part of Proposition lines of congressional districts — and funds intended for transportation, 19, it doesn’t achieve the full effects Proposition 20 seeks to bring those under redevelopment or local government (continued on page 16) Streetwise What is the best decision you ever made? Asked on California Ave in Palo Alto. Interviews by Sally Schilling Photographs by Vivian Wong.
Hollis Radin Tom Kehl Gary Funck Vicki Rather Billy Collins Massage Therapist Director of Analytics Software Industry Employee Accountant Retiree College Terrace, Palo Alto Midtown, Palo Alto Midtown, Palo Alto Crescent Park, Palo Alto California Avenue, Palo Alto “My decision to move to Palo Alto over “Going to business school at Carnegie “To marry my wife.” “To have kids, I guess.” “To not get married.” 30 years ago.” Mellon.”
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 15 that the deal should never have toxic-waste sites and promote Editorial taken place to begin with and pollution prevention. (continued from page 15) that by repealing the legislation Chevron, Exxon Mobil and And they’ve all donated more $1.3 billion would go back into Phillip Morris are all big donors Peninsula School than $100,000 to put California’s the state’s general fund (and to Proposition 26. They and /VSTFSZUISPVHIUI(SBEFr1SPHSFTTJWF&EVDBUJPO4JODF Proposition 23 on the ballot. under Proposition 98 guidelines, other heavy polluters would save The oil companies are calling a significant part of that would a lot of money if it passes. The it the “California jobs initiative,” go toward education). Legislative Analyst estimates but Proposition 23 should more Opponents of a repeal of the that over years it would result in We believe education can accurately be called the “Kill tax breaks say there would be the loss of billions of dollars to AB 32 initiative” — suspension significant job losses if multi- California taxpayers who would be engaging and joyous. of that 2006 legislation until state businesses went back to then be footing the bill to clean state unemployment drops to 8ZaZWgVi^c\VgihVcYVXVYZb^Xh being taxed according to payroll up the polluters’ messes. a very low 5.5 percent would (meaning there would be an Ldg`^c\id\Zi]ZgidXjai^kViZXjg^dh^inVcY^bV\^cVi^dc likely keep the global-warming incentive not to have a lot of Proposition 27: No Higdc\Xdbbjc^inWj^aY^c\ bill in limbo for years, if not employees in California). (See write-up above under decades, or forever. AB 32, the Proposition 24 will Proposition 20.) N ;dXjh^c\dci]ZegdXZhhd[aZVgc^c\ “California Global Warming meaningfully affect, according AdlhijYZciiZVX]ZggVi^d!hbVaaXaVhhh^oZ Solutions Act of 2006,” was to supporters, less than 2 enacted four years ago and percent of the wealthiest multi- Letters (continued from page 14) established the target of reducing state corporations operating in Open House — Nursery, Kindergarten, First Grade the state’s greenhouse-gas California. It doesn’t call for No on 23 Saturday, November 6, 10-11:30 a.m. Children welcome. emissions to 1990 levels by new or higher taxes on these Editor, 2020, through stiffer rules A structural transformation of School Tours companies; it calls for a repeal and regulations for the energy of so-called “loopholes” that the local and California economy is Oct. 14, Nov. 4, Jan. 6 & 13 beginning at 10:00 a.m. industry. California is one of the haven’t even fully gone into well underway, fueled by our long Dec. 2 & 9 beginning at 9:00 a.m. Parents only please. largest emitters of greenhouse effect. history of clean-tech and clean-en- registration not required gases in the world, and AB 32 is ergy innovation. estimated to reduce our GHG in Meanwhile, Texas oil companies For an appointment, please call (650) 325-1584, ext. 5. Proposition 25: Yes are spending millions in support of 920 Peninsula Way, Menlo Park, CA | 650.325.1584 | www.peninsulaschool.org the next decade by 30 percent. Changes legislative vote That Valero Energy, the Proposition 23 to repeal Califor- requirement to pass budget niaís landmark clean-energy and initiative’s biggest funder, has and budget-related legislation clean-air laws that have fostered one of the worst environmental from two-thirds to a simple that job-creating innovation. Big oil records in the state should come majority. companies want to kill competition as no surprise. Cleaning up its and jobs from clean-energy busi- act by 2020 will not be easy on Only Arkansas, Rhode Island nesses, thus increasing air pollution the bottom line. Proponents of and California ask for a two- and threatening public health. Proposition 23 argue that such thirds vote by state legislatures Proposition 23 is deceptive. It regulations as those called for by to pass budgets. All other 47 claims to “suspend” clean-energy Photo: Marc Silber Photo: Marc AB 32 would drive industry out states require simple majorities. and clean-air laws, when, in fact, of the state — resulting in lost Currently a two-thirds vote is the conditions it requires to reinstate jobs. Opponents counter that the needed to pass the state budget, these laws have only occurred three evidence suggests the opposite: and to raise taxes. Proposition times in the last 40 years. Instead 920 Peninsula Way, Menlo Park, CA | 650.325.1584 | www.peninsulaschool.org that not only is the job loss 25 would change the budget- of funding the clean up of the Gulf exaggerated but the gain in green approval requirement to 50 Oil Spill, Texas oil companies are jobs would more than make up percent plus one; it would not opening their corporate coffers to Abilities United the difference. change the two-thirds needed kill clean energy and clean air stan- dards in California so they can keep To us, such a negligible short- to raise taxes. A two-thirds vote term move could have disastrous on polluting. is an arbitrary number to weigh A recent study at the University long-term consequences to so heavily on the workings of California’s environment and the of California, Berkeley, on the eco- aquathon any state. Why not 57 percent? nomic impacts of Californiaís cur- $136,000 raised in 2010 health of its citizens — as well Why not 61 percent? It tends rent climate laws, indicates Califor- as its economic future in green to be high enough to make niaís gross domestic product will go thank you for your participation! technology, a particular interest sure small minorities can keep up slightly with our current laws in of Silicon Valley. practically anything from getting place, but will drop significantly if 2010 corporate teams 2010 community teams done. There’s an argument that a Proposition 23 passes due to rising Alza Alumni Abilities United teams Proposition 24: Yes simple majority gives too much expenses from fossil fuels, environ- E Design C Alpha Repeals recent legislation power to the political party mental and health costs. Genentech Amber’s Hope that would allow businesses to in the majority — perhaps 55 Proposition 23 would take us in Intel Aqua Sunshine lower their tax liability. percent is a better number that the wrong direction. Intuit Big Mike would require an inkling of We can choose how we navigate Northrop Grumman Castilleja The Tax Fairness Act, as it’s bipartisan support. Maybe. What this already overdue economic tran- NVIDIA Jack’s Divers called by its supporters, is a we do know is that anything sition to maintain our leadership in a healthy, clean-energy, clean-tech Oracle Logan YMCA response to a deal cut during the lower than two-thirds would be 2008-09 budget impasse in order an improvement at this point. world. San Mateo Masters Nine Stars Vote No on Proposition 23. And Sue Nommi’s Teams Orca to win enough Republican votes to pass a state budget. The deal rally your friends and neighbors to SRI International Porpoises with Purpose Proposition 26: No did three things: It increased the do so, too. Go to Town Square at UCSC Tachyons Requires certain state Priya’s Rhymers flexibility with which companies www.PaloAltoOnline.com/square Webcor Prouty Porpoises and local regulatory fees be for more details and related conver- can use net-operating losses approved by two-thirds vote. Ruhi’s Crew to reduce taxes; it allowed sation. Lisa Van Dusen St. Frances HIgh School for multi-state businesses to Team Bevo/ Cole’s Crew Proposition 26 looks to further Greenwood Avenue determine their California taxes the two-thirds-approval concept Team Claire Palo Alto based solely on sales in the state by requiring 66.6 percent of the Team Galvez (previously, sales, payroll and Legislature or local voters give The Graduates Don’t vote property value were all factors); a thumbs up before the certain Editor, Tracey’s Tigers & Penguins and it allowed unitary groups to regulatory fees can be exacted to Turbow Turtles Since the outcomes of elections transfer tax credits amongst the make up for the social costs of for state Senate, state Legislature separate businesses within the their businesses. Currently, these and U.S Congress have already group. types of fees are not considered been decided by the primary elec- Essentially, all three revenue-generating taxes (and tions due to gerrymandering of dis- provisions result in lower taxes therefore are not subject to two- tricts, there is no point in voting for for large companies operating thirds voter approval) because these offices. corporate sponsors: media sponsors: in the state — all to the tune, they’re seen as an offset to the I will not be casting a vote for Intuit according to the Legislative societal cost of a company — these and I urge you to do likewise. Webcor Builders Analyst, of $1.3 billion a Raymond R. White EDesignC think of hazardous-materials MarketRiders year when the new rules are Whitney Drive Milk Pail Market fees being levied on a power Montreux Equity Partners fully implemented in 2012. company, with that money being Mountain View Mulcahy Family Dentistry SRI International Proposition 24 proponents argue used by the state to clean up Page 16ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Cover Story
Blowing smoke? Firefighters claim Measure R would protect residents; critics call measure a union ‘power grab’
by Gennady Sheyner
riends and foes of Measure R have the same message for the F voters of Palo Alto: If you vote for the other side, you are placing your family’s life in danger. The city’s firefighters union, which gathered more than 6,000 signatures to get the initiative on the Nov. 2 ballot, claims the mea- sure would protect citizens from impulsive decisions by uninformed politicians to close fire stations and reduce staffing levels in the Fire De- partment. Opponents, led by a coali- tion called “Safe Palo Alto,” counter that the measure will unfairly pro- tect firefighters while forcing police officers, utility workers and other Palo Alto employees to face steeper cuts to their departments. The two sides have a few other things common. Each says it wants to protect democracy from special interests — either the union or “politicians,” depending on who is talking. Each also says it wishes Measure R had never made it onto the ballot, though the firefighters claim their hand was forced by a City Council intent on shrinking an already understaffed department. If voters approve Measure R, the City Charter would be revised to se- verely restrict the council’s ability to close fire stations and eliminate Fire Department jobs. The measure Jay Thorwaldson, Palo Alto Weekly editor and moderator of a debate Oct. 6 on Measure R, introduces the panel (from left), John Barton, Dena would embed the current depart- Mossar, Tony Spitaleri and Alan C. Davis. ment staffing levels in the charter and require the council to hold two basis,” Spitaleri told an audience at get to your house during an emer- Weekly. “They don’t even acknowl- bedfellows as developer Chop public hearings and a citywide elec- an Oct. 6 debate at the Palo Alto gency? edge that anyone else in the city is a Keenan and land-use watchdog Bob tion before it could cut even a single Art Center. “We believe the citi- Opponents of Measure R say the member of the public-safety team. Moss. Every member of the current firefighter. zens should have a voice in any ac- proposal is a brazen “power grab” “They don’t even acknowledge council endorses the Safe Palo Alto Tony Spitaleri, president of the tion that would place them and their by the firefighters union. Members that the police are present.” campaign, which has raised $58,000 Palo Alto Professional Firefighters, loved ones in danger.” of Safe Palo Alto claim the initia- Mossar’s group includes former as of Sept. 30. 1319, says the measure is designed The union’s attorney, Alan Davis, tive would give the union powers mayors Bern Beecham, Vic Ojakian, The council has been sounding to protect residents from hasty and stoked the rhetorical flames fur- over other labor groups, most nota- Lanie Wheeler, Judy Kleinberg and alarms since spring about the nega- dangerous council decisions, which ther when he asked the audience to bly the police, and wrest control of Liz Kniss and a wide assortment of tive ramifications of Measure R. In he claims are just around the cor- imagine a fire station in their neigh- city budget from the council. It’s no civic activists, local commissioners April, the council approved a col- ner. borhood facing a “brownout” — as coincidence that the campaign ad- and former council members. Vice leagues’ memo calling the measure “The city manager and members temporary station closures are often opted “Too Risky for Palo Alto” as Mayor Sid Espinosa and Council- “bad government” and a “waste of of the City Council are looking for called. Would you be willing, Davis its official slogan. man Larry Klein are both on the money” at a time when the council ways to reduce resources and possi- asked the audience, to wait longer “They talk about public safety,” group’s campaign committee — a bly close fire stations on a rotational for a fire engine or a paramedic to former Mayor Dena Mossar told the group that includes such unlikely (continued on next page)
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 17 Cover Story
Measure R or all the talk of looming (continued from previous page) brownouts and democracy F under assault, it is easy to see the battle over Measure R as some- is wrestling with lagging revenues thing else — the latest skirmish in and consecutive budget deficits. the chronic power struggle between The City Clerk had estimated that a cash-strapped city and its most mounting the special election in No- obstinate union. vember for Measure R would cost Spitaleri, a retired fire captain the city about $213,000. who currently serves on the Sunny- “This is putting a hole in the ca- vale City Council, is a seasoned noe while we’re bailing water,” said veteran in this political struggle. Councilwoman Karen Holman, one He last squared off with Mos- of the authors of the April memo. sar and Barton in 2007, when both were on the City Council. In June of that year, the council passed a city budget that restricted staffing ‘We believe the citizens of the Foothills Park fire station to high-risk fire days. In late June, a should have a voice in fire near Junipero Serra Boulevard scorched about 170 acres, stoking any action that would a wave of protests from residents about the reduced hours at Station place them and their 8. A week later, another fire burned 20 acres of grasslands. loved ones in danger.’ On July 8, 2007, Spitaleri joined foothills residents in calling for — Tony Spitaleri, the council to keep Station 8 open president of the Palo Alto throughout the summer, as before. Professional Firefighters, 1319 The station, staffed by firefighters working overtime, poses an annual conundrum for the council. At the time, former City Manager Frank Benest and the council were trying Former councilman John Barton, to find a cheaper way to staff the Dena Mossar, former Palo Alto mayor, along with John Barton, left, urges a “no” vote on Measure R, which a member of Mossar’s coalition, station but couldn’t persuade the would force the city to take any fire department staffing changes to a public vote. said at the Art Center debate that union to renegotiate the relevant the firefighters’ proposal would staffing provisions in its contract. the 109-member union over a new The subject of staffing levels is slashing staffing. He pointed to a make the council’s budget duties Spitaleri declined to discuss staffing contract (the previous contract ex- the most explosive topic in the cur- similar study the city was conduct- even harder than they already are. and asked the council to “not blame pired on June 30). rent negotiations. Spitaleri told the ing earlier this year to measure the The Measure R debate isn’t about the union on everything that’s go- Keene and the council have indi- Weekly the union has repeatedly effectiveness of current staffing lev- public safety, Barton said, but about ing on.” cated publicly they hope to use the offered concessions that would save els. In April, the council’s Finance proper governance. “The issue here is public safety,” current negotiation period as an op- the city more than $1 million while Committee was receiving a status Palo Alto is “not a direct democ- Spitaleri told the council in July portunity to decrease firefighters’ maintaining current staffing levels. report on that study, conducted by racy,” Barton reminded the audi- 2007. “All we do every year is bring compensation as has been done in The city refused to accept these the firm Emergency Services Con- ence. Staffing decisions should be to you our concerns of potential other departments. terms, he said. sulting International (ESCI), when left to the leaders whom the citizens danger.” Earlier this year, when Palo Alto council members were startled to elect to make decisions. Otherwise, The following week, after hearing was facing a projected $6.3 million learn that the consultant managing he said, residents end up with a dys- from the foothills constituency, a re- deficit in its general fund, city of- the study had never recommended a functional system in which the bud- luctant council reversed course and ficials asked the city’s labor groups ‘They talk about pub- staffing reduction. get is chronically late — sort of like voted to keep Station 8 open all sum- to share the budget pain. Palo Alto’s “I’m not sure we’re getting the California’s. mer. The station has been reopened largest police union, the 83-member kind of study that we all thought “If we want to switch to a direct every summer since. It continues to Palo Alto Police Officers Associa- lic safety. ... They don’t we were,” said Councilman Greg democracy and have citizens vote on be funded through overtime. tion, agreed to defer its negotiated Scharff, capturing the council sen- every aspect of the budget, let’s have The touchy topic of Fire Depart- raises for the second straight year. even acknowledge that timent. that conversation,” Barton said. ment staffing simmered in the back- The Service Employees Interna- The committee quickly ditched ground until this spring, when the tional Union, Local 521, which the police are present.’ the study and commissioned a new city kicked off its negotiations with represents more than half of all one, which is now being jointly con- city workers, grudgingly accepted — Dena Mossar, ducted by the International City/ reduced benefits, including a two- former Palo Alto mayor County Management Association tiered pension system with less (ICMA) and the Virginia-based firm generous pension benefits for new TriData. Assistant City Manager Pa- employees. Management workers mela Antil said the study examines followed suit. The union contract includes a data from the fire-dispatch unit and The fire union, for the second “minimum staffing” provision that re- considers ways to reduce the Fire consecutive year, refused to cave in quires the city to have at least 29 fire- Department’s overtime hours. The (in 2009, its reluctance to take cuts fighters on duty at every shift. Keene report is scheduled to be completed prompted former Vice Mayor Jack has told the Weekly the requirement in late November. Morton to accuse the department of precludes the city from even discuss- Council members say the study is “giving the city the finger”). This ing alternative ways to staff the de- an important and overdue analysis year’s budget, which the council ap- partment. The city wants to revisit of department operations and mar- proved in late June, raises the Fire the provision, while the union hopes vel at the firefighter union’s opposi- Department budget by $1 million, to preserve status quo. Spitaleri said tion to the pending report. largely because of previously ne- the “minimum staffing” provision is “It seems to me, if things are as gotiated increases in salaries and needed to protect citizens. they describe, they should welcome benefits. the report that would verify what According to city data, an average he union has another reason they’re saying,” Klein said. firefighters union member receives to feel anxious about depart- Spitaleri, for his part, points to a salary of $104,878, along with T ment staffing. Palo Alto is the aborted Emergency Services $16,001 in overtime. When benefits now completing a study aimed at Consulting International report and are factored in, the average annual evaluating the Fire Department’s to a recent study completed by the compensation is $178,387. resources and recommending ways National Institute of Standards and Firefighters counter that, unlike it can operate more efficiently. The Technology, which recommends other workers, they bring in major study has been on the city’s agenda four-person firefighter crews as the revenues. In the current fiscal year, since 2003, when the City Auditor’s most effective response forces for which ends June 30, 2011, the de- Office first recommended it, and is low-hazard fire operations (in Palo Tony Spitaleri, president of the Palo Alto Professional Firefighters, partment is projected to contribute due to be completed later this fall. Alto, three-person crews are the 1319, supports Measure R, saying it is designed to protect residents from about $11 million in revenues (com- Spitaleri claims the council wants hasty and dangerous council decisions. pared to $26.2 in expenditures). to use this study as a pretext for (continued on page 20)
Page 18ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Cover Story
Democratic forces clash over Measure S Palo Alto officials split over proposal to shift elections from odd to even years
by Gennady Sheyner
alo Alto officials received a local elections from odd to even Kniss, argue that the measure would told the Weekly. A switch to even welcome reminder last month years. If voters approve Measure S, bring two major benefits to the city. years would greatly favor incum- P that democracy is alive and each member of the current council First, it would significantly bring bents by making it difficult for new well within city borders. would get a one-year term extension down the costs of local elections by candidates for local offices to catch The City Council was holding a and local elections would take their consolidating them with other elec- the citizenry’s attention, he said. As special meeting Sept. 21 to select place alongside county, state and na- tions. Kniss estimated the change a result, there would be fewer can- a recruiting firm that would help tional elections. would save Palo Alto about $1 mil- didates running for local offices, he the city find a replacement for out- Proponents of Measure S, led by lion over 10 years. said. going City Attorney Gary Baum. former Palo Alto mayor and current More importantly, the switch to “Here we are in the midst of Council members were interview- Santa Clara County Supervisor Liz even years would promote local de- Silicon Valley, in the midst on an ing Bob Murray, whose firm Bob mocracy by significantly boosting engaged social-network world, and Murray & Associates recruited “Most of the county voter turnout, Measure S backers we’re telling people we don’t want Baum and City Manager James claim. At a recent interview with them to vote every year,” Schmid Keene. Councilwoman Nancy is already there. Out of the Weekly, Kniss and Councilman said. “It’s the wrong direction to go, Shepherd asked, “What did you Greg Scharff both pointed to voter- especially for a community that’s find the most challenging aspect 2 million people in the turnout statistics that showed par- Veronica Weber so engaged and for a council that of hiring in Palo Alto, and how do ticipation soaring in even years and should be sensitive to those engage- you think this will play out with floundering in odd years. In 2008, ments.” finding an attorney for us?” county, only 200,000 for example, 89 percent of Palo Al- Councilman Larry Klein raised Without skipping a beat, Murray tans hit the polls, compared to only a similar issue during the Aug. told the council over the speaker- are left voting in odd- 40 percent in 2007. The average 2 council meeting. Having local phone that Palo Alto’s “unique dy- turnout in the past four even-year Palo Alto Councilman Greg elections in an odd year enables namic” is that people in the city tend year elections.” elections has been 71.25 percent, Schmid opposes Measure S, argu- citizens to “have a community to participate in local government compared to 43.2 percent during ing that odd-year elections allow discussion about where they want far more than elsewhere. —Liz Kniss, Santa Clara odd years. residents to focus exclusively on the city to go” and to choose their “The whole issue of how people County supervisor As an example of the disparity, local issues. council candidates accordingly, are engaged and involved in the 31,566 Palo Altans voted on Mea- Klein said. community is the thing that distin- sure N (Palo Alto library bond) in “The attention certainly would guishes Palo Alto from almost all 2008, while only 14,308 voted on “Here we are in the not be paid if the council (election) of our clients,” said Murray, whose Measure A (the city’s business-li- is one of 10 or 15 elections conduct- firm has worked with cities and cense tax) in 2009, proponents state midst of Silicon Valley, in ed in an even-number year,” Klein counties throughout the state. in their official ballot argument. said. Murray’s pronouncement sounded “We have always pushed voter the midst on an engaged Palo Alto isn’t the only city grap- like music to the ears of the coun- participation,” Scharff said. “If you pling with the change, Kniss said. cil, which listed “civic engagement” look at 30,000 people voting versus social-network world, Half Moon Bay, which is in San Ma- as one of the city’s top priorities in 15,000 people voting — that’s really teo County, is also now considering 2008 and 2009, routinely watches dramatic.” and we’re telling people a change to even years, she said. Its the Council Chamber fill up dur- Councilman Greg Schmid, the proposal, like Palo Alto’s, will be ing its Monday night meetings, and most vocal opponent of Measure we don’t want them to on the ballot as Measure S. Besides relies on citizen task forces for as- S, isn’t buying this argument. Just Palo Alto, Cupertino and Sunnyvale sistance with the city’s most conten- because more people hit the polls vote every year.” are the only cities in Santa Clara tious decisions. during even years doesn’t mean they County that hold their elections in In August, the council took an Weekly file photo pay much attention to local issues —Greg Schmid, odd years. Gilroy and Los Altos had even bolder step to bolster civic or even bother filling out the local city council member recently switched their elections to participation — one that would kill ballot, he said. And even if they do even years. a century-old tradition. At its Aug. vote for local issues, it doesn’t mean “Most of the county is already 2 meeting, the council voted 5-4 they have carefully considered them there,” Kniss told the Weekly. “Out (with Mayor Pat Burt, Vice Mayor before casting their votes. rack Obama was on the ballot. of 2 million people in the county, Sid Espinosa and Councilmen Greg Santa Clara County Supervisor It’s also quite possible, opponents By having elections in odd years, only 200,000 are left voting in odd- Schmid and Larry Klein dissent- Liz Kniss, a former Palo Alto say, that the 2008 turnout had less to the city allows residents to focus year elections.” ing) to place an initiative on the mayor, says even-year elections do with the election’s even year and exclusively on local initiatives and November ballot that would shift would reduce costs and boost more to do with the fact that Bar- City Council candidates, Schmid (continued on page 21) voter turnout. *>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 19 Cover Story Measure R (continued from page 18)
standard). These reports, Spitaleri said, are being tossed aside by the council because they don’t say what the council wants to hear. “Our command staff is at a very low level, and it’s a dangerous situ- ation,” Spitaleri said at the Oct. 6 debate, referring to the department’s nine management positions. “Every report that says we have to boost it up is being ignored.” He also took issue with the pend- ing report, noting that Antil has a long history with ICMA, where she has served on various policy committees. Antil called the joint report from ICMA and TriData an Tony Spitaleri, left, president of the Palo Alto Professional Firefighters, “independent analysis” and said 1319, and Alan Davis, the union’s attorney, take notes and listen care- the group conducting the report in- fully during the debate on Measure R. cludes former fire chiefs and other public-safety officials. id or voiceless — nor the council as sure R would needlessly take away Antil said the ICMA team will fo- unwilling to listen — as the union from the council one of its most es- cus on dispatch data, while TriData alleges. Earlier this year, residents sential duties. will wrestle with the question for packed public hearings to urge the “The public does elect the coun- overtime. She said her membership council to maintain funding for cil to make decisions and to do in ICMA has “no bearing whatso- school-crossing guards; to dispute labor negotiations,” Beecham told ever” on the group’s work. a 33 percent increase in garbage the Weekly. “To do anything but The new report, however, is just collection for residents who use 20- that for one special group is simply CUSTOM SOLUTIONS FOR EVERY one reason why firefighters are gallon minicans; and to refrain from wrong.” N STYLE AND EVERY BUDGET bracing for cuts, Spitaleri said. Pleas imposing housing-size limits in the Staff Writer Gennady Sheyner from firefighters and residents to foothills. The council sided with can be e-mailed at gsheyner@ maintain adequate fire staffing have residents in all three cases. paweekly.com. been falling on deaf ears for years, Safe Palo Alto’s Barton, Mossar he said. Palo Alto residents need to and Beecham point to a wide array have a say in these decisions, he says. of ways residents have to reach their WATCH IT ONLINE That’s why Measure R is necessary. public officials. In addition to the www.PaloAltoOnline.com Members of Safe Palo Alto laugh “public comment” period at council Video excerpts from both sides of the off the union’s premise that Palo meetings, during which time any Measure R debate are posted on Palo Alto residents currently don’t have speaker can talk for three minutes, Alto Online. a voice in the council’s decisions. residents can write letters, send e- Ironically, both they and the fire mails, make phone calls, post com- union point to the 2007 dispute ments on online forums and use the Videos of candidate over Station 8 as exemplifying city’s Open City Hall website, which forums online their points — either that the coun- allows residents to weigh in on the cil makes reckless decisions about hot agenda topics of the day. Videos of candidate forums, staffing or that the council listens to Given these forums, “the idea sponsored by the League of Women its constituency and reverses course that the public is excluded or has no Voters, and other election discus- accordingly. voice just doesn’t make sense,” Bar- sions have been posted online by More recent examples suggest ton said at the Oct. 6 debate. the Midpeninsula Community Me- that Palo Altans may not be as tim- Beecham agreed and said Mea- dia Center. Candidate forums for local races, local ballot measure debates and state proposition arguments are all featured in video clips available on the Midpeninsula Community Media Center website, www.com- munitymediacenter.net. The “Elec- tions Page” has links to all the video clips as well as upcoming broadcast times on Channel 27. The candidate forums cover Mid- peninsula races for Menlo Park and Atherton City Councils, San Mateo County supervisor (District 3), Se- $500 quoia Healthcare District, Las Lo- ——— OFF ——— mitas and Menlo Park Elementary School Boards, and Santa Clara MUST ACT BEFORE 11-15-10 Valley Water District.
MINIMUM $5,000 PURCHASE. Ballot measure video arguments SOME RESTRICTIONS APPLY. cover races in Menlo Park and Palo Alto where a large-scale develop- ment proposal, city employee pen- sion limits, firefighter staffing deci- OUR PENINSULA SHOWROOMS HAVE CONSOLIDATED. sions, and election-year scheduling VISIT US AT OUR NEWLY EXPANDED AND RENOVATED will be decided by voters. There are also two Santa Clara County mea- CAMPBELL SHOWROOM. THE BAY AREA’S LARGEST! sures and one in San Mateo County CERTIFIED GREEN that have been recorded. “The videos enable voters to judge CAMPBELL SHOWROOM 1190 DELL AVENUE how the candidates conduct them- WWW.VALETCUSTOM.COM 408.370.1041 selves in addition to the answers FORMERLY EURODESIGN they give,” Elliot Margolies, the Me- dia Center’s election-programming HOME OFFICES SEWING CENTERS coordinator, said of the presenta- We’re all in it together. WALL BEDS CLOSETS GARAGES tions. N — Palo Alto Weekly staff Page 20ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Cover Story
dered aloud if the citywide debate Measure S of 1987 could have been possible (continued from page 19) during an even year, when guber- natorial, presidential and Congres- But Schmid argued that Palo Alto sional candidates (not to mention Manjul E. Dixit, MD voters already turn out in greater judges, sheriffs and other lower- numbers than their counterparts in profile candidates) also vie for the Manjul S. Dixit, MD, FAAAAI has moved her practice from Menlo Medical other communities and claimed that voters’ attention. a switch to even years would signifi- “Would this have happened if this Clinic to Atherton Square. cantly reduce not just informed vot- was a general election?” Schmid Convenient hours 12 pm-8pm and ample parking. ing but active participation in local asked. “Could you have that kind issues. of attention to local issues like eco- 3ERVICES )NCLUDE s !LLERGIC 2HINITIS s !STHMA s &OOD !LLERGY s #OUGH s #ONGESTION To stress his point, Schmid cites nomics and demographics?” N s ,ATEX s (EADACHES s AND MUCH MORE 1987, the year he became involved Staff Writer Gennady Sheyner Please visit our website @ www.AthertonAllergists.com in local politics. That’s the year can be e-mailed at gsheyner@ Palo Alto’s school board, which paweekly.com. %L #AMINO 2EAL 3UITE s !THERTON #! included Kniss, voted to merge s FAX Gunn and Palo Alto high schools Cover design by Shannon Corey www.AthertonAllergists.com and to convert Gunn into a middle school. The proposal outraged lo- cal school activists, who launched a grassroots crusade against the merger and who helped elect two anti-merger newcomers, Diane Re- AT CHILDREN’S HEALTH COUNCIL klis and Henry Levin, to the five- 650 Clark Way, Palo Alto, CA 94304 member school board (incumbent www.sandhillschool.org board member Joe Simitian, who voted for the merger, barely sur- vived re-election after finishing third in the polls). Shortly after the election, the new school board voted to rescind its ÕÃiÕÊ+Õ>ÌÞÊ,i«>ÀÃ earlier vote, effectively killing the UÊ*ÀVi>ÊUÊ*ÌÌiÀÞÊUÊ >ÀLiÊ merger idea. After months of excru- ciating tension, the Gunn commu- UÊ>`iÊUÊÛÀÞÊUÊ>ÃÃÊ nity breathed a sigh of relief. UÊ7`ÊUÊ-Ìi Schmid said he was impressed by Èxä{n{Ó{x For young the voters’ ability to unite behind a complex issue involving housing, minds, one size economics and demographics, and to effect change. At a recent in- doesn’t fi t all. terview with the Weekly, he won- www.restorationstudio.com
At Sand Hill School, we fi nd what fi ts ACCEPTING APPLICATIONS NOVEMBER 1 Cardoza-Bungey Travel best for your child. Partnering with parents, teachers create the path for each student’s OPEN We Make Vacations Better! successful transition to a traditional classroom. Thu, Oct 21, 5:00-6:00 PM HOUSE Tue, Oct 26, 5:00-6:00 PM Tahiti & South Pacific Cruises this Fall s Grades K-3 s 6:1 student/teacher ratio RSVP: 650.688.3605 or [email protected] s State-of-the-art technology
Seniors: Help is just a phone call away! 45% off & free air on select sailings 650-325-5600
CST#1007564-10 www.cardoza.com
Home safety 24/7 support & checkup for every need Emergency Network of preparedness trusted vendors review Transportation assistance with purchase of $25 or Legal more of natural & organic referrals foods, body care, vitamins Reassuring & more! check-in calls Medical advocacy
Your Local&)%('+)% Natural Foods Store $#"&'%# *!, $&$(&, After all other discounts & coupons. Cannot be combined with any other 'Free' or '$ OFF' For peace of mind, call (650) 289-5405 Country Sun coupon. One coupon per household per day per purchase of $25 or more. or visit us online at AvenidasVillage.org. Your life, your way, in your home *>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 21 special feature About Plastic and Reconstructive Surgery t Plastic and reconstructive surgery techniques have broad applications, without the stares of others. For others, it has meant a life returned to not only to limbs and the face but also to the body’s internal regions: normal activity. Abdominal walls, for example, can be reconstructed, tendons transferred A community health education series from Stanford Hospital & Clinics and even the smallest of blood vessels restored to function. t The field had its earliest recorded beginnings in India, around 2000 BC. t Surgeons can also retain or restore function to the tongue, palate and t By 1794, the first published reports appeared in an English magazine. esophagus as one aspect of a cancer surgery. t In 15th century Europe, the technique was used sometimes to replace a t Specialists in plastic and reconstructive surgery are often part of a team of nose lost and devoured by dogs. Out of Options: physicians focused on a patient’s care and their skills incorporated into a t In 1827, the first American plastic surgeon repaired a cleft palate. As coordinated approach to treatment. soldiers returned from World War I, plastic and reconstructive surgeons t For many millions of people who have suffered highly disfiguring injuries gained, unfortunately, experience with reconstruction of explosive- and Hand Surgery Saves or health conditions, the specialty has offered the chance at a life lived burn-injured faces.
For more information about plastic surgery: Call 650.723.7001 or visit plasticsurgery.stanford.edu. For more information about hand surgery, Fingers and Function call 650.723.5256 or visit stanfordhospital.org/chase. Join us at: stanfordhospital.org/socialmedia
On the outside, Melissa Warde just Warde said. She glows. Confident, quick to smile, hap- has developed a Norbert von der GroebenNorbert py. One look at her hands and a differ- tremendous mental scleroderma center there and regular- lip. Modern microsurgery enables the stitches around the circle of a one surgeons pioneered new techniques ent reality is obvious. strength. “I get up ly consult with physicians, like Chang, reconstruction of wounds and defects millimeter vessel’s circumference. in wrist arthroscopy, nerve recon- every day, no mat- who might offer another aspect of care anywhere from scalp to toes. Just getting to where he needed to struction, and release of Dupuytren’s Her left hand and fingers are purple, ter how much pain to her patients. work in Warde’s hand required a contracture, a condition that twists and swollen. Until this summer, I’m in. I always put Chang and his colleagues can now, as careful movement down through the hand and fingers into a nearly her right hand had been the same myself together.” Warde said Chang explained to her a routine procedure, reattach a hand a tightly-packed group of tendons, non-functional shape. The next steps, way−worse, in fact, with unhealed ul- that scar-like tissue had encircled her completely amputated across the palm nerves, veins and arteries, none much Chang said, will likely include the cers on the tips of her index and ring In part, the pain For several years, Melissa Warde endured disabling pain in her fi ngers, caused by an autoimmune system disease. She found some relief in hand’s blood vessels “like a piece of or move all or just some of the big toe bigger than the ones obscured by the movement of more precise combina- medication, but the disease progressed, constricting blood fl ow to her hands so badly that amputation became a strong possibility. The surgery fingers. comes from blood twine wrapping around a garden hose, to make a new thumb. The latter ca- scleroderma. Even the most meager tions of a patient’s skin, nerve, mus- she had at Stanford Hospital changed all that. vessels whose flow and that you had to strip away the pability is especially critical because misstep can have major impact on cle, and tendons to individually tailor For more than half her life now, Warde is constricted by twine.” Medication might be somewhat the thumb is responsible for 40 per- how well her hand would work after a reconstruction. Stanford’s plastic has doggedly kept moving against overabundant tissue deposited around Delicate procedure, “The stakes are high, and this is a helpful, she thought, but she liked the cent of the function of the hand. surgery, or trigger chronic pain. surgery laboratories also are actively scleroderma, an autoimmune system their exterior surfaces. And, Warde technically difficult and challenging idea of “starting with a clean slate.” involved in the combination of syn- disease that can harden the skin until said, “I started to get these ulcers on practiced hands procedure,” said Chang. “But the effect The scale of the surgical territory in thetic scaffolding and human cells to it feels like stone. Its scientific name my fingers that wouldn’t heal.” Bit by In this procedure, microvascular can be huge. We’re setting back the When Chang opened up Warde’s hand, the hand is stunningly miniscule. Looking ahead repair tissue, bone and nerve. “It’s means hard skin. It’s not a common bit, Warde had to give up playing the surgeons like Stanford’s James clock of the effects of scleroderma on he was using microsurgical tools and The sutures Chang handles are no New techniques are available to an exciting time in plastic surgery, disease, but it can affect every organ sports she loved, and, ultimately, was Chang, MD, Division Chief, Plastic & hand blood vessels by 10 to 12 years.” technique. Microsurgery depends on thicker than a human hair−and to take this type of surgery to an even because our toolbox is expanding,” in the body, in addition to the skin. unable to continue her job in a cancer Reconstructive Surgery, dissect open optics, surgical tools and the skill of secure connections he makes eight higher level. Recently, Stanford’s Chang said. research center. the wrist and palm through small “ I started to get these ulcers on my the surgeon. One early barrier now “ This procedure is becoming a incisions to isolate the blood vessels overcome: the eyes of the needles used fingers that wouldn’t heal and I “ The surgery has been the biggest very much desired procedure for She tried various medications, but that feed the fingers. Guided by his to carry sutures to close up blood ves- nothing worked. Sometimes, the pain view through an operating micro- was in danger of losing my fingers.” sels were so large they tore holes in lifesaver for me. I can fully scleroderma patients, but you need would be so bad that the necessary scope, Chang carefully releases the the fragile tissue. Now, the suture – Melissa Warde, patient, function. I feel a lot more whole a vascular surgeon who has the dose made it impossible for her to do scar tissue that envelops and con- thread is fused to the needle, expand- Stanford Hospital & Clinics then I have in quite a few years experience.” anything. And Warde’s fingers became stricts the arteries. Freed from the ing what microsurgery can success- so damaged that amputation seemed scar tissue, the arteries plump open fully accomplish. because of this surgery.” – Lorinda Chung, MD, ahead. “I was in danger of losing my again and enough blood reaches the “It’s becoming a very much desired – Melissa Warde, patient, Stanford Hospital rheumatologist fingers,” she said. Finally, a sclero- fingertips to nourish them. If the procedure, but you need to have a mi- Stanford Hospital & Clinics derma specialist at Stanford Hospital arteries are too damaged, then the crovascular surgeon who has the expe- More than skin deep Its cause is unknown; a cure not in & Clinics, Lorinda Chung, MD, men- surgeon will make a bypass around rience,” said Chung, an autoimmune Within Stanford Hospital’s Robert A. sight. The best that can be done right tioned one last option−a surgery called them from unaffected arteries else- system physician who has treated Chase Hand & Upper Limb Center Since her surgery, Warde has worked now is to respond to its symptoms. a digital sympathectomy. where in the hand. Warde at Stanford. She and her col- and its Complex Reconstruction Cen- hard with a hand therapist to regain “It’s a very, very debilitating disease,” leagues are part of a multidisciplinary ter, surgeons treat very challenging mobility lost to lack of use. But she conditions. People like Warde may could see the effect of the surgery im- come to Stanford for help with the mediately. Her right hand and fingers
damage caused by a chronic disorder; von der GroebenNorbert lost that deep purple color and became they may come after a traumatic acci- a healthy pink again. The ulcer began dent to have a limb reattached; or they to heal. “There was a drastic, drastic may come to talk about what might be difference,” Warde said. “It wasn’t an done during or after cancer surgery. open wound any more.”
Plastic and reconstructive surgery The surgery, Warde said, “has been Norbert von der GroebenNorbert might mean reconstructing a face Stanford hand surgeon James Chang is one of a very small group of physicians with the technical expertise to the biggest lifesaver for me. I can fully damaged in a car accident or replacing successfully perform a surgery like Warde’s. Called a digitial sympathectomy, the surgery includes stripping disease- function. I feel a lot more whole then a breast removed for cancer by using caused fi bers away from blood vessels. On the screen behind Chang is an angiogram of Warde’s hand; the dark lines in I have in quite a few years because of abdominal skin or repairing a cleft the hand is evidence that blood is now fl owing much more normally to Warde’s fi ngers. this surgery.”
Stanford Hospital & Clinics is known worldwide for advanced treatment of complex disorders in areas such as cardiovascular care, cancer treatment, neurosciences, surgery, and organ transplants. Consistently ranked among the top institutions in the U.S. News & World Report Melissa Warde shows her Stanford plastic surgeon, James Chang, the changes in her hand since surgery. At left, she points out the healthy new fi nger nail and fi nger tip on her right index fi nger where once an ulcer had deadened and annual list of “America’s Best Hospitals,” Stanford Hospital & Clinics is internationally recognized for translating medical breakthroughs into the eroded the tissue. At center, the palm of her right hand is clearly a healthy pink color, in contrast to her left palm, where fi bers still constrict blood fl ow. At right, the renewed blood fl ow has also improved her hand’s function, including its care of patients. It is part of the Stanford University Medical Center, along with the Stanford University School of Medicine and Lucile Packard sensitivity to touch. Children’s Hospital at Stanford. For more information, visit stanfordmedicine.org. Page 22ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ *>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 23 ArtsA weekly guide to music, & theater, art,Entertainment movies and more, edited by Rebecca Wallace
In its 13th year, the United Nations Association Film Festival shows 60 documentaries from 60 countries
Page 24ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Elderly Latinos are shown trying to make a new life in the United States in “The Old Immigrants Dance,” which will be screened Oct. 22.
by Rebecca Wallace Films shown opening night also include “The Old he phrases “reduce your carbon footprint” and Immigrants Dance,” an American movie about four “live green” can seem so vague that it’s hard to elderly Latinos trying to make a new life in the United T find them personally meaningful. Sometimes States. That screening is set for 9:45 p.m. it takes a filmmaker to illustrate an issue’s human Screenings continue at the Aquarius on Oct. 23 and impact. 24, with titles including the American-Pakistani film In this year’s United Nations Association Film “Bhutto,” directed by Duane Baughman and Johnny Festival, which opens Oct. 22 in Palo Alto, several O’Hara. The 115-minute film, a profile of the late movies do just that. One is “There Once Was An Is- Pakistani prime minister Benazir Bhutto, will be land,” in which the residents of Takuu are the faces shown at 5:30 p.m. Saturday with the filmmakers of climate change. On this diminutive Pacific atoll in present. Papua, New Guinea, there have been many reports of “Sing China” is one of the films set for an Oct. the sea level rising. 24 screening, at 6:45 p.m. Directed and produced by Directors Briar March and Lyn Collie show taro Freida Lee Mock, the 72-minute Chinese-American crops being harmed by salination from high tides — film follows the Los Angeles Children’s Choir on a and, in dramatic footage, a “king tide” causing huge tour of China. waves and flooding. A classroom is ruined, with a The festival moves to Stanford University’s Free- strong image showing rows of textbooks lying out to man Spogli Institute for International Studies (in dry. And the whole island society must decide wheth- Encina Hall) on Oct. 25 and 26. “There Once Was er to stay on Takuu or move. An Island” will be screened at 4 p.m., followed by A reviewer for the online New Zealand arts journal a panel discussion on “Climate-Change Impact on The Lumiere Reader recently wrote of the film: “’An Population” at 5:20 p.m., and a reception with the Island’ derives its significant emotional impact pri- filmmakers at 6:30 p.m. marily from the vulnerability and artlessness of the Screenings will also be held in East Palo Alto on Takuu islanders. The director wisely ensures they are Oct. 26, at the Eastside College Prep theater at 2101 kept to the fore.” Pulgas Ave. Films include “Home is Where You Find The 80-minute film, set for a 4 p.m. showing at It,” a 27-minute piece about a 16-year-old AIDS or- Stanford University on Oct. 25, is one of 60 docu- phan in Mozambique. Directed by Alcides Soares, it mentary features and shorts from 60 countries at this will be shown at 5 p.m. year’s film festival. The theme of the 13th annual Screenings will continue in various locations at socially conscious film festival is “Population, Migra- Stanford University through closing day on Oct. 31. tion and Globalization.” (Some films will also be shown in San Francisco Afternoon and evening screenings are in Palo Alto, on Oct. 27.) They include an Oct. 30 showing of East Palo Alto and San Francisco and at Stanford “Gasland,” an American film about domestic gas University, through Oct. 31. drilling and its possible hazards. Directed by Josh Another of the films dealing with the human cost Fox, the 104-minute film will be shown in the Cantor of environmental crises is “Climate Refugees,” di- Arts Center at 12:45 p.m., followed by a panel discus- rected and written by Michael Nash. The 95-minute sion called “Deregulation: Solution or Problem?” movie looks at “climatically induced environmental Also on Oct. 30 is a showing of “Queen of the Sun,” disasters” such as droughts, sea-level rise, fires and which looks at the disappearance of bees in many extreme weather. “All this is causing mass global countries, incorporating interviews with scientists, migration and border conflicts,” Nash writes on the beekeepers and philosophers. The 83-minute film film’s website. was directed by Taggart Siegel. N Other themes in the festival, founded by Stanford lecturer Jasmina Bojic, include women’s issues, chil- What: The United Nations Association Film Festival dren and the environment, immigration and home- screens 60 films from 60 countries. lessness. Where: Screenings are in Palo Alto, East Palo Alto and Here are several festival highlights: San Francisco, and at Stanford University. When: Oct. 22-31, with afternoon and evening screen- Opening night, Oct. 22, takes place at the Aquarius ings Theatre at 430 Emerson St. in Palo Alto. “Climate Cost and info: Ticket prices vary. Some events, includ- Refugees” will be screened at 7:25 p.m. with the film- ing the opening-night screenings and all panel discus- makers on hand, as a tribute to Stephen Schneider, sions, are free. Other screenings can be paid for with a a Stanford professor of environmental biology and single ticket or a daily or festival pass. For ticket details global change who died recently. Schneider earned a and a full schedule, go to unaff.org or call 650-724- collective Nobel Peace Prize with Al Gore in 2007. 5544.
Opposite page: clockwise from top, The Los Angeles Children’s Choir takes a tour of China in “Sing China,” set for an Oct. 24 screening. In the film “There Once Was An Island,” the people of a tiny Pacific atoll live with rising sea levels that may be caused by climate change. The film will be shown Oct. 25. “Queen of the Sun,” showing on Oct. 30, looks at the disappearance of bees. The film “Bhutto,” which profiles the late Pakistani prime minister Benazir Bhutto, will be screened Oct. 23.
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 25 Arts & Entertainment Ecole internationale de la Péninsule Officer Randy Osteen (Julia Brothers) and ̽ shopkeeper Arthur ࣑ Przybyszewski (Howard Swain) catch up over ᄑ coffee in “Superior ዕ Donuts.” ओ
PRE-SCHOOL WHEN IT’S YOUR CHILD, Outstanding full- day program. EXPERIENCE MATTERS.
LANGUAGE TEACHING MANDARIN CHINESE IMMERSION FOR 15 YEARS LEADER IN FRENCH IMMERSION Longest running . A IN bilingual PALO ALTO. ACCEPTING PRE-SCHOOL APPLICATIONS. immersion school REGISTER FOR A TOUR TODAY. in the area. Experienced TOURS & OPEN HOUSES INFORMATION NIGHTS native-speaking faculty. UPCOMING TOURS Learn more about the school’s October 8, 2010 Mandarin Chinese Immersion October 15, 2010 and French Immersion programs. Kitaoka Mark November 5, 2010 RSVP on our website. ACADEMICS November 19, 2010 FRENCH INFO NIGHT Established English OPEN HOUSES/INFO SESSIONS October 12, 2010 Jonathan Rider’s believable chore- curriculum. November 13, 2010 January 8, 2010 CHINESE INFO NIGHT ography. Rigorous program October 19, 2010 in a nurturing Letts is not commenting on the environment. Low A sweet treat student-to-teacher INTERNATIONAL SCHOOL OF THE PENINSULA conventionally well-made play or ratio. 7%" 777)340/2' s 0(/.% ‘Superior Donuts’ proves a welcome confection being ironic about it. He’s simply making it work at a higher level than By Chad Jones usual. If he set out to make a play f Tracy Letts’ “Superior Donuts” that would make people feel good were actually a superior donut, THEATER REVIEW without making them feel guilty, he Iit would be a chocolate-dipped has succeeded mightily. Swain and Gardner execute their old-fashioned — sweet, hearty and there’s absolutely no way he’ll no- satisfying. cross-generation friendship beauti- tice that the lady copy, Randy (Julia fully, and we come to care tremen- Best known as the Pulitzer Prize- Brothers), harbors a giant crush on winning author of “August: Osage dously for both Arthur and Franco him. and cheer for them both to come County,” an eviscerating look at Letts is playing with a sitcom for- the American family at its dysfunc- through their difficulties without mat here, one that has fueled many losing the hope they’ve come to tional worst, Letts has a reputation a sappy “opposites clash and then A friendly Neighborhood Church for dragging his characters through share. change each other for the better” The supporting cast is full of Bay darkness and horror in the name of script, be it on film, TV or the stage. )NTERNATIONAL s )NTERGENERATIONAL drama. Look no further than the Area greats including Joan Mankin The opposite in this case is Franco as the crazy, drunk homeless lady Progressive with Social Justice trailer-trash violence of “Killer Joe” Wicks (Lance Gardner), a 21-year- 470 Cambridge Avenue (close to campus and market) or the psycho-terrors of “Bug” for who dispenses wisdom (did we men- old “self-starter,” as he describes tion this was conventional?). Broth- evidence of that. himself when he bursts into the do- Wesley United Methodist With “Superior Donuts,” Letts ers as the crushing cop is irresistibly s WWWWESLEYCHURCHPAORG nut shop to apply for a job. sweet, especially when she’s razzing lets in a little light. Before Arthur knows what’s really The TheatreWorks production, her partner (Michael J. Asberry) for going on, the kid has basically hired dressing up like a Klingon and go- now at the Mountain View Center himself, and within a very short or- FIRST CONGREGATIONAL CHURCH, UCC for the Performing Arts, gives am- ing to “Star Trek” conventions. der, Franco is planning to spruce Søren Oliver gets many of the £nxÊ ÕÃÊ,>`]Ê*>ÊÌÊUÊÈxä®ÊnxÈÈÈÈÓÊUÊÜÜÜ°vVV«>°À}Ê ple proof that when Letts wants to up the shop (and Arthur himself) -Õ`>ÞÊ7Àà «Ê>`Ê-Õ`>ÞÊ-V Ê>ÌÊ£ä\ääÊ>°° be funny or even conventional, he evening’s biggest laughs as Max, for poetry readings. He might even the Russian owner of a neighboring can do it with gritty, grin-inspiring make the donut relevant again. This Sunday: No Quit in Us dialogue that cuts through most of DVD store. Max has a big mouth Franco is a spirited young Af- and, it turns out, a similarly sized Rev. Dr. Eileen Altman Preaching the sloppy sentiment. rican-American and Arthur is a Director Leslie Martinson is also heart. dispirited old white guy. They dis- The well-made drama that doesn’t An Open and Affirming Congregation of the United Church of Christ TheatreWorks’ casting director, so pense with the issue of race when aim to change the world is in short her advantage is the ability to hire Franco asks Arthur if he’s a racist. some superior Bay Area actors and supply. This kind of show used to After a rambling answer that ends be the stock in trade of American let them do their respective things with, “I hope not,” Arthur adds, “I under her guiding hand. drama, but in recent years, we tend hired you, didn’t I?” to get extremes along the lines of Howard Swain (a Letts veteran “Oh, scoot over, Mr. Lincoln,” from Marin Theatre Company’s hit ultra-silly comedies and hyper-sad Franco retorts. “Make room on the dramas. The middle ground is infre- production of “Killer Joe”) plays penny.” Arthur Przybyszewski, son of Pol- quently trod. Warren Leight’s “Side But race isn’t really the issue here. Man” and David Auburn’s “Proof” ish immigrants and proprietor of It’s much more about hope — or the the family’s crumbling donut shop are two middle-grounders that come lack of it. to mind. in Chicago’s Uptown neighborhood Franco, who has written the Great (the realistic set is by Tom Lang- Letts’ “Superior Donuts” is a wel- American Novel, is full of it. Arthur come addition to this territory. The guth and beautifully lit by Steven is devoid of it. What Arthur sees as B. Mannshardt). play, in its entertaining way, makes fantasies, Franco sees as possibili- a modest but convincing case for the Alone in the world for various ties. reasons, Arthur is a draft-dodging existence of hope in a cynical world. And because this is a conventional And there’s certainly nothing wrong hippie now pushing 60. He’s as de- play — well written, perfectly per- with that.N crepit as his shop, but behind the formed, immaculately produced but gray scruff and greasy ponytail is INSPIRATIONS conventional all the same — we will What: “Superior Donuts,” a Tracy Letts an incredibly bright, compassionate get to a happy ending. Bad things man who isn’t quite done with the play presented by TheatreWorks A resource for special events and ongoing religious will happen — the worst is an off- Where: Mountain View Center for the world, even as he tries to convince stage act of violence that made the Performing Arts, 500 Castro St. services. To inquire about or make space reservations himself the world is done with him. for Inspirations, please contact opening-night audience gasp. And When: Previews Oct. 8 at 8 p.m., with Arthur is so disconnected it takes there will be onstage violence in the opening night Oct. 9 at 8 p.m. Runs Blanca Yoc at 223-6596 him a while to even notice that van- form of a fight between two men through Oct. 31, Tuesday through or email [email protected] dals have trashed his donut shop and — Swain and Gabriel Marin as a Sunday. Cost: Tickets are $19-$67. that two of his donut-loving police money-grubbing goon — who have buddies are there to investigate. If Info: Go to theatreworks.org or call no business fighting but give their 650-463-1960. Arthur can’t bother to see the vul- all with an assist from fight director garity spray-painted on his wall, Page 26ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ \ȐǾɕɜȐɑ7KXUVGD\2FWREHU_SP ɄɤɕȐɨȐȽɜ Deep Pore Acne Lazr Treatment Isolaz® is a new blue light ACNE treatment that 7RXURXUQHZO\ combines a photo-pneumatic vacuum (it really sucks) with painless broadband light. UHQRYDWHGDSDUWPHQWV LQFOXGLQJRXU$VVLVWHG Suzanne Slader, RN www.facebook.com/suzanneslader /LYLQJQHLJKERUKRRG 1515 El Camino Real Suite D [email protected] @ Churchill Ave across from Paly 650.346.7696 DQGHQMR\OLYH www.isolaz.com HQWHUWDLQPHQWE\ Slader patient photos featured on the TODAY Show KDUSLVW.ULVWD6WUDGHU 9DOHWSDUNLQJDYDLODEOH Stiffer joints make it painful to move, run or play. Try &DOOIRU Cosequin®, the #1 Vet recommended joint supplement. PRUHLQIRUPDWLRQ
Cosequin® plays an important role in maintaining optimal joint function. Healthy cartilage is crucial for proper joint mobility. Cosequin helps support cartilage production and protect existing cartilage from breakdown. Cosequin allows your pet to enjoy their everyday activities.
- Cosequin® Available at - 1/2 OFF your next office visit fee ($21 Value - With This Ad) Expires 12/31/2010 Wellness Services include: Heartworm/Tick Disease Testing Flea Control Vaccinations Year-round Parasite Prevention Dentistry & Oral Surgery Surgical Services Spay & Neuter Fecal Parasite Exams Microchipping Geriatric Pet Care (650) 969-8555 Health Certificates For Travel AlpineVetOnline.com Dr. Rebecca McClellan D.V.M. Dr. Tyler Long D.V.M.
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 27 IN AMERICA Movies
PETER TRAVERS
CHECK LOCAL LISTINGS FOR THEATERS AND SHOWTIMES “ABSORBING, GRITTY AND TOTALLY ENGROSSING. DON’T MISS IT!” Helen Mirren and John Malkovich are heavily armed in the entertaining actioner “Red.” – Steve O’Brien, WCBS-FM Red --- a comic book. a retired CIA black ops agent with (Century 16, Century 20) If But before you dismiss it, consid- a fearsome reputation. Of course, you’re looking at your local mul- er this: “Red” stars four Oscar-win- news of Frank’s skills haven’t tiplex today for the “Red” that ning actors. It’s not every day that reached his suburban neighbors or won Best Play at this year’s Tony you’re able to use “Helen Mirren” Sarah Ross (Tony winner Mary- Awards, you’re going to wind up and “heavy artillery” in the same Louise Parker), the Social Security very confused. The movie “Red” sentence, but “Red” gives you the office cubicle worker he’s taken to isn’t an intense, complex medita- opportunity. Very loosely adapted chatting up over the phone. tion on the relationship between from the graphic novel by Warren Frank’s quiet life doesn’t last long: an artist and his art; rather, it’s a Ellis and Cully Hamner, “Red” His plan to travel to Kansas City lighthearted shoot-’em-up based on stars Bruce Willis as Frank Moses, to meet up with Sarah hits a snag when armed commandos attempt to kill him. For Sarah’s safety, he’ll have to abduct her and keep her in KEIR EMMA and ZACH line while looking up old friends GILCHRIST ROBERTS GALIFIANAKIS also classified as “RED”: “Retired — Extremely Dangerous.” What “ we have here is a two-joke premise: ZACH GALIFIANAKIS IS A “Danger man” hero takes innocent COMIC FORCE OF NATURE!” female on the ride of her life, and PETER TRAVERS old folks do the darndest things. But when the comically romantic “A , IT’S KIND couple is Willis and Parker, and SUPERBLY CRAFTED the retirees include Mirren, Mor- ” gan Freeman and John Malkovich, smartly acted, suspense-filled THRILLER. OF A well, you’ve got yourself a movie, – Susan Granger, SSG SYNDICATE my friend. Robert Schwentke (“The Time FUNNY Traveler’s Wife”) gives the picture stylish direction, with swirling “ and ” STORY camera moves and an ear for com- POWERFUL PROVOCATIVE. ic rhythms. The script has decent – Stephen Whitty, THE STAR-LEDGER comic snap and, of course, stuff “A PERFECT blows up real good. But the show ” here is in the casting, which calls up COMING-OF-AGE COMEDY. a deep bench of acting talent. As an “ BETSY SHARKEY DEAD-ON lead PERFORMANCES active CIA agent on the hunt, Karl Urban (“Star Trek”) makes a strong from Robert DeNiro and Edward Norton.” foil for Frank, but the real baddie – Peter Debruge, VARIETY turns out to be Richard Dreyfuss. Ernest Borgnine also turns up, as do Brian Cox, James Remar and Rebecca Pidgeon. It all equates to a couple of hours of crowd-pleasing nonsense. There’s some “last chance” romance, a fa- miliar critique of CIA corruption, STRONG SEXUALITY AND VIOLENCE, AND PERVASIVE LANGUAGE NOW PLAYING EVERYWHERE sympathy for the spy (the first CINEMARK EXCLUSIVE ENGAGEMENT NO PASSES CHECK LOCAL LISTINGS FOR THEATRE LOCATIONS AND SHOWTIMES question when a guest arrives is CENTURY CINEMAS 16 SPECIAL ENGAGEMENTS NO PASSES OR DISCOUNT COUPONS ACCEPTED STARTS FRIDAY, OCTOBER 15 Mountain View (800) FANDANGO 910# ACCEPTED “Are you here to kill me?”) and a " /0 */42+.)18!)52" % 4+2*6/30& 2/ $ Page 28ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ consideration of the ol’ “we’re not In turning life into drama, screen- family tragedy. to a rock star’s coming-of-age sto- dead yet” retirement theme. Frank writer Matt Greenhalgh (“Control”) It isn’t all uncomfortable psy- ry. Here’s John learning from his states the obvious: “With age comes and first-time feature director Sam chodrama for Lennon, who we see mother how to play the banjo, and a certain perspective.” But let’s be Taylor-Wood cannot resist a certain enthusiastically raising hell and laying down his first song, “Hello honest, “Red” is about seeing Mir- amount of myth-making, and if even more enthusiastically embrac- Little Girl.” And here are the Quar- ren wielding a sniper rifle and Mal- this is a “kitchen sink” drama, the ing the cultural arrival of Elvis by rymen — including future Beatles kovich acting all kinds of nutty as sink comes across as rather well- adopting a new style and procuring Lennon, McCartney and George a character who was given “daily scrubbed. But as a broad-strokes a guitar. In addition to playing and Harrison (Sam Bell) — recording doses of LSD for 11 years” (the account of Lennon’s complicated singing, Johnson ably radiates Len- “In Spite of All the Danger,” with other side of the joke being that he’s family dynamic, trouble-making non’s brash bravado at school and Lennon taking lead vocal. always right: You’re not paranoid if youth and first tentative steps to- his scarcely concealed, raw need for Though Lennon didn’t write the they’re actually out to get you). ward rock stardom, “Nowhere Boy” love and approval from his mother song, the filmmakers encourage I won’t say you haven’t lived until succeeds as both entertainment and figures. Taylor-Wood and her actors Johnson to give it an extra-soulful Fri & Sat Only 10/15-16: you see John Malkovich as a retired a rumination on the roots of one also show a sensitivity to the excited vocal informed by John’s personal Waiting for Superman 1:45, 4:30, 7:15, 10:00 CIA agent, sadly dangling a stuffed man’s nascent artistry. but wary friendship that develops, tragedy. After 90 minutes of family- Waiting for Superman 3:00, 5:45, 8:30 pig from his hand, but I will say it Spanning 1955 to 1960, the sto- late in the picture, between Lennon style angst, the Beatle-esque tune, Sun-Thurs 10/17-10/21: brightened up my day. ry kicks off with Lennon (Aaron and Paul McCartney (Thomas Bro- and an authentic Lennon demo cut Waiting for Superman 1:45, 4:30, 7:15 Johnson of “Kick-Ass”) losing die Sangster), Lennon’s life-long under the end credits, provides a Waiting for Superman 3:00, 5:45 Rated PG-13 for intense se- his beloved Uncle George (David rival for attention. quences of action violence and Threlfall) and facing life alone For the sake of drama, Green- (continued on next page) brief strong language. One hour, with his somewhat priggish Aunt halgh fudges facts when it comes 51 minutes. Mimi (Kristin Scott Thomas). The to Lennon’s relationships with Ju- familial shift prompts the teenage lia (who was a relatively constant — Peter Canavese Lennon to reconnect with his af- presence in John’s young life) and “THE BEST CAST FOR AN fectionate but erratic mother Julia the protective Mimi (who, though Nowhere Boy --- (Anne Marie-Duff of “The Last skeptical of John’s musical voca- ACTION COMEDY…EVER.” (Century 16) ‘Tis the job of the Station”). Something of a war of tion, seems not to have been as – Roger Moore, ORLANDO SENTINEL biopic to psychoanalyze its famous wills ensues between Mimi and Ju- severe and combative as her screen subject and sketch connective lines lia, with the attentions and loyalty equivalent). And Beatlemaniacs between the past and the future, the of John at stake. When all is said will quibble over details like which “GO SEE THIS MOVIE. personal and the public. In tackling and done, John will have faced the song Lennon’s first band the Quar- the subject of John Lennon’s for- ugly truth about the splintering of rymen played in their debut. ‘RED’ IS JUST FLAT-OUT FUN!” mative years, “Nowhere Boy” is no his family a decade earlier, and ex- But the music adds an underlying – Kelli Gillespie, XETV CW6 exception. perienced the fresh hell of another excitement and possibility unique “ONE OF THE MOST MOVIE TIMES ENTERTAINING EXPERIENCES
A Prairie Home Companion with Century 16: Thu. at 8 p.m. Century 20: Thu. at 8 p.m. TO BE HAD IN A THEATER THIS YEAR.” Garrison Keillor LIVE (PG-13) (Not Reviewed) Chris Tilly, IGN Alpha and Omega (PG) Century 20: 11:20 a.m.; 1:35, 3:50, 6, 8:15 & 10:30 p.m. (Not Reviewed) Case 39 (R) (Not Reviewed) Century 20: 11:50 a.m. & 5:15 p.m.; Fri.-Wed. also at 10:25 p.m. Easy A (PG-13) (Not Reviewed) Century 16: 11 a.m. & 4:25 p.m.; Fri.-Wed. also at 10:20 p.m. Century 20: 12:25, 2:45, 5:10, “ORIGINAL, 7:30 & 10 p.m. Enter the Void (Not Rated) Aquarius Theatre: 3 & 8:45 p.m. STYLISH, (Not Reviewed) EXCITING…” Hereafter (PG-13) Century 20: Thu. at 12:01 a.m. –– Dean Dean Richards,Richards, WGNWGN AMERICAAMERICA (Not Reviewed) It’s Kind of a Funny Story Century 16: 11:40 a.m.; 2:25, 4:55, 7:50 & 10:30 p.m. Century 20: 11:25 a.m.; 1:55, 4:35, (PG-13) ((( 7:15 & 9:45 p.m. Jackass 3D (R) (Not Reviewed) Century 16: In 3D at 11 a.m.; noon, 1:20, 2:20, 4, 5, 7, 8, 9:40 & 10:40 p.m. Century 20: In 3D at 11:55 a.m.; 12:55, 2:15, 3:20, 4:40, 5:45, 7:10, 8:10, 9:30 & 10:35 p.m. Legend of the Guardians: Century 16: In 3D at 11:05 a.m.; 1:30, 4:05, 6:40 & 9:05 p.m. Century 20: In 3D at 11:30 The Owls of Ga’Hoole (PG) a.m.; 1:55, 4:20, 6:50 & 9:15 p.m. (Not Reviewed) “YOU CAN’T Life As We Know It (PG-13) Century 16: 11 a.m.; 1:40, 4:20, 7:10 & 10:05 p.m. Century 20: 11:35 a.m.; 12:55, 2:15, 3:45, MISS THIS (Not Reviewed) 4:55, 6:30, 7:35, 9:10 & 10:15 p.m. MISS THIS Mao’s Last Dancer (PG) (( Aquarius Theatre: 12:15 & 6 p.m. MOVIE. My Soul To Take (R) Century 16: Fri.-Mon., Wed. & Thu. at 11:25 a.m.; 2, 4:50, 7:40 & 10:15 p.m.; Tue. at 11:25 a.m.; (Not Reviewed) 2 & 10:35 p.m. Century 20: 12:20, 2:55 & 10:40 p.m.; Fri.-Mon., Wed. & Thu. also at 5:30 & LAUGH-OUT- 8:05 p.m. LOUD FUN.” Never Let Me Go (R) ((( Aquarius Theatre: 2, 4:30, 7 & 9:30 p.m. –– Maria Maria Salas,Salas, TERRATERRA TVTV Nowhere Boy (R) ((( Century 16: 11:35 a.m.; 2:10, 4:40, 7:35 & 10:15 p.m. Paranormal Activity 2 (R) Century 20: Thu. at 12:01 a.m. (Not Reviewed) Red (PG-13) ((( Century 16: 11:10 & 11:50 a.m.; 1:50, 2:30, 4:30, 5:10, 7:25, 8:05, 10:20 & 10:50 p.m. Cen- tury 20: 11:40 a.m.; 1, 2:20, 3:40, 5, 6:20, 7:50, 9 & 10:35 p.m. “‘RED’ Secretariat (PG) ((1/2 Century 16: 11:15 a.m.; 12:10, 2:05, 3:20, 5:05, 7, 8:10 & 9:55 p.m. Century 20: 11:15 a.m.; 12:40, 2, 3:35, 4:50, 6:25, 7:40, 9:20 & 10:30 p.m. DELIVERS!!” The Social Network (PG-13) Century 16: 11:30 a.m.; 1, 2:15, 3:50, 5:15, 7:05, 8:20 & 10 p.m. Century 20: 11:20 a.m.; –– Mosé Mosé Persico,Persico, CTVCTV MONTREALMONTREAL (((1/2 12:45, 2:10, 3:40, 5, 6:35, 7:55, 9:25 & 10:40 p.m. The Sound of Music Sing-Along Century 16: Tue. at 6:30 p.m. Century 20: Tue. at 6:30 p.m. Event (Not Rated) (Not Reviewed) Stone (R) ((1/2 Century 16: 11:20 a.m.; 1:55, 4:35, 7:30 & 10:25 p.m. The Town (R) (((1/2 Century 16: 12:30, 3:40, 7:20 & 10:10 p.m. Century 20: 1:25, 4:15, 7:20 & 10:10 p.m. Waiting for Superman (PG) Century 20: 11:45 a.m.; 2:25, 5:05, 7:45 & 10:25 p.m. Palo Alto Square: 1:45, 3, 4:30, 5:45 (Not Reviewed) & 7:15 p.m.; Fri. & Sat. also at 8:30 & 10 p.m. Wall Street: Money Never Century 16: 1:25 p.m.; Fri.-Wed. also at 7:15 p.m. Century 20: 12:50, 4, 7:05 & 10:05 p.m. Sleeps (PG-13) (Not Reviewed) SUMMIT ENTERTAINMENT PRESENTS A di BONAVENTURA PICTURES PRODUCTION You Again (PG) (Not Reviewed) Century 20: 2:35 p.m.; Fri.-Wed. at 7:55 p.m. You Will Meet a Tall Dark Guild Theatre: 2, 4:30, 7 & 9:30 p.m. A ROBERT SCHWENTKE FILM “RED” KARL URBAN WITH RICHARD DREYFUSS MUSIC PRODUCED Stranger (R) ((( BY CHRISTOPHE BECK BY LORENZO di BONAVENTURA MARK VAHRADIAN BASED ON THE SCREENPLAY DIRECTED GRAPHIC NOVEL BY WARREN ELLIS AND CULLY HAMNER BY JON HOEBER & ERICH HOEBER BY ROBERT SCHWENTKE ( Skip it (( Some redeeming qualities ((( A good bet (((( Outstanding © 2010 SUMMIT ENTERTAINMENT, LLC. ALL RIGHTS RESERVED. Aquarius: 430 Emerson St., Palo Alto (266-9260) Palo Alto (493-3456)
Century Cinema 16: 1500 N. Shoreline Blvd., Mountain Guild: 949 El Camino Real, Menlo Park (266-9260) MOBILE USERS: For Showtimes, Text Message RED and Your ZIP CODE to 43KIX (43549) View (800-326-3264) Stanford: 221 University Ave., Palo Alto (324-3700) Century 20 Downtown: 825 Middlefield Road, Red- STARTS FRIDAY, OCTOBER 15 Internet address: For show times, plot synopses, trailers Cinemark CENTURY 12 DOWNTOWN Cinemark CENTURY 20 DOWNTOWN Cinemark CENTURY @ TANFORAN wood City (800-326-3264) and more information about films playing, go to Palo Alto San Mateo 800/FANDANGO 968# Redwood City 800/FANDANGO 990# The Shops @ Tanforan 800/FANDANGO 998# CHECK THEATRE DIRECTORY OR CALL FOR SOUND INFORMATION AND SHOWTIMES SPECIAL ENGAGEMENTS NO PASSES OR DISCOUNT COUPONS ACCEPTED CinéArts at Palo Alto Square: 3000 El Camino Real, Online at http://www.PaloAltoOnline.com/
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 29 Movies
(continued from previous page) , /00 1 23 ) 0 welcome one-two punch of musical + + - . , 3 catharsis, as well as the somewhat cold comfort that Lennon will get !" #$ what he wished for — rock star- %& '( )& *' dom — and, along with it, adult travails. Rated R for language and a scene of sexuality. One hour, 38 ALLIED ARTS GUILD minutes. — Peter Canavese 75 ARBOR RD – MENLO PARK Stone --1/2 (Century 16) Gerald Creeson OPEN (Edward Norton), who prefers to be called “Stone,” has done eight years of a long sentence for arson HOUSE and being an accessory to murder (of his grandparents). Now Stone is attempting to convince his proba- tion officer, Jack Mabry (Robert De 2O1O Niro), that he’s reformed, so that he can get early release and get back 0EVKIWIPIGXMSRSJ to his hottie wife, Lucetta (Milla OCTOBER 23RD, 2010 'PEWWMGW*SVIMKR 6IRXKIX*6)) Jovovich of “Resident Evil”). 1:00 A.M. TO 3:00 P.M. “Stone,” directed by John Curran 8:7IVMIW&PYVE] +6%2( (“We Don’t Live Here Anymore,” “The Painted Veil”), centers on PLEASE COME JOIN US FOR AN AFTERNOON OF 2I[VIPIEWIW HE]VIRXEPW 34)2-2+ the conflict between the two men, COMPLIMENTARY MIMOSAS, APPETIZERS AND LIVE MUSIC! 2SRRI[VIPIEWI HE]VIRXEPW both of whom see themselves as COME SEE OUR BRAND NEW CONFERENCE ROOM, 89)7(%=7 ;)(2)7(%=7 ultra-tough. Stone, heavily tattooed, STROLL THE GARDENS AND VISIT THE $ 99 EPPQSZMIW wears his hair in cornrows and af- NEW STUDIOS AND SHOPS. 2 fects a prison swagger. Cynical Jack, days away from retirement, has seen it all. In Midtown Palo Alto When Stone professes to have -IDDLEl ELD 2D s had a spiritual conversion, Jack isn’t having any of it. Filled with rage, Stone demands to know why Jack gets to walk around free while he, Stone, is locked up. Good ques- tion: Jack, as we learn in the film’s Concerned opening scene, has reasons for guilt equal to Stone’s. The League of Women about our Nation’s direction? So far, the film, tautly written by Angus MacLachlan (“Junebug”), Voters of Palo Alto grabs your attention. Norton gives Learn about important issues a knockout performance, and the from prominent speakers. scenes, many shot in the huge WHERE WE STAND Southern Michigan Correctional The Conservative Forum of Silicon Valley Facility, have the smell of authentic- .OVEMBER s 'ENERAL %LECTION ity. Jack’s home life with his wife, Madylyn (Frances Conroy of “Six State Ballot Measures: Meets the first Tuesday of every month - Feet Under”), provides a suitable NO ON PROP 20 NO ON PROP 26 IFES Hall, 432 Stierlin Road, Mountain View, CA counterpoint to the prison scenes: Doors open at 6:15 PM - Program begins at 7:00 PM Though peaceful, their farmhouse Redistricting of “Polluter Protection” is as isolated as the prison. Ma- Congressional Districts First-Time Guests and Members - FREE - dylyn, lonely and neglected, finds NO ON PROP 27 Returning Guests - $10.00 solace in Christianity and booze, NO ON PROP 23 (Strongly Oppose) while the much less devout Jack in- Suspends Clean Energy and Eliminates State Commission The Conservative Forum of Silicon Valley explicably listens to a fundamental- www.theconservativeforum.com ist radio station. Air Pollution Standards on Redistricting Enter Lucetta, and the movie begins to unravel. Insistently phon- YES ON PROP 24 The League has no position ing Jack at home and devising per- Tax Fairness Act on PROPOSITION 19 sonal encounters, Lucetta aims to and is neutral on VVOLOLVVOO persuade him to write a favorable YES ON PROP 25 PROPOSITIONS 21 AND 22. ##..8t8t..&3$&&3$&%%&4t&4t review for Stone. But — and, don’t worry, there are no spoilers here — Simple Majority Vote the logic of the whole enterprise for Budget "/"/%%..*/**/* unravels. Neither Jack nor Lucetta behaves in a way consistent with his Local Ballot Measures: CORPORACORPORATETE AUTOAUTO WORKSWORKS or her character and situation, and, YES ON MEASURE A NO ON MEASURE R sadly, the film falls apart. Top Rating For Quality By Bay Area “Stone” is worth seeing for Nor- Santa Clara County City of Palo Alto – Fire Dept. Consumer Check Book ton’s performance, as well as Jo- Children’s Health Protection Personnel $PNQMFUF 4FSWJDFand3FQBJS vovich’s as a purring kitten with barely sheathed claws. The setting :VCB .U 7JFX YES ON MEASURE E NO ON MEASURE S — recession-era Michigan, never off El Camino literally portrayed but hinted at in Foothill-DeAnza College City of Palo Alto – General near Hwy 85 the gloomy settings — rings true. District Municipal Elections .PO'SJ The writing? Not so much. www.corporateautoworks.com The League is neutral on MEASURES B AND C Rated R for strong sexuality and pervasive language. One hour, 45 Since s r r 650-691-9477 minutes. Paid ad by the League of Women Voters of Palo Alto 1981 Distributor JT Design Products — Renata Polt Page 30ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ PIZZA
Pizza Chicago 424-9400 4115 El Camino Real, Palo Alto This IS the best pizza in town of the week
Spot A Pizza 324-3131 115 Hamilton Ave, Palo Alto Voted Best Pizza in Palo Alto www.spotpizza.com POLYNESIAN
Trader Vic’s 849-9800 AMERICAN CHINESE 4269 El Camino Real, Palo Alto Dinner Mon-Thurs 5-10pm; Fri-Sat 5-11pm; Armadillo Willy’s 941-2922 Peking Duck 321-9388 Sun 4:30 - 9:30pm 1031 N. San Antonio Rd., Los Altos 151 S. California Avenue, Palo Alto Available for private luncheons Range: $5.00-13.00 We also deliver. Lounge open nightly Happy Hour Mon-Fri 4-6 pm Hobee’s 856-6124 Su Hong – Menlo Park SEAFOOD 4224 El Camino Real, Palo Alto Dining Phone: 323–6852 Catered Also at Town & Country Village, To Go: 322–4631 Cook’s Seafood 325-0604 Palo Alto 327-4111 Winner, Palo Alto Weekly “Best Of” Texas 751 El Camino Real, Menlo Park 8 years in a row! Burmese Seafood Dinners from BBQ INDIAN $6.95 to $10.95 Green Elephant Gourmet Scott’s Seafood 323-1555 (800) 585-RIBS (650) 494-7391 Darbar Indian Cuisine 321-6688 #1 Town & Country Village, Palo Alto (7427) Burmese & Chinese Cuisine 129 Lytton, Downtown Palo Alto Open 7 days a week serving breakfast, 3950 Middlefield Rd., Palo Alto Lunch Buffet M-F; Open 7 days lunch and dinner (Charleston Shopping Center) Janta Indian Restaurant 462-5903 Happy Hour 7 days a week 4-7 pm Get Serious, Dine-In, Take-Out, Local Delivery-Catering 369 Lytton Ave., Downtown Palo Alto Full Bar, Banquets, Outdoor Seating Get Willy’s! CHINESE Lunch Buffet M-F; Organic Veggies www.scottsseafoodpa.com ITALIAN THAI 1031 N. San Antonio Rd, Chef Chu’s (650) 948-2696 Los Altos 1067 N. San Antonio Road Thaiphoon Restaurant 323-7700 Spalti Ristorante 327-9390 650.941.2922 on the corner of El Camino, Los Altos 417 California Ave, Palo Alto 543 Emerson St., Palo Alto 2008 Best Chinese ݵÕÃÌiÊ`ÊUÊ"ÕÌ`ÀÊ } Full Bar, Outdoor Seating MV Voice & PA Weekly www.spalti.com www.thaiphoonrestaurant.com Best Thai Restaurant in Palo Alto Jing Jing 328-6885 Pizzeria Venti 650-254-1120 3 Years in a Row, 2006-2007-2008 443 Emerson St., Palo Alto 1390 Pear Ave, Mountain View Authentic Szechwan, Hunan www.MvPizzeriaVenti.com Siam Orchid 325-1994 Food To Go, Delivery Fresh, Chef Inspired Italian Food 496 Hamilton Ave, Palo Alto Organic Thai www.jingjinggourmet.com JAPANESE & SUSHI Free Delivery to Palo Alto/Stanford Ming’s 856-7700 4-6p.m. 25% off menu price M-F Fuki Sushi 494-9383 Search a complete 1700 Embarcadero East, Palo Alto STEAKHOUSE listing of local 4119 El Camino Real, Palo Alto www.mings.com restaurant Open 7 days a Week Sundance the Steakhouse 321-6798 reviews by location New Tung Kee Noodle House MEXICAN 1921 El Camino Real, Palo Alto or type of food on 520 Showers Dr., MV in San Antonio Ctr. Lunch: Mon-Fri 11:30 am-2:00pm PaloAltoOnline.com Voted MV Voice Best ‘01, ‘02, ‘03 & ‘04 Palo Alto Sol 328-8840 Dinner: Mon-Thu 5:00-10:00pm Prices start at $4.75 408 California Ave, Palo Alto Fri-Sat 5:00-10:30pm, Sun 5:00-9:00pm 947-8888 Õ}iÊiÕÊUÊiÃÌÞiÊ,iV«ià www.sundancethesteakhouse.com
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 31 FREE DELIVERY (with min. order) “THE BEST PIZZA WEST OF NEW YORK” —Ralph Barbieri KNBR 680 Eating Out 226 Redwood 880 Santa Cruz Ave Shores Pkwy Menlo Park Redwood Shores RESTAURANT REVIEW (at University Drive) (Next to Pacific Athletic Club) (650) 329-8888 (650) 654-3333
plewoo Ap d N y! o rt w a Y! D P ER IV L e
a E l
D i
v
e E
e
E
v
R
r
F
a s
! H Michelle Le Michelle Shezan features Tandoori lamb chops on its dinner menu. Gluten-Free Jamshed offers some of his Pizza Now mother’s recipes, and lots of his Available! own. He refined his recipes when helping a friend open a restaurant Some restrictions apply. and train the chef, and in catering he has done from home. Samina is .EW (OURS /PEN -ON 3AT AM n PM s 3UN AM n PM in charge of the desserts, also all 1001 El Camino Real, Menlo Park (650) 324-3486 made in-house. www.applewoodpizza.com “Our spices come in through the side,” is how Jamshed Syed describes his Pakistani tradition. You should be able to close your eyes and know that you’re eating cauliflower, okra or eggplant, rather than being overwhelmed by spices. He variously chops, Michelle Le Michelle Bhindi Masala (okra in garlic, tomato and onion sauce) is one of crushes or juliennes fresh ginger Shezan’s home-style choices. to achieve the correct effect. The meats are halal, in keeping with Muslim practice. Beef shanks Satisfying Shezan are stewed to tender stringiness in nehari ($9.50), a citrus-inflected Shezan offers refined home-style broth dotted with cardamom pods LookLoL okkkinside iinsidenside Pakistani-North Indian fare and ginger. Also excellent, mutton today’s insert by Sheila Himmel do-piazza ($9) features caramel- for savings! ized goat meat, onions and tama- amshed Syed has been a degree in business administration, rind. company controller and an he says, “I learned quite a bit of On the richer side, chicken tikka J accounting professor. He is a cooking.” masala ($9) is bathed in a cream champion bowler in the Northern Shezan is pronounced SHEE- and tomato curry. California Cricket Association. zan (not sheh-ZAN, and definitely Unlike most everything else Since June he’s been running a not sheh-ZAM, a common error). on the menu, the appetizers lean restaurant, and it may be the hard- It means “beautiful,” and reminds heavily on frying. Crispy and hot, est thing he’s done yet. But as the Syed of a restaurant from his child- vegetable samosas ($5) are stuffed chef/owner of Shezan, a home- hood in Pakistan. He and his wife, with potatoes, cilantro and peas style Pakistani-North Indian res- Samina, have reformatted the Cas- and dappled in cumin seeds. taurant in Mountain View, Syed tro Street spot that housed Sue’s Pakistan’s staple grain is wheat, says, “This was the only thing left Indian Cuisine and then Godavari. and it is a predominantly bread- in my dream.” They removed the booths and put eating country. Shezan’s clay Syed came to the United States in cheery white chandeliers and oven produces a lovely plain naan to study, and found himself hun- warm wooden floors. Acoustics ($1.50) as well as naan stuffed Always great gry for the foods of home. He kept have been troublesome in the past, with ground beef ($3.50) and gar- US Club Card
PL calling his mother in Pakistan for but the owners have worked to ad- nished with garlic ($2). Two other
Specials help. While earning his master’s dress the issue. breads are fried. The pan-fried NC Page 32ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ aloo paratha ($3) adds potato and cilantro to the mix. In the plain basmati rice ($2), also good for sopping up sauces, each grain maintains its integrity. 7-10lbs The signature rice dish is Jam- shed’s mother’s bone-in chicken LIGHTER biryani ($9), mildly but plentifully flavored with 11 herbs and spices, In just 6 weeks wafting in saffron. Six week program includes wrap once Shezan’s weekday lunch buffet ($9.99) is a very good deal, includ- a week and herbal supplements. ing chai tea, luscious rice pudding Call for more details. Results can vary. and gulab jamun, the addictive deep-fried dough balls drizzled in syrup. Even the mango ice cream is house-made. The yogurt drinks called lassi also get high marks. A customer reportedly liked Shezan’s mango lassi so much that he downed six glasses at a sitting. N Medical Disaster Preparedness Shezan 216 Castro St., Mountain View Definition: A disaster is a man made or natural emergency/event that 650-969-1112 Hours: Lunch buffet 11:30 disrupts a community’s normal function, and causes concern for the safety, a.m.-2:30 p.m. weekdays. (Regular menu also avail- property and lives of its citizens. A disaster is an event that exceeds the able.) Dinner 5:30-9:30 p.m. capabilities and resources of the community to respond. Mon.-Thurs., 5:30-10 p.m. Fri.-Sat., 5:30-9:30 p.m. During this program, Daniel Huie, MD, will introduce practical principles of Sun. medical disaster preparedness and provide available resources for disaster Reservations Banquet Credit cards Catering Bay Area preparation. You will learn how to be individually prepared for a disaster and Lot Parking Outdoor what community and government resources are available to you. seating Health Spa Beer & Winel Noise level: ÓäxxÊÀ>ÌÊ,`ÊUÊ-ÌiÊ£ää Takeout High Los Altos Highchairs Thursday, October 21 Bathroom 650.390.9727 To register for this event, visit Cleanliness: Wheelchair Very good bayareahealthspa.com 6:30pm – 7:30pm menloclinic.com/prepare or call access 650.721.1411. Seating is limited. 321 Middlefield Rd., Suite 260 Support Local Business Menlo Park, CA 94025
Dr. Daniel Huie is a board certified in Family Medicine and has additional clinical interests in preventive, emergency and wilderness medicine. He is a reserve police officer and tactical officer for the Hillsborough Police Department and the Medical Director for the North Central San Mateo Regional SWAT medics. Dr. Huie Today’s news, completed his medical education at Loyola University’s Stritch School of Medicine in Chicago and medical training at O’Connor Hospital in San Jose, CA. Prior to sports & hot picks joining Menlo Medical Clinic, he was in private practice for over ten years.
A new &!' ! $$! online guide to Palo Alto businesses " ! ShopPaloAlto.com ' $$!- &' "(( & Looking for something to do? Check out the Weekly’s Community Calendar for the Midpeninsula. Instantly fi nd out what events are going on in your city! Go to OPEN HOUSES: ()& -$* " &%" www.PaloAltoOnline )&' - " & %" .com/calendar $&( # '($&/* .$)#( # + ,.+++ &!'"'$& . " '' $#' &!'"'$&
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 33 1ST PLACE BEST SPORTS STANFORD FOOTBALL COVERAGE California Newspaper Publishers Association Lot of Luck Sports certainly goes a long way Shorts Cardinal quarterback has team headed SOCCER NOTES . . . FC Gold Pride teammates and former in right direction after win over USC Stanford standouts Nicole Barn- by Rick Eymer hart and Rachel Buehler have been named to the U.S. Women’s embers of the media who cover Stanford foot- National Team soccer roster and ball on a regular basis had some time on their will represent the United States M hands recently — it is a bye week after all — in the upcoming Confederation and talk turned to Andrew Luck. of North, Central American and It was a few days after he had engineered the game- Caribbean Association Football winning drive last Saturday in Stanford’s thrilling 37- (CONCACAF) World Cup Qualify- 35 Pac-10 victory over USC, in which he drove the ing tournament in Cancun, Mex- Cardinal 62 yards in seven plays in just over a minute ico, Oct. 28-Nov. 8. For Buehler, to set up Nate Whitaker’s 30-yard field goal as time the Pride captain and national expired. team co-captain, and Barnhart, One reporter suggested that Luck could step in, the Women’s Professional Soc- right now, this season, and help several NFL teams. cer Goalkeeper of the Year, the Another one thought he would need at least a week CONCACAF World Cup Qualifying to digest the team’s playbook. No one questioned his tournament will be their first. The ability to do so in any way. United States will open its tourna- So maybe the secret is out: even the most hardened ment on Oct. 28 against Haiti, of cynics have a healthy respect for Luck’s ability as face Guatemala on Oct. 30 and a quarterback. finish Group B play against Costa Stanford coach Jim Harbaugh, who spent 15 years of his life as a quarterback in the NFL, calls Luck “the Rica on Nov. 1. finest football player I’ve ever been around and he’s one of the finest people Iíve ever been around.” LOCAL COLLEGIANS . . . Fresh- Added former Stanford quarterback Guy Benja- man Alexandra Groetsema from min: “He sure could be the best Stanford ever had. He Palo Alto High fired an even-par seems to be very, very developed in his play. He seems 71 to lead the first day of play Sat- to be at a junior or senior class level.” urday at the Williams Fall Classic That’s high praise, considering that former Stanford on the 5,128-yard layout at Tacon- Jim Shorin/stanfordphoto.com quarterback Jim Plunkett (who was in attendance at ic Golf Club in Williamstown, Ma. the USC game) did win the Heisman Trophy. That is the lowest round ever by Luck, a redshirt sophomore, has been preparing for a Williams College woman. She this most of his life without even realizing it. Yes, his had an 11-shot lead in individual father, Oliver Luck, was also a quarterback in the NFL play and the Ephs led in team play so there is some heredity involved. by 13 shots over Amherst. Gro- Yes, he’s a terrific student and devours information etsema followed up her first round in much the same way Hall of Fame quarterback Steve with a 78 on the second round Young did with Bill Walsh’s complicated system with to take medalist honors (149) by the San Francisco 49ers. eight shots and lead Williams to Stanford quarterback Andrew Luck had plenty to celebrate after driving the Cardinal 62 yards in the win. She tied the Williams just over a minute to set up the game-winning field goal in a 37-35 win over USC last weekend. (continued on page 38) record for lowest two-round total . . . Menlo-Atherton grad Vaughn Smith and Palo Alto High grad PREP WATER POLO PREP FOOTBALL James McCollough both contrib- uted to College of San Mateo’s 45-0 victory over Los Medanos Revenge is sweet Bono has a chance College on Saturday as the Bull- dogs completed a 5-0 nonconfer- as M-A girls move to really contribute ence schedule. The Bulldogs ran for 349 yards with Smith carrying closer to PAL title to Paly’s season 10 times (for a season-low) 62 yards. CSM held the Mustangs by Keith Peters by Keith Peters to 152 yards of total offense. Mc- his could have been the season that alo Alto senior quarterback Christoph Collough had four tackles, three someone other than Menlo-Atherton Bono will enjoy taking the field Friday unassisted. In another community T won the PAL Bay Division girls’ water P night to face Los Gatos in a showdown college game, Palo Alto High grad polo title. The Bears, after all, had lost seven for the SCVAL De Anza Division champion- Mike Scott caught touchdown standout seniors from last season’s team that ship at 7:30 p.m. It sure beats what he was passes of 37 and 15 yards to help went 27-2 and finished second in the Central doing last season at this time. Foothill College blast visiting West Coast Section Division I finals. After guiding the Vikings to a 4-1 record Valley College, 62-0, on Saturday. Included in that group of graduates was in 2009, Bono suffered a broken clavicle in Scott finished with three catches two-time CCS Division I Player of the Year his (right) throwing shoulder. He missed the for 61 yards. Becca Dorst. remainder of the season as Paly finished 3-1-2 While Menlo-Atherton opened this season without him, suffering a 34-7 blowout loss to ON THE AIR with a handful of talented holdovers from the Bellarmine in the first round of the Central past two seasons, including reigning CCS Di- Coast Section Open Division playoffs. Friday vision I Goalie of the Year Emily Dorst, the This season, Bono made it through the first Women’s volleyball: Washington at talent level just wasn’t the same. five games with a 5-0 mark and, more impor- Stanford, 7 p.m.; KZSU (90.1 FM) That appeared evident on Sept. 11 when tantly, without a season-ending injury. Saturday Castilleja handed Menlo-Atherton a 4-2 de- He’ll lead the Vikings against the Wildcats Women’s volleyball: Washington St. at feat in the third round of the St. Francis Au- (2-0, 3-1-1) in a showdown game that most Stanford, 7 p.m.; KZSU (90.1 FM)
tumn Invitational. Keith Peters likely will decide the division champion. Palo “The last time we played them, they abso- Alto captured last season’s title with a 4-0-2 READ MORE ONLINE lutely shut us down,” M-A coach Chris Rubin mark as Bono missed all but one league out- www.PASportsOnline.com said of that surprising loss to the Gators. ing. For expanded daily coverage of college In the past four weeks, the Bears refocused “I guess it was hard to watch, instead of and prep sports, please see our new Menlo-Atherton senior goalie Emily Dorst had 16 site at www.PASportsOnline.com (continued on page 41) saves in a 6-3 win over Castilleja on Wednesday. (continued on page 37) Page 34ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ MENLO PARK MID-PENINSULA 14TH ANNUAL SIDEWALK IGH CHOOL ARTS & CRAFTS FALL FEST H S SANTA CRUZ AVENUE DOWNTOWN MENLO PARK OCTOBER 15 $ 16 $ 17 FRIDAY, SATURDAY & SUNDAY 10 AM - 5 PM FALL OPEN HOUSE 90 PROFESSIONAL ARTISTS Saturday, October 23, 2010
Presented by Menlo Park No RSVP is necessary 10:30-12pm Mendy Marks Chamber of Commerce A PACIFIC FINE ARTS FESTIVAL pacificfinearts.com
HE EARNED HIS B.S. IN INDUSTRIAL AND LABOR RELATIONS FROM CORNELL UNIVERSITY, A J.D. CUM Choose a small, caring, innovative high school LAUDE FROM UNIVERSITY OF PITTSBURGH, AN M.A. 1340 Willow Road, Menlo Park, CA 94025 (650) 321-1991 IN POLITICAL SCIENCE FROM UNIVERSITY COLLEGE www.mid-pen.com LONDON, AND AN M.A. IN EDUCATION FROM UNIVERSITY OF MICHIGAN. Drew loves helping students learn to interpret and analyze historical sources. He says, “…students can use the skills of critical analysis and synthesis to become careful contributors and consumers of information throughout life.”
He’s an admitted “recovering lawyer” and welcomes any lawyer joke you may know. When he’s not teaching, he can often be found playing soccer, trail running, or longboarding.
Drew earned academic acclaim with several awards and fellowships including: University of Michigan School of Education Scholar Award, University of Michigan Regents Fellowship, the Rebmann & Calloway Cornell Tradition Scholar, and the Cornell Tradition Fellowship.
He hopes his students become more informed and empathetic members of society through the study of different cultures in a historical context.
His favorite quote is: “Tell me and I’ll forget. Show me, and I may not remember. Involve me, and I’ll understand.” - Chinese Proverb DREW CIANCIA ONE OF THE MANY REASONS TO SEND YOUR CHILD TO: October 30 at the Palo Alto Baylands
Woodside Priory School Event Details: 100% of funds raised go to help Admissions Office 10:20 am 10k Run local youth and teens be healthy. 302 Portola Road, Adults: $35 Portola Valley, CA 94028 10:25 am 5k Walk/Run USATF Certified Course Youth: $10 www.PrioryCa.org YMCA Members get a $5 discount OPEN HOUSE for Prospective Students and Families Saturday, Nov. 13th, 2010 at 10 a.m. Lucile Packard Children’s Hospital Wednesday, Nov. 17th, 2010 at 7 p.m. AT STANFORD Saturday, Dec. 4th, 2010 at 10 a.m. Palo Alto Family YMCA For information and to R.S.V.P. contact Admissions at 650. 851. 8223 Register Today! www.marshmadnessrun.org
*>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 35 Page 36ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Sports
Uniform Complaint Procedure
Title IX Violations, Discrimination and Harassment. District programs and activities are free from discrimination and harassment, with respect to ethnicity, religion, gender, age, color, race, ancestry, national origin, sexual orientation, marital or parental status and physical or mental disability. The board desires to maintain an environment in which all students and adults are treated with dignity and respect. No student shall be subjected to sexual overtures or conduct either verbal, visual, or physical, which are intimidating, hostile, offensive, or unwelcome. Such conduct by adults or students is deemed unacceptable and will not be tolerated by the school district. (EC 48980)
The board prohibits intimidation or harassment of any student by any employee, student or other person in the district. Students who harass other students shall be subject to appropriate counseling and discipline, up to and including expulsion. (BP 5145.3)
The Board ensures equal opportunities for all students in admission and access to the
Jim Anderson educational program, guidance and counseling programs, athletic programs, testing procedures, and other activities. Eligibility for choral and cheerleading groups is determined solely on the basis of objective competencies. School staff and volunteers carefully guard against segregation, bias and stereotyping in instruction, guidance and Injured a year ago at this time of the season, Palo Alto senior supervision. However, separate provisions may be made for students according to sex quarterback Christoph Bono is healthy and off to a 5-0 start. with respect to such matters as protection of modesty, family life and sex education, Los Gatos averaging 28 points while grading standards in physical education, and choral groups. Paly football allowing just 10 per game. The (continued from page 34) Wildcats are averaging 18 points The district follows uniform complaint procedures when addressing complaints alleging while giving up an average of just playing,” said Bono, who actu- over 10. unlawful discrimination based on ethnic group identification, religion, age, gender, color, ally didn’t mind watching his team Palo Alto coach Earl Hansen says or physical or mental disability. All complaints will be handled in a professional manner, plaster Los Gatos, 34-12, on the Vi- his team is ready for the challenge. and complainants are assured of non-retaliation and not-retribution. kings’ field. “It’s a championship week, be- “We played really well and that cause no one else is going to beat wasn’t as hard to watch,” Bono said. them,” he said. Any person who wishes to discuss or file a complaint based on discrimination or “The Homestead game (a 20-20 tie) Los Gatos already has played harassment should first seek remedy through the office of the school’s principal. was the most frustrating and we Wilcox and Milpitas, the preseason Depending on the nature of the complaint and/or if the complainant feels that the issue should have won the Wilcox game contenders along with Palo Alto, and (another tie, 14-14).” beaten them both. The Chargers fell has not been satisfactorily resolved, a written statement may be filed with the principal While Bono rehabbed his shoul- 17-9 and the Trojans were toppled and a copy sent to the Associate Superintendent for Educational Services. If the issue der, he wasn’t idle. 23-6. Paly beat Wilcox 28-15 and cannot be resolved at the level of the principal, a formal complaint should be filed with “I watched and tried to keep my- will play at Milpitas on Oct. 22. self involved in the games,” he said. After that, the Vikings have a the District’s Title IX compliance officer, the Associate Superintendent for Educational “I tried to look at things, helping home game against Homestead, a Services Brigitte Sarraf. After a complaint has been duly investigated and if the the defense and offense; just tried nonleague game at Mountain View complainant is dissatisfied with the District’s decision, the complainant may file a written to help the team.” and a league finale at home against appeal with the Board of Trustees or the California Department of Education within 15 Bono is doing that once again, Saratoga. only this time on the field. He has While the Wildcats aren’t as of- days of receiving the District’s decision. completed 61 of 92 passes (.663 fensively talented as in previous percent) for 841` yards and nine years, running back Garret Zeiter If the complainant is unable to put a complaint in writing due to conditions such as touchdowns. He has thrown only did gain 260 yards on the ground two interceptions while averaging against Milpitas (on 48 carries) and illiteracy, language barriers, or other handicap, district staff shall help him/her to file the 168.2 yards per game. had 193 rushing yards against Wil- complaint. Bono has plenty of talented tar- cox. gets this season in senior Davante Los Gatos QB Hayden Hibberd, Adams (23 catches for 330 yards), however, is no Trent Edwards. He Complainants may pursue other remedies, including actions before civil courts or other senior Maurice Williams (8 for 151), threw for a combined 75 yards in public agencies. Complainants may seek assistance from agencies such as legal Michael Cullen (12 for 157) and T.J. those two victories. assistance, local mediation centers or from private attorneys. Braff (7 for 85). Palo Alto has gone 3-4 against “I think we have a pretty good Los Gatos in the past five years and game plan,” Bono said for Los Ga- 0-5 the five preceding seasons for Any individual, public agency of organization may file a written complaint of alleged tos. “I’m not sure how they’re going an unspectacular 3-9 in the past de- noncompliance with state and federal law. The complaint must be initiated no later than do on defense, whether they try to cade. six months from the date when the discrimination is alleged to have occurred or when shut down our passing game. But, “That’s still better than the previ- I think they’ll have to respect our ous 10 years,” Hansen said. the complainant first obtained knowledge of the facts of the alleged discrimination. running game.” These past five years, however, Helping open up the Paly pass- have showed Palo Alto’s consisten- Complaints regarding school procedures, practices and personnel. Complainants ing game has been the running of cy as an elite program. The Vikings are encouraged to resolve complaints against school personnel through informal means juniors Dre Hill (43 carries for 363 have gone 47-12-2 and reached the yards) and B.J. Boyd (20 fore 216). postseason all five times, playing for by talking directly with the school person involved. If this is not successful, a written Both are finally learning better a CCS title four times while win- complaint may be directed to the employee’s administrative supervisor or principal. blocking techniques, as well, which ning twice (in 2006 and ‘07). Appeals from administrative determinations or decisions may be taken up with the takes some pressure off of Bono. Coming off a 49-14 victory over “As long as we can establish both Gunn last week, Palo Alto is headed Associate Superintendent of Personnel, who will make decisions on these matters. After (running and passing), we’ll be in that postseason direction once consultation with the superintendent, any patron may address the Board of Trustees at a fine,” Bono said. again. And this time, Christoph regular meeting. Palo Alto (2-0 in league) comes Bono is enjoying the action first- into its annual grudge game with hand. N *>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 37 Sports
In reality, he’s already churning the dious practice in summer and spring age is better and his passing yard- of the season? There’s no easy path Stanford football new information around in his head workouts have helped shaped Stan- age (1,538) is up. Luck ranks 10th but Stanford could be looking at a (continued from page 34) and seems to grasp Harbaugh’s con- ford’s success to date. nationally in passing efficiency major bowl game come the postsea- cepts before the coach has finished The regular season hit its midway (166.9), 16th nationally in total of- son. Perhaps Luck’s strength is how explaining them. point with the USC game and third- fense (296.7) and is 13-5 in 18 career After this weekend every team quick he can adapt and turn class- Luck also has a tendency to accept place Stanford (2-1, 5-1) seems starts. will have played at least three con- room knowledge into production on too much blame for when things go poised to improve its record from Stanford’s rushing attack, with ference games and it’s just as likely the gridiron. wrong. That’s probably because he last season. Stepfan Taylor and Luck at the fore- there will be a five-way tie for sec- Young possesses a photographic thinks he gets too much credit for Under Harbaugh, the Cardinal front, has been solid too. The Car- ond place behind undefeated and memory and had a knack for pro- when things go right. The young has gone 2-4, 3-3, 4-2, and now 5-1 dinal averaged 218.2 yards on the second-ranked Oregon, which is in cessing information with the speed man is a fierce competitor and a over its first six games. Stanford ground last year. That figure has contention for a spot in the national and accuracy of a computer chip. loyal teammate. went 2-4, 2-4 and 4-2 over its last ‘fallen’ all the way to 210.5 yards a championship game. Luck, it has been suggested, is He stood up for the running backs six games (not including last year’s game this season. Should the Ducks play in the known for memorizing information who had to endure comparisons to Sun Bowl, which Luck missed due As a team last season the Cardi- national title game, a berth in the as it’s written on the chalkboard. Stanford’s record-breaking back to injury) in each of the previous nal averaged 209.4 passing yards a Rose Bowl becomes wide open, and There’s a story circulating that as Toby Gerhart early in the season. three seasons. game. This year: 260.5. Stanford Stanford hasn’t qualified for over 10 Harbaugh begins to explain his game He’s talked up his offensive line Luck threw 13 touchdown passes also ranks No. 5 nationally with years. plan for the week, Luck humors his and wide receivers. He constantly all of last year. He has 16 already 43.3 points per game. But, the Cardinal does have Luck coach by writing everything down. points out how important every te- this season. His completion percent- What does it all mean for the rest on its side. N
ѕђȱǯȱ ђѠѠȱѕђћѠќћȱђѐіѡюљȱ
Don Feria/stanfordphoto.com ђџіђѠȱюѡȱѡюћѓќџёȱ Stanford defender Delano Howell helped upend USC receiver Jordan ;]VLIa7K\WJMZ I\"XU Cameron (84) and the Trojans last Saturday, 37-35. 4)=:),-+0-:?)A<-[WXZIVW_Q\P STANFORD ROUNDUP 6)<0)41-.7:<16XQIVWIVL It’s just another busy weekend -4)16-<07:6*=:/0PIZX[QKPWZL for top Stanford teams at home 8:7/:)5" Page 38ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Sports be Menlo School grad Jamin Ball, Field hockey Stanford roundup Daniel Ho, Fawasz Hourani, Ted Stanford has been in the national (continued from previous page) Kelly and Walker Kehrer. rankings for a school-record 16 con- secutive weeks, dating to Sept. 18, late former Stanford coach George Women’s soccer 2009. Haines, who coached the Cardinal Christen Press set Stanford’s ca- The Cardinal (8-3) entered last from 1981 to 1988, producing two reer goals mark last Friday, when Richard C. Ersted/stanfordphoto.com week ranked No. 17 in the country Pac-10 titles and the 1983 NCAA she scored on a 20-yarder against and routed Harvard 6-0 in its only title. In his seven years at The Farm, USC at the Los Angeles Coliseum match. Instead of climbing in the Haines’ teams never finished lower in a 2-1 victory. She also owns the polls, Stanford actually dropped than third at the NCAA meet. all-time school scoring record. three spots to No. 20. Stanford comes in after a run- The top-ranked Cardinal (3-0, A win over 8th-ranked Syracuse nerup national finish at last year’s 11-0-2) hosts Washington State at 5 (8-4) at 9 a.m. (PT) in Albany, N.Y. NCAA Championships. Under p.m. Friday and Washington at noon would certainly solidify Stanford’s sixth year head coach Lea Mau- Sunday. position in the rankings. rer, a former Olympic medalist for The Orange has all three previous the Cardinal, Stanford won its first Men’s soccer meetings with Stanford, though they conference title since 2005 and 17th After gaining its first win in Pac- last met five years ago. overall. 10 play, Stanford (1-2, 5-6) will try Stanford’s goalie Brian Pingree earned MPSF honors this week after Stanford is at Rutgers Sunday and To go along with the No. 1 rated to improve its standing in the con- sparking a 5-3 upset of No. 1 USC last weekend. Northeastern on Monday. recruiting class in the nation, the ference with a pair of home matches The Cardinal features a balanced Cardinal feature features: Kate this weekend and it’s not going to Women’s volleyball Most of the top teams in the na- offensive attack in which 15 dif- Dwelley (freestyle), Betsy Webb be easy. No. 2 Stanford’s loss at UCLA on tion will be in attendance as the ferent players have scored goals. It (sprints), Sam Woodward (sprints) First up is unbeaten UCLA (3-0, Saturday ended a 14-match season- course is also used for the NCAA is led by junior forward Stephanie and Liz Smith (breast) among its top 8-2) as the back end of a men’s and opening win streak and dropped championships in November. Byrne, who has 13 points, with five competitors. women’s soccer doubleheader. The the Cardinal to No. 2 in the AVCA The men are ranked No. 1 and goals and three assists. Becky Dru Haines, of course, has an extend- Cardinal and 13th-ranked Bruins rankings. Stanford (14-1, 5-1) is in are the defending team champions has four goals and a team-high four ed influence on Bay Area swim- square off at approximately 7:30 a three-way tie for first in the loss of the event. The women are ranked assists. Junior goalkeeper Alessan- ming. The Hall of Famer founded p.m. column with Cal (15-1, 5-1) and No. 17 and are looking to raise its dra Moss has an 1.36 goals against the highly-successful Santa Clara San Diego State (1-2, 7-3) comes Washington (15-1, 4-1). The Cardi- ranking. average and 33 saves. N Swim Club in 1950, eventually to Stanford for a 2:30 p.m. match nal hosts No. 7 Washington on Fri- coaching 26 future Olympians. He Sunday, also following a women’s day at 7 p.m., Washington State at 7 also coached on seven U.S. Olympic match. p.m. Saturday and California next teams. Stanford earned an overtime win Friday at 7 p.m. PALO ALTO CITY COUNCIL Stanford is the host site for the at Oregon State in its last appear- The Cardinal leads the nation in CIVIC CENTER, 250 HAMILTON AVENUE men’s Intercollegiate Tennis Asso- ance. Dominique Yahyavi scored the kills per set (15.06), and is second BROADCAST LIVE ON KZSU, FM 90.1 ciation Northwest Regional Cham- golden goal in the 107th minute. in the country with a .324 hitting CABLECAST LIVE ON GOVERNMENT ACCESS pionships, which runs through “Dom is an explosive player with percentage and 14.10 assists per set. CHANNEL 26 **************************************** Sunday at the Taube Family Tennis the ability to break down defenses Senior Alix Klineman is among the THIS IS A SUMMARY OF COUNCIL AGENDA ITEMS. Stadium. on ball,” Stanford coach Bret Simon national leaders in kills (5.63, 2nd), THE AGENDA WITH COMPLETE TITLES INCLUDING LEGAL In addition to host Stanford, the said. points (6.16, 3rd) and hitting per- DOCUMENTATION CAN BE VIEWED AT THE BELOW WEBPAGE: event will showcase top players Galen Perkins made his first two centage (.382, 30th). http://www.cityofpaloalto.org/knowzone/agendas/council.asp from California, Eastern Washing- career starts over the weekend, al- Stanford has out hit its opponents ton, Fresno State, Gonzaga, Oregon, lowing two goals in 197 minutes in all 15 matches this season. In fact, (TENTATIVE) AGENDA-SPECIAL MEETING- COUNCIL CHAMBERS Pacific, Portland, Portland State, for a goals-against average of 0.91. the Cardinal has hit .250 or better in OCTOBER 18, 2010 - 5:15 PM Sacramento State, Saint Mary’s, He recorded his first career shutout all 14 of its wins. CLOSED SESSION San Francisco, San Jose State, Santa against Oregon State. Senior libero Gabi Ailes leads the 1. PUBLIC EMPLOYEE APPOINTMENT - Title: Acting City Auditor Clara, UC Davis, Washington and “He has great hands and good conference with 5.09 digs per set COUNCIL CONFERENCE ROOM Washington State. mobility,” Simon said. “He is brave in conference only matches, while 6:00 PM to 7:30 PM The singles finalists and doubles and confident in the goal.” Klineman is the Pac-10 leader in 2. Joint Meeting With the Utilities Advisory Commission Regarding champion from each of the 24 re- Yahyavi leads the Cardinal in conference matches in kills (6.68), Utilities Issues gionals earn a berth to the ITA Na- scoring with five goals and 11 hitting percentage (.396) and COUNCIL CHAMBERS tional Intercollegiate Indoor Cham- points. Bobby Warshaw, who has points (7.02). Klineman also ranks 7:30 PM to 8:30 PM pionships, scheduled to begin Nov. led Stanford in points the previous amongst the top-10 in dig per set in 3. Status Report on the East Meadow Circle/Fabian Way and California 4 in Flushing Meadows, N.Y. three years, has three goals from his conference matches (3.14, 10th). Avenue/Fry’s Area Concept Plans (Continued from 10/04/10) Ten Cardinal players will compete central defender position. 4. Adoption of a Resolution to Karen Smith for 34 Years of Service in singles action this weekend. Ryan Stanford and UCLA have an in- Men’s water polo 5. Appointments for the Library Advisory Commission for Two Thacher enters the weekend as the teresting history. The Cardinal owns Stanford (1-0, 7-4) moved into Unexpired Terms tournament’s No. 2 seed while Alex a 3-2-4 mark against the Bruins in fourth in the CWPA Top 20 rank- 6. Appointments for the Public Art Commission for Two Unexpired Clayton (No. 3), Greg Hirshman their past nine meetings. That comes ings Wednesday but there’s more Terms (No. 9), Denis Lin (No. 9) and Matt on the heels of a nine-match losing work ahead. 7. Proclamation for the United Nations Association Film Festival Kandath (No. 17) are also seeded. streak to UCLA dating to a tie dur- The Cardinal, which beat top- 8. Update on City’s Water System Cross Connection Control Program Also in action for Stanford will ing the 2001 season. ranked USC at home last Saturday, 9. 2 nd READING Amendment to the Municipal Code to reflect those has a chance to make another move employees who are allowed to issue citations this weekend when it travels to No. 10. Approval of Three Year Maintenance Contract With Accela, Inc. for 3 UCLA (1-1, 9-3) for a 7 p.m. con- Permit Tracking Application in the Amount of $339,158 test Friday night in an important 11. Approval of $2.5 Million Loan from Residential Housing Fund for Mountain Pacific Sports Federation Affordable Rental Project at 488 W. Charleston Road match. 12. Cancellation of Monday, November 15 Regular Council Meeting and Stanford also plays at No. 6 UC Setting of Monday, November 22 Special Council Meeting Santa Barbara (9-4) at noon Sunday. 13. Appointment of Interim City Attorney The Gauchos handed Stanford one of 14. Recommendation From UAC Ad-Hoc Committee Regarding Role of its losses at the SoCal Invitational. the Utilities Advisory Committee UCLA has lost two of its last three, 15. Public Hearing: Community Development Block Grant Citizen splitting a pair of MPSF contests last Participation Plan weekend. The Bruins fell, 11-8, to 16. Recommendation of an award of contract for Golf Course Richard C. Ersted/stanfordphoto.com California and beat Pacific, 10-9. maintenance responsibilities and the purchase of used golf course UCLA beat the Cardinal in the equipment semifinals of the NorCal Invita- tional earlier in the season. STANDING COMMITTEE MEETINGS The Bruins are led by Menlo School grad Ben Hohl, who has a The Finance Committee Meeting will be held on Tuesday, October 19, team-high 22 goals. at 7:00 p.m. regarding: 1) Library Bond Oversight Committee Quarterly Report, 2) Report on Alternatives for Landfill and Composting Operations Cross country and Staff Recommendation for Operational Changes Stanford returns to action this weekend as both the men’s and The High Speed Rail Committee Meeting will be held on Thursday, October women’s teams will compete at the 21, at 8:00 a.m. regarding: 1) Discussion of HSR Station Community Stanford senior Christen Press (right) became the school’s all-time NCAA Pre-National meet in Terre Workshop, 2) Discussion of Letter to Peninsula Corridor Joint Powers leader for career goals in women’s soccer last weekend. Haute, Ind., on Saturday. Board, 3) Contracts Update and 4) Legislative Update *>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 39 Sports Roller & Hapgood & Tinney PREP FOOTBALL THIS WEEKEND The Peninsula’s Premier M-A (1-0, 2-3) at Aragon (0-2, 2-3), Palo Alto. The Titans simply were outmanned Funeral Service Friday, 3 p.m. against the best public school football team in the Central Coast Section and one of the best football The Bears are coming off a big 35-14 victory over and Cremation Provider teams (period) in the section. The Titans actually King’s Academy to open the PAL Bay Division and led 7-0 after two nifty pass plays by Anthony Can- are averaging 34.5 points in their past two wins non to Matt Mertz that gained 50 and 15 yards Serving all faiths since 1899 after an 0-3 start. The Bears’ latest effort came in with the second one going in for a touchdown to their Homecoming game, which had to be played Offering Pre-need Arrangements give Gunn a 7-0 lead with 9:50 to go in the first at Sequoia High when a court injunction blocked quarter. 980 Middlefield Rd, Palo Alto, California 94301 the use of temporary lights at M-A. No matter, the (650) 328-1360 Bears made the best of it with a huge win, bat- Pinewood (2-0, 3-1) at Cornerstone tling back from a 14-0 deficit in the second quarter Christian (0-5), Saturday, 1 p.m. and scoring 35 unanswered points. M-A now The Panthers look to add another victory against www.rollerhapgoodtinney.com has outscored the opposition by 69-20 in its past a team that forfeited to Priory last weekend. Pin- two games. The Menlo-Atherton offensive line Se Habla Español ewood, meanwhile, is coming off a 48-12 victory Funeral Home FD132 had a lot to do with the comeback as the Bears over Alma Heights that saw Dante Fraioli score rushed for a remarkable 320 yards on 39 carries. two touchdowns in the Coastal Athletic League M-A head coach Sione Taufoou singled out Noah game. John Bennett took over as the team’s QB Stid, Taylor Karis, Ricky Vea, Ausia Mataele, and also produced two touchdowns, one throwing Tiulipe Lolohea and Semisi Mataele for opening and one rushing. PALO ALTO UNIFIED SCHOOL DISTRICT holes for running backs Cameron Moody (15 car- ries, 112 yards) and Junior Sakalia (nine carries, King’s Academy (0-1, 3-2) at SHP 83 yards), who accounted for four touchdowns. (0-1, 4-1), Saturday, 2:30 p.m. Moody scored on runs of 12, two and seven yards The Gators find themselves in an unusual position Notice is hereby Given that proposals will be received by the Palo Alto after Sakalia had run one in from 25 yards in the this weekend, having to bounce back from a tough Unified School District for bid package: second quarter to make it a 14-7 game at halftime. loss. SHP failed to score in the second half and The Bears’ defense also was outstanding as it lost a 13-9 decision to visiting Burlingame to open Contract Name: Interactive White Board & Classroom Audio system picked off two passes and recovered four fum- the PAL Bay Division Division. “We have to bounce bles, turning three of the recoveries into TDs. back,” said SHP’s Colin Terndrup, who gained 80 Contract No. WBS-2 & WBS-3 San Mateo (0-1, 2-3) at Menlo (1-0, yards rushing but was kept out of the end zone against Burlingame. “We just have to get better DESCRIPTION OF THE WORK: The work includes, but is not limited 4-1), Friday, 3:30 p.m. and come back stronger.” The Gators seemed well to: The supply and installation of Interactive White Boards and Classroom The Knights hope to have more than just Home- on their way to the go-ahead score after taking Audio Systems at four elementary schools and one middle school. Work coming to celebrate in their home opener. Menlo over at midfield following a short punt. Their final includes the removal and disposal of older existing Interactive White comes in averaging 36.2 points a game while giv- drive began with 5:28 showing on the game clock. Board, the removal and replacement of standard white boards, Installation/ ing up just 14. Senior quarterback Robert Wick- Quarterback John Geary and Tomas O’Donnell Modification of tack able wall surface. Patch and paint wall surfaces as may ers, who threw for a career-high 325 yards and hooked up on a 15-yard pass play to jump start be necessary. Bidding documents contain the full description of the work. two touchdowns to pace the Knights to a 40-22 the drive and Pedro Robinson picked another 20 thumping of host Half Moon Bay in a PAL Ocean yards on three carries. Tyler McCool, who caught There will be a mandatory pre-bid conference and site visit at 1:00 p.m. on Division opener last Friday night, has completed a 14-yard touchdown pass from Geary with 18 October 27, 2010 starting at the District Facilities Office located at 25 82 of 121 passes for 1,251 yards and 14 TDs. He’s seconds left in the first half, and Terndrup also Churchill Building D. Palo Alto, California averaging 250.2 yards per game. Senior running made clutch runs. Terndrup got the Gators a first- back/linebacker Beau Nichols also had a big and-goal at the six. Robinson went wide right and Bid Submission: Proposals must be received at the District Facilities game against HMB, rushing for 106 rushing yards seemed to be headed into the end zone just as Office building D, by 10:00 a.m. for WBS-2 and 10:30 a.m. for WBS-3 and scoring four TDs in addition to catching seven Burlingame’s Deke Marquardt knocked him out of on November 15, 2010. passes for 85 yards and another score. He also bounds inches short. Geary didn’t go anywhere intercepted a pass while playing both ways. Tim on a quarterback sneak, leaving the final inch or Bonding required for this project is as follows: Bid Bond 10% of the total Benton caught six passes for 111 yards. so to Terndrup, who was met at the line of scrim- bid, Performance Bond to be 10%, Payment Bond is to be 10%. Saratoga (0-1, 2-2) at Gunn (0-1 mage and driven back. PREVAILING WAGE LAWS: The successful Bidder must comply (3-2), Friday, 7:30 p.m. Priory (2-2, 3-2) at Anchorpoint with all prevailing wage laws applicable to the Project, and related The Titans will need to bounce back after drop- Christian (2-0, 5-0), Saturday, 7 p.m. requirements contained in the Contract Documents. ping a 49-14 decision to host Palo Alto to open The Panthers will be facing the league’s most the SCVAL De Anza Division season last week- dominant team, which has outscored the op- Palo Alto Unified School District will maintain a Labor Compliance end. ìThat a great football team,î Gunn coach position, 140-32, in the past two games. Priory, Program (LCP) for the duration of this project. In bidding this project, Bob Sykes said about Palo Alto. ìThey have no meanwhile, picked up a forfeit over Cornerstone the contractor warrants he/she is aware and will follow the Public weaknesses.î Sykes had reason to be impressed Christian last weekend. Works Chapter of the California Labor Code comprised of labor code as even after Gunn hit some milestones against -- compiled by Keith Peters sections 1720 – 1861. A copy of the Districts LCP is available for review at 25 Churchill Avenue, Building D, Palo Alto, CA 94306. 1. A pre-job conference shall be conducted with the contractor or subcontractors to discuss federal and state labor law requirements applicable to the contract. Menlo girls improve to 174-0 in league 2. Project contractors and subcontracts shall maintain and furnish to the District, at a designated time, a certified copy of each payroll with tennis duals; Palo Alto volleyball 24-0 a statement of compliance signed under penalty of perjury. 3. The District shall review and, if appropriate, audit payroll records to he Menlo School girls’ ten- umphs end soon. Menlo will be in Dana Point in verify compliance with the Public Works Chapter of the Labor Code. nis team has not lost a league Sophomore Giannina Ong rallied Southern California this weekend 4. The District shall withhold contract payments if payroll records are T match since the end of the from a 5-1 deficit in the second set for the annual National Invitational delinquent or inadequate. 1993 season. If victories over Hark- to pull out a 4-6, 7-5 (default) vic- tournament. 5. The District shall withhold contract payments as described in the er and Castilleja this week were any tory at No. 1 singles to pace Menlo. Castilleja dropped a 7-0 decision LCP, including applicable penalties when the District and Labor indication, the Knights’ streak will Her opponent had to default when to host Sacred Heart Prep in anoth- Commissioner establish that underpayment of other violations has remain intact for another season. she began to get leg cramps late in er WBAL Foothill Division match occurred. Menlo improved to 6-0 this sea- the second set. on Tuesday. SHP (3-2, 10-5) swept son in West Bay Athletic League Freshman Kristy Jorgensen con- the singles while losing only five Bidders may examine Bidding Documents at Facilities Office, Building (Foothill Division) play with a 7-0 tinued her excellent play with a 6-1, games. “D”. Bidders may view the Plans and Specifications at the Districts triumph over Castilleja on Wednes- 6-3 win at No. 2 singles while fresh- In the PAL Bay Division, Men- Facilities office. day. On Tuesday, Menlo produced a man Christine Eliazo won at No. lo-Atherton (7-2, 8-4) took care of 6-1 triumph over host Harker. The 3, 6-0, 7-5, and sophomore Laura host Half Moon Bay, 6-1. The Bears All questions can be addressed to: Knights (11-2 overall) now have Gradiska posted a 6-1, 6-3 triumph swept the doubles and lost only at won 174 straight league matches and at No. 4 for the youthful Knights. No. 2 singles where M-A’s Julia Palo Alto Unified School District 25 Churchill Avenue, Building D have captured 16 consecutive league Menlo had only three seniors in Sommer fell in three sets, 1-6, 7-5, Palo Alto, CA 94306-1099 crowns since 1994. the lineup against Harker and only 10-4. Attn: Alex Morrison Harker appeared to be the only one, Lauren Robinson at No. 3 dou- M-A senior Paige Keating slugged Phone: (650) 329-3927 WBAL team with a chance to end bles, suffered a loss. it out for more than two outs with Fax: (650) 327-3588 that streak this season, but Menlo Against Castilleja, the Knights Simone Vandroff before securing showed Tuesday that it’s not ready lost only seven games while sweep- to see its remarkable string of tri- ing the singles. (continued on page 42) Page 40ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ Sports NOTICE OF A SPECIAL PUBLIC MEETING of the Palo Alto Planning & Transportation Commission Please be advised the Planning and Transportation Commission (P&TC) shall conduct a special meeting at 6:00 PM, Wednesday, October 27, 2010 in the Civic Center, Council Chambers, 1st Floor, 250 Hamilton Avenue, Palo Alto, California. Any interested persons may appear and be heard on these items. Staff reports for agendized items are available via the City’s main website at www.cityofpaloalto.org. and also at the Planning Division Front Desk, 5th Floor, City Hall, after 2:00 PM on the Friday preceding the meeting date. Copies will be made available at the Development Center should City Hall be closed on the 9/80 Friday. AT 6:00 PM NEW BUSINESS. Study Session: 1. Update on the Highway 101 Pedestrian/Bicycle Overpass/Underpass Keith Peters Feasibility Study AT 7:00 PM 2. Preliminary discussion and direction to staff regarding the draft California Despite tight defense by Castilleja senior Natasha von Kaeppler (2), Menlo-Atherton senior MJ O’Neill was Avenue Concept Area Plan able to score a pair of goals during the Bears’ 6-3 win over the Gators in a PAL Bay Division showdown. Questions. Any questions regarding the above applications, please contact the Planning Department at (650) 329-2440. The files relating to Water polo while the Bears grabbed a 4-1 lead Pippa Temple added two goals each these items are available for inspection weekdays between the hours of (continued from page 34) on two goals by O’Neill and junior for the Gators (5-0, 14-1), who have 8:00 AM to 5:00 PM. This public meeting is televised live on Government Emily Gran, whose second goal only one league match remaining — Access Channel 26. made it 4-1 and came after Cas- against Mitty on Oct. 28. their efforts on who the key op- tilleja hole defender Grace Arnold SHP next will compete in the Da- ADA. The City of Palo Alto does not discriminate against individuals with posing players are and how best to picked up her third ejection — put- vis Fall Classic on Friday, where the disabilities. To request accommodations to access City facilities, services defend them. In addition, M-A con- ting her on the bench the remainder Gators may have an opportunity to or programs, to participate at public meetings, or to learn more about the tinued to improve upon putting the of the match. avenge their only loss of the season City’s compliance with the Americans with Disabilities Act of 1990 (ADA), ball in the net and playing better as M-A senior Shelby Fero added a — to Davis in the season-opening please contact the City’s ADA Coordinator at 650.329.2550 (voice) or by a team. crucial goal with just 21 seconds left St. Francis Autumn Invitational on e-mailing [email protected]. “Cohesiveness has been has been in the third quarter, thus taking any Sept. 11. Since that loss, the Gators a great topic of discussion,” Rubin pressure off the Bears and putting have won 12 straight. *** said. “In my first year as varsity it on the Gators. Castilleja did add Curtis Williams, coach I learned something very im- fourth-quarter goals by senior Bar- Boys’ water polo Director of Planning and Community Environment portant, that it’s never the top play- bara Peterson (off a missed shot) and Sacred Heart Prep maintained its ers who wins games but your fifth, sophomore Sydney Molano from hold on second place in the West sixth and seventh players. Those outside, sandwiched around a goal Catholic Athletic League with a big players will make a difference. I by M-A junior Brittany Krappe. 10-7 triumph over host Bellarmine think that happened today.” “The league championship was on Wednesday evening. Senior Phil- NOTICE OF A SPECIAL PUBLIC MEETING Getting important contributions riding on this game and the kids re- ip Bamberg led the Gators (4-1, 9-5) of the Palo Alto from throughout the starting line- ally responded,” Rubin said. with four goals while sophomore Planning & Transportation Commission up, the Bears avenged their previ- Junior Marie Popp added three goalie Will Runkel had 12 saves. ous loss to Castilleja by handing the assists and junior Danielle Flana- Senior Robert Dunlevie and fresh- visiting Gators a 6-3 loss in a show- gan was solid on defense for M-A man Harrison Enright each added Please be advised the Planning and Transportation Commission down for first place in the PAL Bay while Gran and O’Neill helped three goals. Division on Wednesday. blank Castilleja high scorer Natasha In PAL Bay Division action, first- (P&TC) shall conduct a special meeting at 7:00 PM, Wednesday, “We played great today,” Rubin von Kaeppler. The Gators’ top three place Menlo swamped host Sequoia, October 20, 2010 in the Civic Center, Council Chambers, 1st Floor, said. scorers were limited to just two 23-6, in a lopsided contest as 12 250 Hamilton Avenue, Palo Alto, California. Any interested persons Barring a major misstep, the goals, by Peterson and senior Sayeh Knights scored. Jack Lucas (four may appear and be heard on these items. Bears (3-0, 9-4) will defend their Bozorghadad. goals) and John Gilhuly (three) league title. Menlo-Atherton still In another PAL Bay Division con- led Menlo, which had three goalies Staff reports for agendized items are available via the City’s main has two PAL matches remaining — test, Menlo School goalie Lindsay combine for 12 saves. website at www.cityofpaloalto.org. and also at the Planning Division at Sequoia and Aragon — but those Montgomery came up with 12 saves In another match, host Menlo- Front Desk, 5th Floor, City Hall, after 2:00 PM on the Friday preceding should be routine affairs. Also, there and the Knights pulled away in the Atherton (2-1, 10-7) dunked visit- the meeting date. Copies will be made available at the Development are no league playoffs this season, second half to register a 10-7 victory ing Carlmont, 24-3, as every Bear Center should City Hall be closed on the 9/80 Friday. just a single round of matches. Thus, over visiting Sequoia. Menlo (1-2, scored at least once. NEW BUSINESS. Castilleja (2-1, 7-5) will have to wait 4-10) got three goals from Morgan Jake Bercow’s four goals led the yet another season in an attempt to Cundiff and two each from Hailey way in the match that saw Carlmont Study Session: wrest the title away from M-A. Smith and Ilana Crankshaw while at a disadvantage all day with only While the Bears did return the outscoring the Cherokees, 7-4, in 10 players suited up. The Scots got 1. Housing Element – Review of Housing Goals, Policies and section’s top goalie in Dorst plus the second half. in foul trouble early and played most Programs for the Comprehensive Plan Housing Element dependable scorer M.J. O’Neill, this In the SCVAL De Anza Divi- of the second half with no substi- Update. M-A team had only four seniors. sion, host Gunn maintained its hold tutes. Questions. Any questions regarding the above applications, Castilleja, on the other hand, came on second place with a solid 15-6 M-A coach Marco Palazzo played in with eight seniors and a coaching swamping of Monta Vista. Junior his second team much of the time, please contact the Planning Department at (650) 329-2440. The staff that featured 2008 U.S. Olym- Elizabeth Anderson tallied five but the Bears still were much fresher files relating to these items are available for inspection weekdays pians Brenda Villa and Jessica Stef- goals for the Titans (6-1, 12-1) while than Carlmont and it showed. Senior between the hours of 8:00 AM to 5:00 PM. This public meeting is fens. senior Shelby Newman added four. Nick Henze had three steals and two televised live on Government Access Channel 26. While it appeared the Bears might Freshman Caroline Anderson and assists to go with a solo goal. Em- be ripe for an upset, it didn’t happen junior Casey Lincoln each had two. ery Welton also posted two assists ADA. The City of Palo Alto does not discriminate against individuals because Menlo-Atherton’s defense Gunn will host first-place Los and Alex Gow made six saves in the with disabilities. To request accommodations to access City was superb this time — sparked by Altos on Tuesday at 4:45 p.m., with cage. facilities, services or programs, to participate at public meetings, Dorst’s 16 saves. the league’s regular-season title at In the SCVAL De Anza Division, or to learn more about the City’s compliance with the Americans “Having Emily in the cage means stake. sophomore Bret Pinsker scored with Disabilities Act of 1990 (ADA), please contact the City’s we don’t have to be one-dimensional On Tuesday, Sacred Heart Prep three goals during a 17-6 loss to ADA Coordinator at 650.329.2550 (voice) or by e-mailing ada@ on defense,” Rubin said. “It’s just a effectively wrapped up the West first-place Los Altos on Wednesday cityofpaloalto.org. gift to have her there.” Catholic Athletic League regular- in the Vikings’ pool. Paly fell to 5-3 Dorst’s performance in the first season title with a 10-4 triumph over in league (6-7 overall). *** half was crucial, because she faced visiting Presentation. At Gunn, Ben Hendricks scored the setting sun and could have been Sarah Westcott scored four goals four goals but the Titans (3-4 in Curtis Williams, blinded on any number of shots. Yet, and goalie Catherine Donahoe had league) dropped a 7-6 division Director of Planning and Community Environment she came up with save after save 10 saves, while Emily Parsons and match to Monta Vista. N *>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 41 Sports dropped a tough 4-3 decision to Los Division with a 25-19, 25-12, 25-12 Prep roundup Altos in another SCVAL De Anza win over visiting Lynbrook. ATHLETES OF THE WEEK (continued from page 40) Division match. The Eagles wound Junior Melanie Wade led Palo up clinching the victory by sweep- Alto with 10 kills on a hot night in a 7-5, 7-6 (13-11) victory at No. 1 ing the singles after Gunn’s Allana a hot gym. Paly coach Dave Winn singles in the featured match. Booth and Alice Li had won their said his team came out flat and In the SCVAL De Anza Division, opening games at No. 1 and 3 sin- played uninspired against the 1-5 Palo Alto (3-5, 8-5) followed up its gles, respectively. Falcons as the Vikings closed the victory in its own tournament with a first half of league play. 4-3 triumph over host Lynbrook. Girls’ volleyball Palo Alto will open the second The Vikings won the Palo Alto Palo Alto and Gunn continued half of division action on Thurs- Invitational on Saturday, winning to streak through their respective day at Monta Vista as a tuneup for three matches in a reduced field SCVAL divisions with quick victo- next week when the Vikings host after three teams pulled out due to ries. The Vikings (6-0, 24-0) held Mountain View (Tuesday) and sec- SATs on Saturday morning. Paly on to their one-game lead in the De ond-place Los Gatos (Thursday) in junior Amy Ke was 9-for-9 during Anza Division with a 25-19, 25-13, matches that should decide the divi- the tourney while playing at No. 1 25-20 triumph over visiting Sarato- sion championship. doubles. ga while the Titans (6-0, 20-4) ex- At Gunn, the Titans (6-0, 20-4) At Gunn, the Titans (2-5, 7-9) tended their lead in the El Camino also wrapped up first-half play as sophomore Lisa Yan provided seven kills for the host team. Gunn won its sixth straight and has captured 12 of its past 13 matches, the only loss during that time coming to Palo FALL SALE Alto. In the WBAL Foothill Division, the first of numerous showdowns Elizabeth Anderson Beau Nichols Hunter Douglas Products took place as defending Central Gunn High Menlo School Coast Section Division IV champion The junior began a 4-0 week The senior rushed 26 times Sacred Heart Prep overhauled 2009 in water polo with two goals for 106 yards and scored CCS Division V runnerup Castille- in a 9-6 win over Paly. Then, four touchdowns in addition ja, 23-25, 26-28, 29-27, 25-18, 15-13 despite dealing with the flu, to catching seven passes in a battle of the Gators. she added eight goals in for 85 yards and another Sonia Abuel-Saud and Sarah Daschbach each had 23 kills for three wins to help the Titans TD and had an interception SHP with Abuel-Saud adding 24 finish as the only unbeaten on defense in a 40-22 PAL digs and Dashbach 16. Amelia Al- team at the Presentation Ocean Division victory over varez (25 assists) and Hanna Elmore Invitational. Half Moon Bay. (23 assists) set up the kills while Ol- ivia Bertolacci contributed 22 digs. Honorable mention Menlo (2-0, 15-6) remained in Emily Dorst B.J. Boyd a tie for the division lead with an Menlo-Atherton water polo Palo Alto football 18-25, 25-21, 24-26, 25-15, 15-9 Jesse Ebner Dre Hill* marathon win over visiting Harker. Sacred Heart Prep volleyball Palo Alto football It was the Knights’ seventh straight Amy Ke Cameron Moody victory. Palo Alto tennis Menlo-Atherton football Menlo freshman Maddie Huber Brenna Nelsen Bret Pinsker tied the career high she set in her Castilleja golf Palo Alto water polo last match, recording 17 kills, and Erin Robinson Robert Wickers added 21 digs. Gunn cross country Menlo football In the PAL Bay Division, Menlo- Pippa Temple Keegan Williams Atherton remained within reach of the division leaders with a 25-15, Sacred Heart Prep water polo Menlo water polo 25-11, 25-16 win over host Wood- * previous winner To see video interviews of the Athletes of the Week, go to www.PASportsOnline.com side. N SELECTED: 7HAT SCHOOL IS MEANT TO BE Roman Shades 20% off Wallpaper 20% off Sale runs October 1-31 Additional Rebates $25-$200 360 California Ave. #HALLENGING %NGAGING *OYFUL Palo Alto -IDDLE 3CHOOL /PEN (OUSE PM PM 326-9285 5PPER 3CHOOL /PEN (OUSE PM PM www.californiapaint.com 7BMQBSBJTP"WFOVF "UIFSUPO $"ts XXXNFOMPTDIPPMPSH Page 42ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ GOT WRINKLES? +IRIVEXMSR%KIPIWW 0SRKIZMX]ERHXLI&SSQIVW The Aesthetics Research Center is participating in 'SRWIUYIRGIWJSV3YV;SVPHERH3YVWIPZIW a research study for crow’s feet and forehead lines. We’re looking for women, age 30-70, with slight to deep wrinkles. 7EXYVHE]3GXSFIV` ¦EQ FOR MORE INFORMATION: 1ETPIW4EZMPPMSR7XERJSVH9RMZIVWMX]`[[[WXERJSVHIHYVSYRHXEFPI Contact Stephanie at 800.442.0989 or email [email protected] The Aesthetics Research Center " !%(& #' 707464 8SQ&VSOE[ .SLR0,IRRIWW] 0EYVE0'EVWXIRWIR 7ERHVE(E] &EVV]6ERH 7LIV]P7ERHFIVK 6SFIVX7ETSPWO] 7TIGMEP 4VIWMHIRX7XERJSVH (MVIGXSV7XERJSVH 3«'SRRSV ')3%%64 '33*EGIFSSO 4VSJIWWSVSJFMSPSK] 'SVVIWTSRHIRX 'IRXIVSR0SRKIZMX] %WWSGMEXI.YWXMGI RIYVSPSK]ERH GET IN SHAPE 2&'2);7 4VSJIWWSVSJ 977YTVIQI'SYVX RIYVSPSKMGEP Bounce $19.00 TW]GLSPSK] VIXMVIH WGMIRGIW 14 Day Start-up, Fitness Assessment 1 Training Session *VSQJEQMP]H]REQMGWXSXLIKPSFEPIGSRSQ]XLIKVE]MRKSJXLIFSSQIVKIRIVEXMSR[MPP Jump $39.00 MQTEGXIZIV]EWTIGXSJWSGMIX];LEXMWRI\XJSVFSSQIVWERHXLIKIRIVEXMSRWXLEXJSP 14 Day Start-up, Fitness Assessment PS[MRXLIMV[EOI# 2 Training Sessions Leap $59.00 %WXLITPERIX«WTSTYPEXMSRWYVKIWXS[EVHW FMPPMSRMRSYVWLIIVRYQFIVW[MPP 14 Day Start-up, Fitness Assessment I\IVXXVIQIRHSYWTVIWWYVISRVIWSYVGIWMRJVEWXVYGXYVIWERHXLIEFMPMX]SJPIEHIVWXS 3 Training Sessions EHHVIWWXLIMWWYIWSJXLIQEWWMZIWLMJXMRHIQSKVETLMGW Over 65 Classes per week :UMBA s 0ILATES s 9OGA 0MZMRKPSRKIVERHFIXXIVQE]FIXLIFMKKIWXGLEPPIRKIER]MRHMZMHYEPFSSQIVJEGIWFYX &REE 7EIGHTS s 428 3USPENSION XLIKPSFEPMQTPMGEXMSRWSJEREKMRK[SVPHTSTYPEXMSREVIIUYEPP]HEYRXMRK*I[MWWYIW #OMBAT #ARDIO s 3TEP EVIEWYRMZIVWEPERHGSQTIPPMRKMRXLI[SVPHERHMRSRI«WS[RPMJI "OXING s +ETTLEBELLS 0ERSONAL 4RAINING s 3PIN 3TIRXSXLITYFPMGERHLIPHMRGSPPEFSVEXMSR[MXL7XERJSVH6IYRMSR,SQIGSQMRK !ND -UCH -ORE 2010 8MGOIXWEZEMPEFPIJSVIEGLEXXLI7XERJSVHXMGOIXSJ´GI MASSAGE NOW AVAILABLE 7XYHIRXWJEGYPX]ERHWXEJJQE]SFXEMRJVIIXMGOIXW[MXL-(GEVH 4EVOMRKMWPMQMXIHWSGSQIIEVP]SVYWITYFPMGXVERWTSVXEXMSR No long term contracts s . 3HORELINE "LVD -TN 6IEW All memberships are month to month - & AM PM 3AT3UN AM PM 6IYRMSR,SQIGSQMRKTEVXMGMTERXW[MPPFIEHQMXXIH[MXL6IYRMSRREQIXEK Some restrictions apply www.overtimefi tness.com Infinite Poßßibilitieß . . . Join us for our Open House AS OC N IAT R I and discover why. E O T N S O E F W S C S Accrediting Commission H E O for G E O Schools L LS L A ND CO Celebrating 5 Years in Palo Alto and Growing! Join us for our Open House and learn more about our curriculum and how we nurture Open House the inquisitive and creative nature of children in a positive learning environment. Saturday, October 16 10:00 a.m. to 1:00 p.m. Nurturing, Safe Environment Engaging Curriculum Palo Alto Campus 870 N. California Street Spanish & Science beginning in preschool taught by specialty teachers (650) 493-1151 Infusing Music & Fine Arts for all students Learn more, visit Enriching Social Development www.stratfordschools.com Preschool State License Number: 434408056 Preschool Elementary Middle School *>ÊÌÊ7iiÞÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊU Page 43 2SHQ6DWXUGD\ 6XQGD\ WR 30 3776 NATHAN WAY, PALO ALTO Offered at $979,000 www.3776Nathan.com 7KLVIRXUEHGURRPWZREDWKKRPHUHSUHVHQWVDQRXWVWDQGLQJRSSRUWXQLW\WRPRYHULJKWLQ:LWKÁRRUWRFHLOLQJZLQGRZVDQGDQ DEXQGDQFHRIOLJKWWKLVKRPHUHSUHVHQWV%URZQ .DXIPDQ·VODUJHVWÁRRUSODQ7KHUHLVDIRUPDOOLYLQJURRPWKDWVKDUHVDWZRZD\ ÀUHSODFHZLWKWKHIDPLO\JUHDWURRPDQGWKHRSHQÁRRUSODQRIIHUVÁH[LELOLW\DQGURRPIRUDJURZLQJIDPLO\7KHUHLVDOVRDSRRODQGD screened in bonus room. Located close to parks and shopping, with convenient access to public transportation and freeway access. $ZDUGZLQQLQJ3DOR$OWR6FKRROVLQFOXGH)LDUPHDGRZ(OHPHQWDU\6FKRRO-/60LGGOH6FKRRODQG*XQQ+LJK6FKRRO 2SHQ6DWXUGD\ 6XQGD\ WR 30 134 PARK DRIVE, PALO ALTO Offered at $1,995,000 www.134Park.com 7KLVH[FHSWLRQDOHOHJDQWKRPHZDVUHFHQWO\EXLOWLQSURYLGLQJDXQLTXHEOHQGRIUXVWLFLQIRUPDOLW\ZLWKDWUDGLWLRQDOLQWHULRU7KH HIÀFLHQWWKUHHOHYHOÁRRUSODQ\LHOGVEHGURRPVEDWKURRPVSOXVDQRIÀFHDQGDÀWQHVVURRP Sure to be the central gathering spot is the spectacular kitchen and dining area that awaits formal occasions or casual meals. The property offers level lawn, mature IROLDJHDQGDQH[SDQVLYHSDWLRZLWKDODUJHSRRODQGVSD&RPSOHWLQJWKHGHVLUHRIWKLVKRPHLVLWVVXSHUEORFDWLRQQHDU&DOLIRUQLD $YHQXHVKRSVDQGUHVWDXUDQWV6WDQIRUG8QLYHUVLW\DQGVKRSSLQJORFDOSDUNVDQGH[FHOOHQWVFKRROV www.DunckelAndBrill.com ALAN DUNCKEL Derk Brill 650.543.1074 650.543.1117 If we had a buyer for your home, [email protected] would you sell it? [email protected] Information herein is deemed reliable but not guaranteed. Page 44ÊUÊ"VÌLiÀÊ£x]ÊÓä£äÊUÊ*>ÊÌÊ7iiÞ