Iileter Stay of Execution Lights
turije Volume 50 October 6, 1998 Issue 5 ] Convicted child Rising Black rapist and murder actresses shine in er denied another V. the Hollywood iileter stay of execution lights. Tennessee State University page? page 10 Tfre JVfea.srM.rc of Stodent Opfiwzion. and Sentiment 3Past winners reflect about title, role of TSU plans for homecoming Mr. TSU TVacey L. Vance News Writer By Mitchell Vantrease Vews Editor New activities, along with a twist of tradition, are in the works for an unde He competes in a pageant, becomes an feated season of the Tigers for the last honorary member of the Student Union Board homecoming of the century. TENNESSEESTATEUNItfERSITYTIGERS of Governors and escons Miss Tennessee State The theme for homecoming which 1338 OHIOVALLEYCOHFEREKCEFOOTBALLCHAMFtfllS University duringthe homecominggame. He's begins on Oct. 31, is "New Life for A L C. COLi - fliAO COACH Mr. TSU. New Era". 1Q9Q oct \ov c Some students have mixed emotions HOMFCOMING For the last eight years, the Mr. TSU OR. JOM>. cnwn \rullr\nf 1 vM.os. pageant has become an icon and a tradition this year about being the first homecom where the men of the campus vie for the most ing away from Tennessee State Life far a coveted titles on campus. Each year, students University. The only other game that has crowd into Kean Hall gymnasium to watch one been away from home unofficially was in of the most attended events during homecom 1994, which was played at Vanderbilt ing. University Stadium. I'HOrO BY JONATHAN GRAY Myra Swindell, a business adminis Ronald Myles. director of student activi-' The theme for this year's homecoming is a 'New Life for a New Era.' tration major, said she likes Adelphia tics, said the pageant originated in 199) Homecoming begins on Oct. 31. because SUBG wanted to fill a void during Coli.seum better - than Hale Stadium homecoming week. because of the space it provides. from students with the Halloween party TSU this year. Margaret Whitfield, direc • "Someone suggested why not have a tal-; "It's not comparable because once this year." said RonaldMyles, director of tor of alumni relations and a 19.55 gradu enl show for males, and they said they would' you lake something away, you just get a student activities. ate,of TSU, expects more people this call it'Mr. TSU'," Myles said. different vibe," Swindle said. Imani Holmes, a SUBG member year because of it being the first home The show was held in Ute "A-buiiding,"; Neveile Smith, a student and Atlanta from Detroit, said there will be themes coming game in Adelphia. now known as the Humanities Building, in the; native, said homecoming will still be the for each day. Activities also have been "From where I sit, I see more beginning. He said in the beginning lhe| same, and as long as TSU is playing, it planned during the music in the court younger people commg back in what pageant had a rocky start because the show; doesn't matter where the home field is. yard. The activities will include a cobbler seems to be a resurgence of alumni in was getting out of hand. | "That's our new home, so students contest, a banana peel contest, a TSU recent years, maybe because of more "Basically, theguyscame out wearing the! might as well get used to it. It's not the jeopardy contest anda fashion show. activities and groups," Whitfield said. tightestbikini swimsuilsand Hexedtheir mus-!Hole, so deal with it," he said. The fashion show will definitely In addition to a band chapter being clcs. There was very little talent. It was almost; Along with the stadium changes, a have a twist, according to McKie. who inducted by the National Alumni like an all male revue," Myles said. few of the week's activities have changed said the men will be modeling womens' Association, following the parade this He said the first two years were vety; this year. fashions and vice versa. year, other new activities will include a shaky because the administrationalmost dis-j Activities for the week are planned Advertising for the concert this year reception of appreciation in the coliseum missed the pageant for lack of rules and regu by the Student Union Board of will be different. Mckie said SUBG for the alumni. lations. But SUBG cleaned up the pageant and: Governors. The iraditionai activities regained trust from the students when The class of 1954, which meets got some control. include the gospel explosion, the battleof Goodie Mob and Jon B. appeared at last every five years, will have a luncheon He had some reservations with calling the the residence halls, the Mr. TSU pageant, year's concert. reunion. The alumni's annual activities pageatu 'Mr. TSU' because the roles of Mr. the Miss TSU coronation and the home "In previous years, something include a fish fry, open houses of the dif and Miss TSU are different. Miss TSU is elect coming concert. always happened so until all of the con ferent departments and Greek reunions to ed in April during Student Election "Because our campus is so diverse tracts are signed we are not revealing name a few. Commission Week and receives a budget, a now, we have to make sure that all of the who will be here for the concert," Mckie The alumni also have mixed reac stipend and a free room. Myles said Mr. TSU activities planned are what the students said. tions for the homecoming game not being gets prize money, a trophy and becomes an want whether it be their gender, color or Mckie and Holmes, who both along in Hale Stadium this year. honorary member of SUBG. age," said Tiffany Mckie, chairperson of with the other board members, said they "It won't be the same, but I imagine "My recommendation to SUBG has SUBG. hope to bring a concert that students will there will be some grateful people," always been to call him Mr. Homecoming, but Mckie, a senior majoring in English, enjoy this year. Whitfield said. "People get comfortable they decided to maintain the name of the title," said the feedback SUBG gets from the Mckie said to also be on the lookout with being at home and I think that opce he said. students every year helps to improve for fliers, which are in printing now and theysettle into their seals, they will expe Reginald Shareef, Mr. TSU 1998-1999, activities for the next year. will hopefully be out a week prior to rience a level of comfort." also said that the title should have been Mr. One of the changes occurring homecoming. Also door knockers will be TSU Alumni Association National Homecoming since it was an activity during throughout the week, is the annual video hung personally on everyone's door in President, Robert Smith said, "I think it the week. He said putting the name of the dance party given on the first day of the the residence halls, in addition to fliers will be a warm and celebratory occasion. school behind the title was powerful, but tech week. In its place, there will be a being located at the information desk and I think we will catch the elements of the nically no power was involved. Since his Halloween parly on Get, 31. A costume posters of the itinerary around campus. pastanda glimpseofthe future andI say freshman year, one of Shareef's goal was to contest with cash prizes to the top three Besides the activities for the stu this because of the joyous spirit that the winners will occur on that night. see 'Mr. TSU' on page 2 dents, there are plans for the alumni of see 'homecoming' page 3 "We hope to generate more interest Page 2 iReter October 20, 1999 News Winners say title is not equal to Miss TSU
that to me," he said. And the next year, he ran and Peete rroj'j Shareefsaid he was frustrated during crowned him. becomeMr.. TSU. hisfirstmonthasMr.TSU.Hesaidthere Alien said the reason he wanted to "I felt I was the best male representa- ms jum mujiui ua • win the title was because of his school tiveonthiscampus,"hesaid. .'f' pride. And he wantedto give more to the Shareefsaidthequalitiesthatone Sohesubmittedalettertotheadmin.stra-university, because Allen was already a mustpossessincludefriendliness,loyalty,"«"• SGAandSUBG.Theletterwas j , ca ed 'A great representative for a great part of the Aristocrat of Bands. intellectand open-mindedness. f ^ Allen, who is a recruiter for TSU, said "It was more than a homecoming university. . .. , , j ,u In the etter, it stated the importance it bothered him that Mr. TSU was not as aettvity. It was much more deeper than • equal as Miss TSU. was the representative of all "if you are going to have a pageant males on campus, which has that label, then he must have he needs an some responsibilities also. Or they should His and a have called it something else," Allen said. '*When But during his reign, he did stay to the active with SUBG and tried to attend SGA me was a home- meetings although Mr.TSUis notan offi PHOTOCOURTESYOFTHETENNESSEAN cial member. ^ coming ReginaldAndrews,Mr.TSU'96-'97 During reign, held Mr. TSU 1997-1998, Steevon Hunter, forums in different dorms and saidhewasundertheassumption(hathe SEC week ballot. The title would also made appearances at different had duties just similar to Miss TSU. He have to be written into the SGA constitu n|^H eventsduringtheschoolyear. never expected to be just a homecoming tion. Cornelius Allen, Mr. TSU escort. .,l "Hopefully,someone will say let s 1994-1995, said he was "When I was Mr. TSU, I made him move this (the Mr. TSU pageant) to the • _ involvedwiththepageanthave responsibilities," he said. nextlevel," said Michelle Robinson, Miss ^|H|||||||||||B 1 becausehisfriendMauricceo fiunter saidhealsoranfor a position TSU 1999-2(X)0. . Peete, Mr. TSU 1993-1994, on SUBG and became a permanent mem Shareef, the current SGA president, ' previously held the title. Allen ber, along with Shareef. said if SUBG's willing to give up the ' said that the night Peete won, Although .someprevious winners said pageantand administrationagrees then raoTOCOURTESYOFTHETENNESSEAN friend jokingly that there were no re.sponsibilitie.s. Tiffany students wifi vote hands down' for Mr. Robert Vick, Mr. TSU 1995-1996 he was running for Mr. TSU. Mckie, chairperson of SUBG said it was TSU as an elected official. up to the Mr. TSU's to make the most On Nov. 2, a new Mr. TSU will be during their reign. crowned, and the reign will begin for "In the past, some of the winners did another man to fill Shareef's shoes. He has not mind being just homecoming escorts. talked with contestants who will be run But just recently, some of the Mr. TSU's ning for the title this year. Shareef said • 7^ wanted to do more," said Mckie. he's told them about the importance of Mr. One issue that some students have TSU, and that it's nothing to be played around with. Roderick Rice, a contestant from Birmingham. Ala., said the reason he wanted to run for the title was because he had to make a difference on the campus. Taking "I felt the past winners haven't done a good job representing the university. And I thought I could step up and be a better representation," Rice said. Alien said the candidates who are the DAT? running for Mr. TSU should run not because of popularity, but because they care about the university. Start preparing now with Kaplan. "I want people to understand (Mr. TSU) is one of the most important titles on Enroll today and receive our comprehensive OATreview notes and exclusive campus," said Shareef.* "Practice for the DAT" CD-ROM, so you can begin studying right away. Get a jump on the competition by getting started before classes begin! Past Mr, TSU Winners Conveniently located minutes away from TSU on West End Ave. PHOTO COURTESY THE TENNESSEAN GinoYancy, Steevon Hunter, Mr. TSU 1997-1998 '91-'92 Call today to enroll! Kelvin Bush, '92-'93 been concerned with was that Mr. TSU Maricceo Peete, '93-'94 should be elected by the students. Cornelius Allen, *94-'95 KAPLAN Myles said in order for Mr. TSU to Robert Vick, '95- '96 become an election process, students 1-80a-KAP-TEST must voice their opinions. He said the Reginald Andrews, '96-'97 www.kaplan.com • AOL keyword: kaplan issue must go through the SGA, SUBG Steevon Hunter, '97- '98
'DAT Is a rsgitofod trademsilt of tho Amencan OonUI AasccUHon. and the administration. It would also Reginald Shareef, '98- '99 have to be voted on in the spring on the October 20, 1999 tS^lje Meter Page 3 Alumni anticipate last homecoming alumni will be the same. "Because we are "The alumni could be alumni brings back to the SUBG, have made sure standing on 18th and campus will be evident we've planned a home Jefferson and still be in everywhere and the new coming that we feel will that good TSU school stadium will be a glimpse be unforgettable," Mckie of the future of the univer spirit," Smith said. said.* sity." As the homecoming marks a new era in TSU Smith, a 1972 gradu Don't forget the history, alumni and stu ate of TSU, said he is homecoming looking forward to home dents alike will always football game coming in Adelphia keep the tradition alive especially during home Nov.6 in Aldephia Coliseum this year and Coliseum. feels that the spirit of the coming. DO WE HAVE SGA holds meeting in Boyd thinks the stipulation can be over turned,' By Kester Kilkenny Shareef said it was too early to tell. Right < HOMECOMING SHOES ? News Writer now they are in the process of compiling | all the information from all areas and - everyone involved. On Monday, Oct. 4, the Student "That way we know everyone is on Government Association held one of the the same^ageand all partiesare going largest general student body meetings in about fighting the stipulation with the the lobby of Boyd Hall. same strategy," Shareef said. After a short prayer and the reading Shareef said the plan is to gather as of the minutes, the atmosphere immedi much information as possible about the ately became heated. The discussion of status of the stipulation. Then they the meeting was about the 1994 stipula would like to hold a forum with their tion of settlement which mandates that attorney, school administrators, the alum TSU be made 50 percent white. It has ni association and Judge Wiseman, the % A. caused uneasiness among students and at judge presiding over the case. the meeting this was very evident. The next step Shareef said would be In 1994, Tennessee State University to compile the information in a concise was allocated $112 million for renova manner, then relay it to the general stu tions' u'itJ? the understanding that by the. dent body. year 2000 it would bemadefifty percent "SGAwillputtogetherthefacts, but; mixed. However, with only a few students need to know them so they know months left in 1999 thepercentage of the exactly what they are fighting for," while population is below the fifty per Shareef said. cent mark. Members of the SGA said the prob- "President Hefner is being accused Temtheyare runninginto isn't a lackof of ignoringthe settlement,but theschool student interest, but the lack of student has offered all the incentives," said SGA involvement. President Reginald Shareef. "The white "Right now the studentsjust aren't students just don't want to come here." unified," Shareef said. "One example of the stipulation is Other SGA members agreed with that requirements for white students to Shareef. Members urged students to lake A FEW. receive an academic scholarship are less the situation .seriously in light of the pa.s- than those for Blacks," said Shareef. sage of similar legislatureat Alabama' OPKN7DAYS Fueling the accusations against Hefner, • State University. according to Shareef, was that out-of- In that particular case, the students COOLSPRINGS30W939 DOWNTOWN254.6242 state fee waivers were givento 223 more lost the battle to keep the school histori Black students. cally Black. For the next school year, students SGA members believes that the whopresentlyreceivewaiverswill keep administration is on their side, but with them. But far less students will be grant out strong, unified support from the stu ed to new students. dent body, the cries of the students are The SGA said they were taking the less likely to be heard. positionagainstthe stipulationon the "We need to make our voices heard, groundsthat,"notonlyarewhitestudents whether that be packing the courtroom to justnot coming,butweare not up to par we overflow into the hallways or flood with the other neighboring schools as ing the legislaturewithlettersandphone mandatedby the stipulation,"said Trade calls," Shareef said.* Gilbert, an SGArepresentative. According to the SGA, there were several buildings, institutionsand equip mentpromisedtoTSU.butthesepromis es haveyet to materialize. When questioned as to whether he Clje Mztn October 20, 1999 Forum Editor in Chief Mia D. McNeil Cfje Mttzv News Editor Mitchell Vantrease Community View Editor Hillary S. Condon The Measure of Student Opinion and Sentiment Interim Arts & Entertainment Editors Metra Baugh, Sparkle Davis Tennessee State University Copy Editors Sonja Jones, Regan Toomer TSU Box 1246 Arts and Visual Manager Jonathan Gray 3500 John A. Merritt Blvd. Advertising Manager Dorian Wynn Nashville, TN 37209-1561 Advisor Regina Vincent Clark phone: 615-963-5652, fax: 615-963-5051 E-mail: [email protected] What we think IFrom where I sit: I found a new blue Money mogul Donald Trump could buy his way I'm sure that they were a good team .selves through the whole experience. into the U.S. Presidency, but what about the public's that year, but needless to say, they I told a member of the team what voting ballot? Jesse Ventura can bodyslam his have gotten a whole lot better recent a goodjob the team was doing and he wrestling opponents, what about bodyslamming a for Ila D. ly- simply said thank you. eign policy document for international affairs. Arnold IcNeli I say whatever the team did for the No pomp. Schwartzenegger can fight alien ghouls, but can he complete 360 degree turn, bottle it No circumstance. help to balance California's budget? Is it safe to vote and sell it to the Detroit Tigers and That simple answer said a lot to these celebrities into our national office, and can we, as Pistons, because at this point, they me. the voting public, count on them to lead our nation? iditor in need it more than you. I have noticed how the players con As a society, we are easily influenced by popular Chief I suspect that, sure, the personali tinue putthings in perspective without ity. Why is that everyone wants to run the nation, but ties on the team had a lot to do with gloating or being arrogant. are still not able to handle themselves, let alone a sole the change of course; but I believe the Upon further research, I found that country? It takes more than a good actor, a multi-bil Okay, I have to be honest with you team revisited the game of football "The Boyz" have particpated in men lionaire and a wrestler to run our nation. The main guys, I'm a die hard fan for University and why they loved to play it as kids, toring with young boys to give them question: Is politics today considered as a joke? of Michigan football and basketball. I why they love to play it now, and why positive male role models. Tennessee State University has a deep history as a love the maize and blue. So perhaps a win feels so much better than a loss. Not only have I seen this quality in political university. During the latter portion of the it's because I'm from Michigan and Now "The Boyz," as they affec these men as athletes, but as students spring semester, election week is held. Throughout the I'm biased, but anyone else can see, tionately call themselves are 6-0. also as well. entire week, the air is filled with various aromas of even if you're not from Michigan, that Right now, they have a level of confi In spite of all the wins you have fish, chicken, Italian food, and yes... even cajun. they are pretty good teams. However, dence that is insurmountable. had TSU Tiger football team, your The dorms are overflowing with fliers, posters and these days when I say "Go blue," U of How do I know? biggest achievement, in my eyes, has people going from door-to-door who are running for M is not the team on the brain. Could you not tell by their pictures been the clinic you have put on, about Miss TSU, SGA officers and class officers. We are able I have to admit that I've been very in The Tennesean recently, or perhaps being classy men without saying a to hear the candidates' platforms on the changes they proud of our football team this year it was planning a post-game-celebra word. are willing to accomplish for the following academic and last year. They have worked so tion partybeforethey won the Eastern So, I guess the most appropriate year. hard to show the country what a great Illinois game. thing to say at this point, is look out Is it fair to say that TSU students vote for some team they are. Good thing they won. University of Michigan, because I one because of the job they are willing to accomplish Indeed, it is a far cry from my fresh However, I must say that although think I have a new blue favorite.* or do we vote for people because they have the best manyear when I wasa memberof the winning isgreat, that has not been the fish sandwich at their booth? pep club, but felt "pepped-out" after thing that has caught my attenyon As people, we have a problem with votingfor the another Tiger loss...and then anoth about this group of men. best candidate whether it is for our nation's president er...and then another...and yes, one I have been most impressed with or for TSU's president. It would be great to vote for the way the team has carried them- our friends for office, but would they really do an effective job? Take into consideration why some people vote for others. There is the situation of a family member that has been a political figure and the spouse, child or ttrite ftli ter is published biweekly and is available free to the Tennessee State University cousin who thinks theycancarry on that legacy thatthe family member left behind-whether that be a good or conimiinity. Opinions expressed hereinare of the writer, not those of the administration, the Student Government Association or the faculty and staff of Tennessee State Universitv. bad one. * ^ In some cases, if the public is familiar witha per Submission Requirements son, then the sole fact is reason enough to vote some one in office. That person's credibility and platform Cite i-llrter invites submissions by all members of tlieTennessee State University commu may not ever be mentioned, but they sure turn in five nity. Timeliness,clarity oftliought,factualaccuracy,and interestto tlieuniversitycommunity or six blockbuster movies at the box office. willbe factorsin selectingmaterialforpublication.All materialsmustadhereto the Following These kind of reasons are nice to vote for a boost guidlines: er club president for a local school, but as far as the a) All contributions must be typed, double spaced (submitted on 3.5" Macintosh disks and hard person who will be handling a billion proposals and copyj.and must include the writer's name, telephone number and P.O. Box. budgets a day-this job is for real and not for entertain ment. b)Featured articles .should not exceed 1,000 words. Opinion length should not exceed 500 words. They will definitely take their votingprivileges to Letter length should not exceed 300 words. heart and vote for the right person for the position. c)Sources of factual material should be included. All claims of fact are subject to verification. Having someonein office who is about business, djClje iHcter reserves tlie right to reject letters, articles or ads without explaination, and to edit and not because of theirpopularity, should be our pri those as necessary. ority.TakeastandAmericaandmaketherightchoice.* October 20, 1999 Forum Money Talk$$: Can I have the ID? account in a person's name. The way to stop a criminal from tity thieves. Melanie The waiting period for a victim to potentially stealing a identity is to use 5. Keep a list of all credit cards, the receive another account can take a time effective preventative measures. As a stu account numbers and customer service Ballard span of one week to one year, depending dent: telephone number in safe place in case on the status of the account when it was 1. Don't ever write your full Social your wallet is stolen. Financial stolen or falsely acquired. The problem is Security number on classroom attendance 6. Protect your Social Security Reporter that most bills do not go to a collection sheet or any other document that will be Number. This number is the key to your agency until they are over 90 days over seen by a large amount of people. Place credit and banking accounts and is the due. an "X" in place of some of the numbers. prime target of criminals. Don't give your This means that a victim may not 2. Be consistent with the placement Social Security number or any credit card The fastest growing crime in the even find out about overdue accounts until of the "X" in.your Social Security number. number over the phone to anyone or a country, identity fraud, can destroy credit a collection agency calls with a complaint For example, if you place the "X" in the company you are not familiar with. and result in a trip to jail. True identity about failure to pay a bill. In most cases, middle sequence of the number, always Please take the precautions necessary fraud happens when a criminal takes your it takes longer for the collection agency to place it there. to protect yourself. Yourcredit is the keys name, address, Social Security number locate the victim because the criminal 3. Don't ever leave your wallet any buying power and sometimes career.* and/or phone number and,uses that to get will change the phone number and place where you are not. You may trust into bank accounts. address. your roommates, but what about their The thief will usually use another As 'students at Tennessee State friends? address and phone number in order to Universit'y, it is imperativethat we be very have easy access and set up new accounts. careful w'ith our Social Security numbers. The Better Business Bureau makes Most victims of this crime do not We use our Social Security numbers these suggestions; If you have 1. Don't carry extra cards, your even realize that they are a subject to this repeatedly on campus and,these are the Social Security card, birth certificate or offense until creditors start calling mostwidespread itemsthat a criminal will any financial passport in your wallet or purse, except demanding payment. If the payments take when they steal an identity. when necessary. aren't made to the creditor, then the credi While it is true that criminals can use questions for a simpli first and last name to find Out 2. When using an ATM or a public tors have the power to garnish wages, telephone, shield the screen or keypad so press charges and take the innocent party almost anything about a''person, most criminals are not that experienced and will "shoulder surfers" can not read your Melanie to court. Personal Identification Number or other The average victim of thiscrime will rob apersontogetinformaiibn.Livingin close quarters campus), easy data. spendyearstryingto removetheblemish (on it is for Ballard, the thief to get informnt'ion about you 3. Take ATM, credit card and other es that the criminal placed on their credit from something as simpleas yourgarbage receiptswithyou andeithersavein a safe report. Itispossibleforcreditproblemsto can. place, or destroythemin sucha way that please call occuragaindownthelineto thevictim. Furthermore, as the nation continues they can not be read. Also, shred pre- Once a thief has accessed a person's to use more electronic forms of commerce approved creditcardoffers. account, they will use them until every 963-5652 (i.e. Internet shopping), the problem of 4. Cancel all unused credit card penny in the account is gone. After Identity fraud will increase because accounts. Even though you don't use exhaustingone account,the thief can set Internet shopping does not ever require them, their account numbers are recorded upotheraccounts,voidinganypossibility contact. in a creditreport thatcan be used by iden for a creditor to issue any other type of
All letters mutm or submissions should be addressed to: Editor The Meter mmm TSU P.O. Box 1246 3500 John A. Merritt £nU6Rfvterc«V£'3>lU£{> Blvd. - Nashville, TN fCCTMooeaiajaew ,1 37209-1561
SfOPlD. fax to (615) 963-1561 email: meter® harpo. &f a tnstate.edu October 20, 1999 Community View Community Calendar 1
October 23 - TSU Football vs. Western Kentucky University, In Bowling Green, Ky. at 4 p.m. October 28 - Taize prayer services at Scarritt- Bennett Center, located at 1008 18th Ave. South. On Gel. 16, at the Clubhouse Inn and October 30 - Haunted Ball at Cheekwood Gardens Conference Center in Nashville, the Tennessee chapter of the National Organization for Women and Mansion from 6-10 p.m. Tickets are $25 for embarked on a new era of fighting for women's museum members, $35 for non-members. Call equal rights in the Midsouth. 353-9827 for additional Information or tickets. After nominatons and elections by acclamation October 31 - Tennessee Titans football game vs. for the Tennessee chapter's board, including Rams at Adelphia Stadium President Kathy Austin, Vice President- Communications Pat Holland, Vice President- Political Action Toby Abrams (whom also seves as Campus Calendar Nashville chapter president). Secretary Virginia Staliworth and Treasurer Susan McKenzie, the keynote address was at hand. October 17- 22 - Honors Program Week The keynote speaker was Kim Candy, vice president executive of the National NOW Action' October 17 - Student Talent Showcase, T.E. Poag Center in Washington, D.C. Auditorium, 7 p.m. Candy, who introduced such monumental PHOTO BY DERRICK K2MBROUGH October 18 - "Making the Grade," the First Joan C. women's rights as the Domestic Abuse Assistance NOW's Vice President Executive Kim Gandy Elliott Honors Lecture Series, Micheai Grant, Act and the Child Support Enforcement Act in La., addresses an audience of local activists at the speaker. FPCC Forum 6 p.m. addressed the small crowd of local feminists on the daily, "normal" routine at the National Action TN NOW Conference Oct. 15. October 19 - Graduate and Professional School Center. .' "Tennessee is 49th in the nation in total educa Symposium, FPCC Forum, 6 p.m. Her keynote addressed the major issues affect tion spending per capita," she said. "But we are October 20 - Phi Kappa Phi/ Alpha Kappa Mu/ ing women's lives every day, from social security 20th in personal income... 12th in business taxa Golden Key Freshman and Sophomore Scholar and fair pay legislation, to Federal Communications tion... andSOtb in the nation in tax burdens." Breakfast, Faculty Dining-Room, 7:30 a.m. Commission legislation on "public interest." The next presenter was Carole Stanford Buoy, "Hundreds of channels were given away for October 20 - Naomi Tutu will speak in "Challenges Chair of the History Department at Volunteer State free to broadcasters," she said. "The only require Community College and a scholar of women's his 'Facing Race Relations in the New Millenium", in the ment was that it be used for public interest, and that tory. She has written books and manuscripts about Hale Hall Lounge at noon was not an enforced or even a stated requirement." Tennessee's role in the passage of the 19th October 20 - Voter Registration in FPCC lobby, The FCC is also under NOW's scrutiny after Amendment (women's sufferage), and other from 10 a.m. -2 p.m. they refused to attack issues of diversity in broad famous and infamous women in American and October 21 - Blood pressure screening in FPCC casting. This is an issue long supported by other Tennessee history. human rights organizations, like Kweise Mfume Her luncheon address was centered on Martha lobby from 8 a.m.- noon and the NAACP, who have proposed network boy Ragland, a name revered by feminists in the South. October 21 - Honors Luncheon hosted by the cotts due to a lack of diversity in their broadcasting. In a thrilling narrative by Buoy, Ragland is Department of Hospitality and Tourism (By invita "The FCC won't let us pressure the individual described not only as the "democratic political tion only), in the Barn at 11:45 a.m. companies and networks to be race or gender-con activist" under, but a trailblazer for all women in scious," Gandy said. "And they include demanding October 21 - Mr. and Miss Honors Pageant, Kean politics. statistics of numbers of women and minorities as She graduated in 1928 from Vanderbiit Hall 7 p.m. pressure." University with a master's degree in economics. October 22 - Poetry Slam, Womens Building, 6 Gandy also addressed issues of women's safe She went on to lead the Chattanooga and then the p.m. ty in public and on college campuses, and encour national chapters of the League of Women Voters, October '22 - Women's volleyball vs. Morehead aged ail NOW members and concerned citizens to where she was invited to contribute to the cam write their legislative representatives for support of State. Kean Hall Gym 7 p.m. paigns of then-unknownTennessee Congressman the 1999 version of the Violence Against Women October 23 - Women's volleyball vs. Eastern Estes Kefauver. Act. Ragland continued her work through Kentucky, Kean Hall Gym 1 p.m. "Ask any man what he does on a daily basis to Kefauver'ssenateandvice-presidential campaigns, October 26 - Engineering and Technology Lecture protect himself against sexual assault," she said. but returnedto Tennesseeonce again to organize Series, FPCC Forum, 6 p.m. "Women have to organize their lives around pre the first Democratic Women's Caucus in 1972 and October 27 - Voter Registration, FPCC lobby, 10 vention and safety, and men do not." the National Women's Political Caucus. The next speaker was Martha Wetterman, a "She workedfor equity for women," Bucy a.m. - 2 p.m. representative for Tennesseans for Fair Taxation, said. "Itseemslikeaneasygoal. It is very simple October 28 - Blood pressure screening FPCC who presented an exercise to the audience about to consider,butsomewhatharder to implement." lobby from 8 a.m.- 2 p.m. Tennessee's unfair taxing practices that target poor Aboveand beyondher feminist and political October 29 - (Organizational Queen) Coronation er citizens, while basically giving a breakto richer stridesthatblazedthe wayforailinterested women, Tennesseans. Rehearsal, Kean Hall Gym, 4-8 p.m. Ragland is held by many politicians and feminists According to Wetterman, this practice unfairly today as "an example of what can be done."* October 30 - Football game vs. Eastern Kentucky, larget.s poorer and minority women. Adelphia Coliseum, 1 p.m. Free student shuttles Wetterman described the unfairness of the sys willleave campus from 11:30 a.m.-1:30 p.m. tem while simultanously outlining what these tax October 31- November 6 - Homecoming Week dollars do not accomplish for Tennessee's children and elderly. October 20, 1999 W^fjeMeter Community View Historic state execution date postponed again Tines, record 47 men, napped the young girl from the Primitive More appeals and described only 10 of them Baptist Church in Greenfield, Tenn., he only as a white, were exe brutallyraped, sodomizedand assaulted denials postpone a "37-year- cuted in the her. old Negro chair. But Coe did not kill the child until historic execution from Knox . This, accord she attempted to comfort him by saying, 20 years in the ing to the major "Jesus loves you." was execut- ity of capital Testimonyfrom his subsequent trial making punishment's provided information from psychologists opponents, is and psychiatrists te.stifying for the electric where the prob defense, alleging that results of Coe's By Hillary S. Condon for lem in the sys mental health tests showed psychotic CommunityViewEditor the tem lies. thinking, schizophrenic tendencies and "The number diminished reasoning capacity. No one has been executed in the state of Blacks exe These mental health issues allegedly ofTennessee in40years, and if local pub three years cuted is wildly stemmed from traumatic events in Coe's lic defenders have anything to do with it, disproportionate childhood, what defense expert Dr. Allen history will not change any time soon. What to the popula Battle referred to as "grossly abnormal." Robert Glen Coe, sentenced to die in represent photocourtesyof dee of corrections tion," said As a child, he was forced to watch as his 1981 for the aggravated rape and first- advances to Harmon Wray, father sexually assaulted and raped his degree murder of an 8-year-old West some and Does he deserve to die? Robert Glen Coe's executive direc sisters, as well as suffering his own severe Tennessee girl named Gary Ann Medlin, setbacks to prison mug shot, tor of the physical and sexual abuse at the hands of is still scheduled be executed by means of others in Restorative his father, which led him to become "out lethal injection this year. death penalty cases in Tennessee, includ Justice Ministries for the United of touch with reality." According to Sharon Curtis-Flair, the ing Supreme Court bans and reinstate Methodist Church, one of dozens of Battle also conceded that this condi media liason for the State Attorney ment of death penalty laws, protected church-based groups officially opposed tion was worsened by drugs and alcohol at the time of the crime, which caused General's office, Coe's case has been convicted criminals from capital punish to the death penalty. "The race of the vic Coe to become temporarily insane. refused for review by the Tennessee ment for 40 years. tim is determinative of who gets killed, Information was also brought to trial Supreme Court. New state Jaws also-provide the not the race of the offender," he said. from another assault four years before in Coe's lawyers have 25 days to file a choice between lethal injection and elec Wray also believes he would feel the Florida, where the information supporting request for the United States Supreme trocution to all condemned criminals con same way if it were his family member a theojy of Coe's mental instability actu Cojtrf to review the case. If the highest victed before Jan. J, 1999, To follow the killed as Medlin was. "You can't be a Christian and be for ally caused a judge to warrant Coe unfit court either refuses to review the case, or law and allow lethal injection procedures, to stand trial. denies another stay, the final decision will the death chamber at River Bend the death penalty," he said. "People who consider themselves Christians should The leading defense witness for the be left to Governor Don Sundquist. Maximum Security Institution, where Florida case, psychiatrist Robert Wald, Sundquisi's spokeswoman says the Coe still resides today, had to be remod ask themselves what Jesus would do. If after numerous meetings and tests with governor favors the death penalty for eled. you can envision Jesus saying that he should die, then I don't have an argu Coe, concluded that Coe was a "seriously heinous crimes, but "will review each Since the replacement of public ment." disturbed young man...who certainly case on its individual merit." hangings withtheelectricchairin 19!6 as manifests aspects of a schizoid personali There have been numerous changes a means of execution, 85 African- It is hard for many supporters of Coe's death to be as forgiving, given the ty," and had the potential to be "blatantly in Tennessee's capital punishment system Americans and 40 whites have been law situation of the deadly crime. According psychotic" in the future.* since November of 1960, when William fully executed in Tennessee. This prac ticereachedits peak in the 1930s, when a to Coe's 1979 confession, after he kid Emanon Entertainment provides fun, new venues for TSU community and poetry tojazz and reggae. tainment in the title is "no name,"joined TO II ^ ^ * andpoetrytojazzandreggae. thatbeingexposedtodifferentstylesof XoU SlUCl©ntS TyhembaAli Lyles,DanielMaree musicisimportant. and then spelled backwards. _ . andErwin Prentiss Hili Hillform the dynam- dynam Lyles,Hill and Mareeare working Hill, Prentiss and Lyie found the solution to the difficult problem of nam brinq new ideas ictriothatformedtheideaforH^BH EmanonEmanon. forH^—It I II ing a newbusiness by turning a seeming ^ wasn'tIII I overcrowdedIHI ll Mill ill \i andHIl/ ly negative situation into a positive one. to your WOGKOnd "A"agroupofusthoughtM^^^^gthought^H0ggave a^ nice alternativeto aboutwhatNashvilleneededas^H This has been a recurring theme in the faras entertainment,"Lyles^H'''^/rap and 'booty' music. establishment and operation of their busi By Amani Murph ness. Community View Writer AndsofarNashvillehas^H Emanon has endured a few other hardships, like losing one of the group's rewardedtheirforesightwith^H -Tyhemba Ali Lyles tremendoussuccessin provid-^H original members to skepticism. Lyle Looking for a new venue of enter owner ingjust that. responds to that situation only by main tainment? There are some students at taining the adage that"the balls will keep Tennessee State University trying to pro Their very first event, on rolling." videjust that to the local collegecommu appropriately titled "A Night Venice," held at Club Venice"had a nice the owners of Jubilee Restaurant, Donnie Emanon's plans for the future nities. turnout," Lyles said. Hatcher of Urban Professionals, Kim include a college-wide trip during spring Emanon Entertainment was formed "It wasn't overcrowded and gave a Davis of Coca-Cola and representatives break for students to Gatlinburg, Tenn., bya group of three TSUstudents withthe from J&P Menswearfor sponsorship and and hopes that by then, more students intentto expose the people of Nashville's nicealternative to rap and 'booty' music," partnershipopportunities. will catch on to the idea of altemaUve many collegecampuses and communities he continued. He concedes that there is The moniker thai precedes the enter- eniertamment venues in Nashville.* to entertainmentthatrangesfrom comedy nothing wrong with rap, but points out Page 8 itteter October 20, 1999 World View World View
World
The German government, along with several German-based industrial organizations, recently offered approximately $3.3 billion in compensation to people forced into slave labor during Nazi rule in Europe. The offer came after lawsuits were filed on behalf of thousands of former slave laborers and their descen dants, who sued various companies for back pay. Legislation
The U.S. House of Representatives voted 275-151 last week to approve the controversial and infamous "Patient's Bill of Rights," which, among other means of regulating managed health care plans, will allow patients to sue their HMO's.
Sixty-eight republicans and 206 Democrats voted RELTIERSPHOTO COUKl'ESY OF YAHOG-COM RIEUTERS PHOTO COURTESY OF YAHOO.COM the bill's passage, despite issues over partisan politics international Relations and Republican's concerns aboutincreasing the already Weather large numbers of Americans without health insurance. Parts of eastern and southeastern Mexico are still Former Chilean dictator Gen. Augusto Pinochet under 2 1/2 feet of water as a result of weeks of storms wasofficially granted extradition to Spain from London Space and flooding has left over 250 people dead. At least 200,000 are homeless due to massive, dead last week. Last week, the National Aeronautics and Space The 83-year-old general, whose failing health leads ly mudslides and hundreds more are still missing, Administration demolished one of its most famous thought by officials to be buried under mud. many to believe he will not survive his trials and pun launching pads. No. 4, that launched such historic firsts ishment, is charged in Spain for numerous counts of The rains have caused flooding throughout the as the Viking and Apollo shuttles. cities of Teziutlan and Mexico City, upsetting every human rights abuses and torture of his political enemies in his home country. He will remain under house arrest thing in its path, destroying homes and uncovering coffins in cemeteries. in London until filed appeals are heard.
Community Voices Has media Ronald Adwaters Ronald Mullens Tiffani Martin Terry Owens coverage of Freshman Freshman Senior Faculty Atlanta Charleston, SC Nashville Dir., Wilson Hall TSU been
fair and "I believe that media "I am a band student, so coverage of TSU is "I think TSU is pretty impartial? I really don't have much "I haven't been here generally positive, but I well-covered by the time to read newspapers long, but what media don't believe that coverage I have seen of media. Tennessee State or watch the news, but I Freshmen receive has a positive image think that what I do see TSU has been positive. I enough attention when it What do you don't really get a change when it comes to how in the news about comes to news cover events on campus are Tennessee State are to watch the news, but age. I think the positive think? covered by the newspa good things. I've never when I do see something things that the young about TSU, it's usually pers, as well as the local really seen anything bad men and ladies are good." news." Compiled by in the news about doing deserve more TSU." Joscelyne M. recognition." Gibson October 20, 1999 %\)t ^eter Page 9 Community View Gore appoints Black woman to manage campaign New appointment and local headquarters could re-energize campaign away from Washington and establish his says she has By G. Thaddeus Flowers own identity, independent of President known Gore . since childhood. Community View Writer Bill Clinton. One of the most vocal opinions con "I think it cerning the relocation is that Gore is divides him from American history was made when scrambling to move ahead of New Jersey Washington," Democratic presidential hopeful Al Gore Senator Bill Bradley, the sole Democrat Cooke said. "It introduced .Donna Brazile as his cam who is daring to challenge the two-term puts him back paign manager, making her the first Black national officer. with his roots of woman to hold the prestigious position in. The vice president, who claims the people." a U.S. presidential campaign. Bradley is dodging a meeting with him Brazile, On Oct. 6, al the grand opening of two, said he wants to debate the former completely confi Gore's new headquarters, Brazil made her NBA player eveiy two weeks until the dent in Gore and first public appearance as chief officer in primaries. the campaign, the Democrat's bid for the White House. "It caused me to really evaluate the says is no reason "She is the most qualified candidate, way I was running my campaign. It is a for supporters to she is the best candidate," Gore said. "She good thing," Gore said about Bradley's worry about the will do a great job for the camp." challenge for-the Democratic nomination. presidential bid. Brazile's appointment is causing a "The Gore Camp" contends that the "The cam stir locally and nationally, with many move was to come back to familiarity. paign is in great political analysts showing surprise that Claiming that Washington is not where he shape across the Gore is strong enough to make such a would shine the brightest. Gore wants to country...people move. As an added plus, Brazile will move to the place that would offer the are very ener bring with her support from women and most mobility for him to reach potential gized to be com Pi iOlO J. CARROLL minorities. voters. " ' ^ ing here to A native of New Orleans, Brazile "When I started connecting with the Tennessee," she Presidential hopeful Al Goreintroduces Donna Brazile, will be making the transition into her new American people, I wanted my campaign said. "Thestaffis his newcampaign manager, at his new Nashville head- position. She is in the process of organiz to have the same feeling I was getting in excited, the vol- quarter opening Oct. 6. ing volunteers for out-of-state trips, set being a candidate ... So I returned to my unteers are excit across America."* ting up a media relationsdepartment, cre roots," Gore said. ed. We're ready to take this campaign ating a phone bank and taking care of Vowing to fight for every vote, the otherlogisticalissuesassociatedwiththe wife of the vice president reminded historical move of the headquarters to Tennesseans that returning to the stale Nashville. was the natural thing to do. "I am excited to be one of the leaders "Every campaign that we have run of the campaign," Brazile said while and won (14 total) has been from greetingthe manysupporters,mediarep Tennessee," said Tipper Gore, the "sec resentatives and officials who turned out ondlady" famous in herownright, most for the event. commonly known for her stand against With her new role, Brazil will have to first amendment rights through parental- make many personal changes as well. advisory labels. First and foremost, she must move from Local politicians, including Metro her Washington. D.C. -area home to council members and state representa ihcMusicCity. She willalsoleaveherjob tives, were present at the opening to as professor of political science at the show their support for the presidential University of Maryland. hopeful. But some ofTennessee's elect Classes are starting now! Sinceshe has planned thisas her last ed officials feel there is a greater reason politicalcampaign,Brazilwillput .some for the move to Nashville. Call today to reserve your seat. effort into reaching out to Nashville's Tennessee Senator Bill Frist feels highereducationcommunityfor a future Gore's move is to put distance between position. himself and the president. GRE classses begin October 21 "I want to teach youngpeoplehow to "He is burdened, especially in LSAT classes begin October 16 get involved. I believein democracy,I places like Tennessee, by being tied to believe in what we are fighting for," said President Clinton from a moral stand • Conveniently located on West End, Brazile, who is also veiy eager to visit point," said Frist. minutes away TSU. Overall, many in attendance are • Tuition Assistance available Thoughit turnedout to be the high apprehensive about how easy Gore's lightof the event,Brazile'sintroduction White House victory may be. Gore has wasjust part of the celebration. re-vamped his campaign, from his out The main reason was to announce the spoken speeches to his personal physical KAPLAN openingof the newcampaignheadquar demeanor. While most Americans are ters, located at 2410 Charlotte Ave. For ready for him to start "shaking it up" on many,the relocation wasan acknowledg the national political scene, Tennesseans 1-800-KAP-TEST ment that the vice president's bid for are happy he is back home. www.kaplan.com Pennsylvania Avenue was' in jeopardy. Following his moves closely is *LSATis a registered trademark oltheUw SchooiArknss^onCoundt. The move is one of three steps to break Cookeville's Virginia Cooke, 57, who 60 YEARS OF BUILDING FUTURES. ONE SUCCESS STORY AT A TIME. October 20, 1999 Black actresses sparkle in Hollywood lights T>-.By SparkleC l.l„ Davisr* weekI. on ABC'sA Boyn.... Meets World. urban drama New YorkV,^^b IUndercover.T„,-lyi^.-^,,ar BomRz-irn ^ Interim Arts and Entertainment Her first acting job was in the play and raised in Indiana, Michelle has appeared in numerous films such as The Editor Chelsea Walls with the Naked Angel Theater Group in New York City. After Sixth Man with Marlon Wayans, New that, she moved to Los Angeles to answer Jack City and the The Substitute 2. Tangi Miller, Trina McGee-Davis, an open casting call in the Quincy Jones Her television credits include guest Monica Calhoun, Michael Michelle, television pilot Diva and won the leading appearances on the NBC show Players, Melissa De Sousa, Nicole Ari Parker and role. Since then her television and film the mini-series Trade Winds and Peter Sanaa Lathan all have one thing in com career expanded as well. Benchley's Creature. She was also a mon ... they are all rising stars of Her television credits included guest regular on the CBS series Central Pork Hollywood. These seven actresses are all roles in Family Matters, Martin and City West. Michael Michelle is currently on making names for themselves in the Guys and in film she starred in The the show ER as Dr. Leo Finch. movie and television industry. Many of Birdcage with i Nicole Ari them have been acting for years, while Robin Williams ^ Parker can be others are just getting their feet wet. the seen opposite Monica Calhoun got her start on the thriller Daylight Martin Lawrence very short-lived show Baghdad Cafe in the film Blue Lathan recently starred in the box office opposite Whoopi Goldberg and Maureen Streak. hit Life alongside Eddie Murphy and Stapleton. Her big break was in 1998, This graduate Martin Lawrence. when she was cast as Ebony in Ice Cube's Miller of .New York Her film credits include The Wood The Player's Club . for her role as University Tisch opposite Omar Epps, Catfish in a Black. Since then she has appeared in Elena Tyler on School of the Arts Bean Sauce and Blade. She also has a HBO '5 The Ditchdigger !$•Daughters, the the WB's began' her career series role on NBC's Lateline and starred mini-series The Jackson's: An American Felicity. She ^^ in theater appear- in the CBS movie Miracle in the Woods. Dream and Park Day with a starring role was recently ? ing in a produc- Lathan is featured in The Best Man and is opposite Sidney Poitier andBrockPeters. named one of i tion «of Mad currently in production on New Line She is currently starring in The Best Man "TV Guide's" ^ Woman of Cinemas Love and Basketball opposite with Moms Chestnut and Nia Long. sexiest women ^ ' Chauillot. Since OmarEpps and Alfre Woodard. Trina McGee-Davis is no stranger to ontelevision. ^ ^ I Melissa De Sousa has appeared on the screen since she is featured every Miller 1 ^ I appearedin such stage inAn Evening of Shakespeare with began her career Sanaa Lathan films as The End Charles S. Dutton, but is mostly remem in high school by of Violence, bered in the feature film Ride starring participatingin school productions.After Boogie Nights, The Incredibly True opposite Malik Yoba. graduating from Alabama State Adventures of TwoGirls in Love, Subway She will have a role in the film University, she seriously pursued an act Stories and 200 Cigarettes. Lockdown, an independent film that is ing career by enrolling in the University She has also starred with Eriq currently in production with Richard T. of California where she earned her mas LaSalle in the telefilm Mind Prey and Jones and Master P. ter's in Fine Arts. Law and Order: Exiled. Parker is cur Sousa has had numerous television Since then, she received roles in rently in production with Sigourney appearances on such shows as ER, independent films such as The Other Weaver and Scott Elliot in the up coming Married ... With Children and Living Brother, starring opposite Mekhi Phifer film Map of the World. Single. and in Rhino. She has also appeared on Sanaa Lathan got her start by per These young ladies have proven that HBO's sports comedy Arli$$ and the forming in numerous regional and Off- it is possible for Black actresses to make drama series Michael Hayes. Broadway productions, which include it in Hollywood.* Michael Michelle is well-known for Black and White at The Public Theater On the cover is Trina McGee-Davis. Monica Calhoun her portrayal of Sandy Gill on the popular and A Movie Star has to Die. Since then, Earn Mone IMMEDIATE How would you like to earn money every time OPENINGS! someone uses the phone? Watches cable T.V.? Surfs the net? I am offering every student the Students earn $375/$575 weekly opportunity to own his or her own business and processing/assembling make lots of money without leaving medical I.D. cards campus.For more information contact from your home. Experience IndependentRep.306-454506at 1800-506- unnecessary...we train you! 1144 ext. 8832 or 972-283-3294 email daaalex Call MediCard 1-541-386-5290. [email protected] ext. 300. October 20, 1999 fReter Arts and Entertainment Into the land of stars enter African-American actors
By Tony Forte world of "lights, camera, action." nated fans and audiences with a Arts & Entertainment Writer The glamour and glory often associat mixture of sex appeal and stellar ed with the fast-paced lifestyle of acting talents, introducing the Hollywood celebrities has shed its bright likes of Denzel Washington, African-American men cannot act! Outrageousstatementslikethe previ lights on men of color. Belafonte and Wesley Snipes and Eddie Murphy. ous one, must have overwhelmed the Poitier sparked African-American stardom The male African-American actor into Hollywood. mindsofHollywoodfora significantpor began to impact Hollywood as tion of lime, considering the lengthy Poitier acquired much acclaim and much as their white counterparts. arrival and acceptance of African- recognition for becoming the first black With an abundance of actor to win an Oscar, with his encore per- African-American actors making American actors to formance in Lilies their presence felt in the hearts the"bigscreen." [ the Field. Also, and homes across America, the ' A The opening the door movieindustrywereandstillare 0 coming out of Hollywood with the movies has been Americans hiringof blackactorsat a phe- |B|^B quite apparent for the Hollywood as a nomenal majority of the 20th whole, he earned Withtheapproachofthenew^^^B Century. This void BIM praises, such millennium,the torchhas been^^^B amongst ethnic races, passedtoAfrican-Americanactors^^^B specifically with Efijr "Poitier, pushed , the envelope wher- ofthe pre.sentandfuture,suchas jjjj^^l black actors, is most « K [ ever he could to the sexual icon Taye Diggs (How Taye Diggs evident in the main W expand the world Stella Got Her Groove Back ) and cast or starring roles, v American males. With the efforts of Spike i for Black actors," the hilarious antics of Chris Tucker Lee and John Singleton, the thoughts and African- Wf;' m according by the- {Friday and Rush Hour). creativity of life, through a Black male American actors t ater Several Urban/R&B music , artists perspective, has made its way to the "land broke false Charles Dumas, have exhibited diversity with bold ven of stars" in the field of direction and pro assumption late starred in the tures into the acting scene. Names ranging duction. 1950s with the emer Sidney Poiter 1997 action film from the late Tupac Shakur to the witty With so much to look forward to and gence of actors- Separate But Will Smith, who has become the sci-fi quite a bit to reflect on, the efforts of the including Harry Belafonte and Sidney Eqiia\. hero of Hollywood. African-American actor shall never be Poitier, whom were trailblazers for a rising As of the last quarter of the 20th The eyes of America can sleep no overlooked again. That's a wrap, cutl* surge of African-American actors into the Century, African-American actors fasci more on the acting laleiiis of African- a meter minute By Sparkle Davis such as Made in America opposite Will Smith and Whoopi Goldberg,Friday with Ice Cube and Chris Interim Arts and Entertainment Editor Tucker, Tru in Hav Plenty , Soul Food alongside Vivica A. Fox and Vanessa L. Williams, Lcfve Jones Nia Long is one of the most sought-after African- with Larenz Tate and American actresses in — 1 the HBO film Butter Hollywood. She was bom on opposite Eddie Oct. 30, 1970, in Brooklyn, Hudson and Shemar NY. In 1974 she moved to the Moore from The Midwest with her divorced M||[H Young and the mother. As a young child, she Restless. grew an interest for acting I Other films Long and soon got involved in her ( ; can account for are In school productions. ^c ^ Too Deep with Omar After four years of living Bhi Epps and LL Cool J. in Iowa, she and her mother and current box office moved to South Central Los 13 hit Stigmata opposite Angeles. She continuedto act Patricia Arquette. She in school productionsand ^ take acting classes after she ff graduated from high school w ^V• • ^^H^^k on Moesha, Livin' andenteredcollege. f .A Nia didn't have to wait I / ^^^^BI^B FreshPrince of Bel long before she was discov- f ered and given a part as Nia Long Katherine "Kat" Speakes on the seven days of the CBS daytime drama, Kwanzaa, means "life purpose."and is making quite a Guiding Light.. While on the show, she auditioned for name for herself in Hollywood. She has three new the part as Brandi in John Singleton's movie Boyz N films coming out later this year that include an HBO the Hood. Her performance in this movie opened up movie called If The.se Walls Could Talk 2, The Best the doors for her career. Man on Oct. 22 and Boiler Room in 2000. Since then, she has been in a long list of films October 20, 1999
are back on the hip hop scene with their sophomore album M- Pire Shrikez Back. I meatloaf''withawhich provided mad beats and definitely a waiter comes by more improved lyrical with the adjacent table's food - grilled style from the last Memphis Block Coming of chicken, turnip greens and turnips - and album, on such tracks Age 3 you begin glaring at their plate like you like "Shoot to Kill" haven't had food in days. Well Bleek is the and "Suspect Ni****," Before every meal one has to have an same when compared to Swizz Beatz. Just produced by Gray Boy appetizer in order to whet his/her appetite one little smidgen of Swizz Beatz on and Havoc of Mobb and in other cases to get them full. "Memphis Bleek Is ..." makes the audi Deep. Memphis Bleek serves us his fresh CD ence want to taste more and more of his Other cuts include "Girlz Ninety Now," titled Coming ofAge. delectable beats. PHOTOCOURTSYOFORIGINOOGUN CLAPPAZ Bleek's CD had somewhat of a bland where the Gun Roc-A-Fella Records took part in the Originoo Gunn Clappaz preparation of this dish, while Jay-Z pro- taste, which can be improved by adding Clappaz trade humor- the Down South Georgia vided the necessary ingredi- ^ Boys steps to the scene ents. with his debut album The titleisdefinitely f DISCussTMs!:Saiitana Supernatural4 We Ready I Declare whichcoiiidlid lust aseas- appropriate for Bleek, g Sara Caldwell Life,"featuringDaveMatthews, , justr.. ,eas- War. d - Everlast s because he isa youngchap in ^ ,, ilyfitintoaDaveMatthewsBandrecord,- Everlasl's_ Signed to Raw i the first song ^ therap game who isserious ContributingWnter haunting"PutYourLightsdn" whichwasthefirstsong Deal Records, the ould... be a new , abouthisabout his present position. — ; ; —: rr" he wrote after a near-fatal heart attack - could be a new album features eleven Santana's latest effort is nothing short of its title, direction for him His selection of guest . tracks of Troy dropping appearances, including Jay- Superiiaiural. Not only are the men who In spite of all thelie superbper- per , . t , •. lyncs over heavy bass started the first Latin explosion back and formances, Santana isIS injly truly at its / . ,u • ..a Z, Ja Rule, Beanie Sigel, j , .u - fines and synthesized better than ever, but they also brought best when the bandd plays their , ^ Noreaga and Da Ranjahz, . drum machines. shows that his schooling some friends along for the ride. fusion of classic rock: and traditiontradition- ^ , j Santana gained a major following in Standouts include No from Jay-Z has paid off after al Hispanic selections,f. ,, More Play in G.A.," the early1970safteroutshining.several' f the album is .. , u- all. The last half of the album« . is "Am t No Sunshine, better-known acts at Woodstock in 1969. reminiscent of the older Santana nu Some might disagree, ^ , and' Help Me Rhonda, A string of hit.smade the band bankable. ike all Carlos il A ' a u-. but Bleek's voice sounds like tunes and it .seems like all Carlos.. Troy flexed his butas theyexperimentedmore with tradi- Nas's voice.You might think Santana has to do is "look" at his lyrical skills on "No twice after hearing tional Mexican music, they lost much of guitar to evoke the psychedelic their fan base. Santana continued to tour .sound of the pre-disco'o1970s.WOs "Memphis Bleek Is ..." and j anthem dedicated to his and make records for the next 25 years, Witii Spanish lyricsTICS and wanwan- _ "You KThug ." His home state Georgia. dramatic presentation shows but they were virtually ignored by radio, dering melodies, songs like - '• ' A Yhistrackis suretoget that he put forth a special whichresultedin disappointingsales.^ "Migra," "Corazon Espinado" and T'"th r" anytime effort in order to get the Finallyinthemid-1990s,thebandsigned ofrequestmagazine"Primavera,"aretrueeto the bolero ., , •' with Arista Records when Clive Davis, ,entinMexico, ,, attention of his audience. Santana style thatisomnipresentin Mexico, ^P Troy calls on thepresident of the label,offeredSantana while encompassingig the more . , Bleek followed the same , ,, rapstress Rhonda on the path that other emcees have the artistic freedom they needed. meanderingstyle of classicAmericanrockand roll. , On Supernatural, the band proves that its artistic art. whenu »u they Bonnie-and-Clyde-type, , taken and today is still travel Veryfew bandscan createa workof art whenthey track Help Me ing - his lyrics are somewhat freedom was well worth the label jump. Guest artists attemptto fuse two styles of musicthat areire so different . C I. .• ,u • Rhonda, m which Troy repetitious. The overall range from Lauryn Hill andCee-Lo toDave Matthews to and. top that, add artists who tire thele best in their ; . on of , in shows he doesn t need theme on Coining of Age guitar great Eric Clapton. genre. Santana not only created a work•k ofot art with Even though on some albums the guest artist is just , ,, any help at all. surrounds life on the street, Supernatural-,hetookthe listenertoa whole>le newworld.* ^ , , On the track "I Declare murder, money, etc. singingorplaying with theband, Santanaincorporates the Remember the time you guest's style with theirs. The beautiful "Love of My ^ War,"PastorTroylets were in that restaurant called the world know of his some spice to his lyrics with a dash of ous lyrical verses with the Boot Camp dispute with No Limit Records over a originality. Metra Baugh Click about sexual escapades over a laid track infused with bombs, gunshots and a back Dru Hill produced track. "Bounce to repitious drum track. O.G.C M-PIre Shrikez Back 3 the Ounce"is another hot single. Troy says, "/'m not callin' no names Straight out the grimy streets of Despite the production from QB's on P/ This the same boy they said would Brownsville, Brooklyn, comes one of the finest. Havoc, and also guest appearances never reach the key... /But if you do it's most underrated, underground threesomes by Heltah Skeltah and the Boot Camp gon' be even worsefor you./ Go call you of our lime - O.G.C. Its members, Click, this album still lacks some of the soldiersand tell themto bring a hearsefor •Louieveville Sluggah, Starang Wondah elements that would establish its place in you." and Top Dog, are originally a part of Fab the rap world. Franklin Alexander Although Troy shows his indepen 5, a group that is part of Heltah Skeltah's dence, the album standouts overshadow Ruck and Rock. Pastor Troy We Ready I the weaker tracks. Most of the bass lines The young guns from Brooklyn's Declare War 3 sound the same and the drum track used in boot camp click stomped into hip hop's "No More Play in G.A.," is similar to the landscape with their debut album Da It's obvious the dirty south held down beat on TRU's "No Limit Soldiers." Storm, which did not achieve its anticipat the music scene for the summer of '99 So soldiers get your ammunition, ed success as former members of Fab 5, a with the arrival of the Youngbloodz. Cool because Pastor Troy is ready to show the PHOTO COURTESY OF THE SOURCE well known underground rap group. Breeze and INOJ. Just to make the circle world that,he is indeed ready to declare Memphis Bleek That was three years ago ... now they complete, fellow Georgian Pastor Troy of war. Brandi Montgomery* October 20, 1999 tEIje JHeter Students become familiar with class officers
By T'Neisha Jackson ment from the class officers with the News Writer sophomores. , "I think there needs to be communi Dave Ragland, Hollie Ware, Nicole cation between officers and the sopho Bonner and Jaime Riley are names that more class," she said. Last year, she didn't know who her students should be familiar with on cam pus. class officers were and didn't attend the They are the names of the senior, meetings. She plans on attending the junior, sophomore and freshman class meetings this year if she is made aware of presidentsfor the 1999-2000school year. them. "As an officer, it's my duty to try There are some students who said every way possible to inform them of an they are unaware of who their class offi cers are and how the officers are serving event," Bonner said. them. Some students said they question Although iHeter was not given a whetherthey are keepingtheir campaign specific date, Bonner said the first sopho promises, as the student government asso more class meeting will be held at the end of October. To make students aware of ciation should. PHOTO BYJONATHAN GRAY 'T didn't make anycampaign promis future meetings and activities, the class es because I didn't want to make promises officers plan to publicize with fliers. They The seniors and their class officers enjoy a mixer in the Women's Building I didn't know if I could fulfill," said are also developing a newsletter and get auditorium. Nicole Bonner, sophomore class presi ting information circulated by word of be distributing their newsletter, establish ments. Class officers include Ragland, mouth. dent. ing a tutoring service and participating Larculia Exum, Miss Senior and Tameka Although she made no promises to "We'll also try to get a phone list, if at with community service projects. Hill, class representative. all possible," Bonner said. her class, she and the other officers of the Watkins wasn't the only student who "The class officers' basic responsibil Unlike Bonner, freshman class presi class have met and discussed future activ was unsure of who her class officers. ity is to take the information given to them dent Riley did make campaign promises ities. The plans include a candy selling Junior Chandra Edmonson, a biology by the SGA and disperse it throughout the and says he's keeping them. The promises fund-raiser, a social and a community ser major from Sparta, 111.,could only name class," said Eric James, SGA vice presi he made included improving the condi vice project. class representative Dacia Sellare as a dent. tions of the bathrooms in Wilson and But officers have yet to meet with the junior class officer. He suggested the officers meet with Watson halls. Riley said he was currently sophomore class. The junior class officers include their class at least once a month. There are working on the is.sue. "J have no idea who the president is," Ware, president; Mary Fleming, vice pres still positions to be filled within the class. The first class meeting will be held on said Kristy Watkins, a sophomore. "I want ident; Patricia Hubbard, treasurer; Mia The positions will be filled by the Student Oct. 27. Riley said he and his officers have to know what it is they're doing for the Evans, Miss Junior and Ebony Ingram and Election Commission.* met to discuss and plan activities for the sophomore class." Sellars; class representatives. freshman class. Officers have also met the Watkins, a business administration The senior class held their first meet freshman delegation of the SGA, they will major, said there should be more involve ing on Oct. 12 at the Heiman Street apart Leaders discuss relationships at Wilson Hall By Nicholas T. Jones than men and men and that women think I did not like is that we did not have more Shaun Morrow, a freshman business infor News Writer differently. time. We'll just have to schedule another mation systems major. "The guys would The forum lasted for almost three debate." know what [the women] wanted if they hours. Some of the other topics that were "I think that it was a great positive told us." "Things you don't understand about discussed were "why do men disrespect effort of these young Black men to have Jacquay Waller, president of the fra the Black male, but were afraid to ask!!" women?" "what influences the behavior this meeting to discuss issues that young ternity and a computer science major, said was the theme of the open forum held on of men?" and "what are men looking for black men and women face each day of the fomm was successful, but felt it Thursday, Mary Sept. 30, in Wilson Hall, in a woman?" their lives," said Candance Tutwiler, a shouldn't have to take a forum to discuss sponsoredby the menofAlphaPhi Alpha "I think that it was very infomiative biology pre-med major from male and female relationships. Fraternity Inc., Beta Omicron chapter. as well as important," said Carlisa Porter, Winstonville, Miss. "I feel that it is sad that it takes a "The purpose of this forum is to a freshman mass communications major. The majority of the students in atten forum about relationships to get a great address the concerns of TSU students with "It was important because it addressed dance appreciated the efforts of the frater turnout, but at the same time, I feel that it respect to male and femalerelationships, issues that all of us experience or have nity to bring the debate to TSU. is a topic that we as Black men and what those roles are at present, what they experienced." "I think that it was a good idea. It women should be able to discuss," Waller were in the past, and what they should be Practically 'everyone in attendance gives the brothers a chance to find out said.* in the future," said Kenneth Goodman, a were involved in the question and answer what is actually on the sisters' minds," member of Alpha Phi Alpha Fraternity, session. Students formed a long line lead saidVincent Smith, a political science Inc. ing to the podium in hopes that they could major from Marion, Ind. . "The Alphas Patricia Mabry, assistant director of ^ a address a question to either males or should be credited for this because they Got news Wilson Hall, commented about friend females. Some of those who went to the have the in.sight to know that there are ships with people of the opposite sex in podium were unable to have their ques misinformed brothers," the discussion of relationships. Mabry story? tions addressed. Although most people in the audience said that a woman who has a friend of the "I think tonight's eventwasdefinitely opposite sex is said to be in a relationship, gave high praise to the debate, some had Call Mitchell a success. To all those who missed criticism. whereas a man who has a friend of the tonight's program, they missed a treat," iVantrease 963- opposite sex is said to "have a lot of "It's too specific because they're at said John Hart, a graduating seniorand a frierids." The response of Alpha Phi making it sound like that it's just for the memberofthe fraternity. " Theonly thing 5649. Alpha were that women develop faster women. What about the guys?" said Page 14 tKlje iHeter October 20, 1999 TSU PD arrest robbers in TSU parking lots By Henderson Hill III Lawson said the new induction of the Community View Writer undercover officers has been in effect for Three men were arrested by two to three weeks. Tennessee State University police in a There are three observational points parking lot near a local church where stu set up on campus by the undercover offi dents park their cars. cers as well as TSU PD. They include two On Thursday, Oct. 7, TSU PD arrest regular campus parking lots and dorm ed the three Nashvillians (who were not parkinglot of Hale Hall, were the officers students) in the parking lot adjacent to say the most problems occur. Friendship Baptist Church. "These people are dressing like the student.s, so that they can blend in," The men arrested included Jamille Lawson said. Danyez, of 3028 Sunnyview Dr.; Micheal Sgt. Carl McMillan said. "They wait J. Sneed, of 2510 Jenkins St. and William until the traffic ceases, then they break C. Edmondson, of 2121 26th Ave. North. into the cars." The officers reported that The men were caught by undercover the assailants shattered car windows with officers who had been observing the park screwdrivers, then lifted out the entire ing lots after several reported cases of BY window. PHOTO JONATHAN GRAY break-ins. He also said the TSU PD has been TennesseeState Universitypolice department found these items from the Arthur Lawson, chief of TSU PD, analyzing reports of car break-inson cam robbers who broke into students cars. saidthe individuals were caught while pus that seem to be related, as well as checking out a red unidentified vehicle. cases from 32nd Avenue and Claire your car," he said. ; , t Edmondson was charged with autoj Items such things as a .38 revolver with a Avenue in the Preston Taylor Homes two Lt. Ray Jackson, a shift supervisor, vandalism and evading arrest. Toran was four-inch barrel was found in the men's weeks ago. said the undercover police bust has been a chargedwithpossessionof a weapon, auto car as.well as a small boom box radio, a Lawson said he wants students to feel collaborative^effort. vandalism and simple possession. Sneed portableTV,book bags, CDs,books and safe, and offers preventative tips to elimi "This is able to happen because of the was charged with auto vandalism.* two or three CD players. nate more crimes. perseveranceofgoodpoliceofficers," said The three men were taken into cus "Do not leave expensive things in Officer James Kizer. tody by Metro Police.
olosses. f Mf
Buy a Coca-Cola®classic from any specially marked on-campus vending machine and you could win a commemorative Coca-Cola® classic/NFL T-Shirt*. speciallymarkedpackagingavailableInapeclaHymarkedvandlrtgmachlrtesunta11/30/80orwhilesupplieslast. Nopurchase necessary. Requestsforfree game piece must be received try 12/28/g9. See specially marked vendlrtg machlnei for detais or caB 1-800-785-2653 eimIbtCoc»«oliCoTMny. •CoiTtOo"H»aP»Icanif n»ni>iaajdmnnacT>>»CcoCo*CiOTrwn
• I October 20, 1999 ^\)e illeter Page 15 Sports Up On Deck Randy Moss: Mr. Do It All
Anthony Football Weeklyand The Football News. Miller To add to his already extraordinary list of achievements. Moss was named to the 1998-99 All-Madden Team and the 1998- 99 Pro Bowl, where he was a starter. In the 1999-2000 .season, the Sports Minnesota Vikings are 2-3 after finishing There will be a Contributor 15-1 in the regular season in 1998 before losing in the NFC championship game against the Atlanta Falcons. In 1997, no rookie had ever been the Moss has, through five games, caught foreign languages recipient of 17 touchdown passes. 21 passes for 365 yards, scored three By 1997, the only player in National touchdowns, a 17.4 yard receiving average, Football League history to have 10 touch an 8.5 yard rushing average and has yet to open house from downs of over 40 yards in a single season fumble the football this season. was Elroy Hirsch. Moss is the friend of the NBAs In 1997, no rookie in a Minnesota Sacramento Kings guard, Jason Williams, Vikings' uniform had ever scored two and this friendship has existed since the Wednesday, Oct. 27 touchdowns in their first NFL game. two attended high school together. In 1997, Randy Moss was not in the Williams would go on to play at the NFL. University of Florida, and Moss would Moss, now a second-year Viking wide attend Williams' in-state rival Florida State to Friday, Oct. 29 in receiver, in a single NFL season caught 17 University. touchdown passes (10 of which were over Neither athlete attended their universi 4b yards), scored two touchdownson ties very long. Williams was suspended the Humanities opening day, tied teammate Chris Carter from his team and Moss transferred to with .seven consecutive' games with a Marshall, where he ended his illustrious touchdown catch and set a team record for college career. Williams would get drafted most games with a touchdown reception by the Kings while Moss was drafted 21st Building. (11). overall by the Vikings. After his breathtaking performance in Inhighschool.Moss played basketball 1998, Moss was named Offensive Rookie and was named Mr. Basketball two times. of the Year by the Associated Press, Now, rumors are starting to circulate College and Pro Football Weekly and that he would like to try to use his skills in Football Digest. He was also named the the NBA. playing for the Minnesota overall Rookie of the Year by Sp.orts Timberwolves.* Illustrated, The Sporting News, Pro
Picks S X of the
Pack Jonathan Atiya James Corey Eric Ronald Gray Jones Pitts Swanson James Myles October 13-17 NCAA , Michigan Michigan Michigan Michigan Michigan Michigan Michigan vs.Illinois Florida State Florida State Florida State Florida State Florida State Florida State TSU TSU TSU TSU Florida State vs. Wake Forest TSU TSU TSU vs. Martin
NFL Green Bay Green Bay Green Bay Green Bay Green Bay Denver Green Bay vs. Denver Tenne'ssee Tennessee Tennessee New Orleans Tennessee Tennessee Atlanta St. Louis Atlanta St. Louis Tennessee vs. New Orleans St. Louis St. Louis St. Louis vs. Atlanta ®Ije iWeter Freshmen Sophomores Juniors Seniors Faculty/Staff Win/Loss record 5-2 4-3 4-3 7-0 6-1 Learn How to Prepare a Personal Statementfor Graduate School
You are invited!!! Personal Statement Worksho|i
Tuesday, November 16,1999
1:30 p.m. to 3:00 p.m.
Floyd-Payne Campus Center - Faculty Senate Room
PRESENTER
Wanda McGowan, Ph.D., Former Assistant Dean Vanderbilt University Graduate School
TTNTVERSTTY SPONSOR
Office of Graduate and Professional Opportunities TennesseeState University - Floyd-PayneCampus Center- Suite 103 Tel: (615)963-5176 Website: littp/Avww.tnstate.edu/gpo
Demetrius L. Greer, Director Angela M. Robertson, Assistant Director