DOCSLIB.ORG

Mouse Fbxw8 Conditional Knockout Project (CRISPR/Cas9)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Mouse Fbxw8 Conditional Knockout Project (CRISPR/Cas9) https://www.alphaknockout.com Mouse Fbxw8 Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Fbxw8 conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Fbxw8 gene (NCBI Reference Sequence: NM_172721 ; Ensembl: ENSMUSG00000032867 ) is located on Mouse chromosome 5. 11 exons are identified, with the ATG start codon in exon 1 and the TAG stop codon in exon 11 (Transcript: ENSMUST00000049474). Exon 4 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Fbxw8 gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-156D17 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Mice homozygous for a null allele display partial late embryonic lethality with embryonic growth retardation and abnormal placental morphology. Exon 4 starts from about 32.83% of the coding region. The knockout of Exon 4 will result in frameshift of the gene. The size of intron 3 for 5'-loxP site insertion: 3784 bp, and the size of intron 4 for 3'-loxP site insertion: 11166 bp. The size of effective cKO region: ~589 bp. The cKO region does not have any other known gene. Page 1 of 7 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele gRNA region 5' gRNA region 3' 1 4 11 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Exon of mouse Fbxw8 Homology arm cKO region loxP site Page 2 of 7 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the GC Content Distribution Window size: 300 bp Sequence 12 Summary: Full Length(7089bp) | A(21.91% 1553) | C(25.76% 1826) | T(27.39% 1942) | G(24.94% 1768) Note: The sequence of homologous arms and cKO region is analyzed to determine the GC content. No significant high GC-content region is found. So this region is suitable for PCR screening or sequencing analysis. Page 3 of 7 https://www.alphaknockout.com BLAT Search Results (up) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr5 - 118125275 118128274 3000 browser details YourSeq 59 2402 2490 3000 83.2% chr11 + 117547409 117547497 89 browser details YourSeq 58 2402 2480 3000 86.2% chr19 + 45827700 45827776 77 browser details YourSeq 58 2269 2480 3000 68.0% chr1 + 26212825 26212917 93 browser details YourSeq 57 2402 2496 3000 80.0% chr5 - 31065989 31066081 93 browser details YourSeq 57 2297 2480 3000 66.3% chr17 + 46670813 46670898 86 browser details YourSeq 55 2402 2480 3000 84.6% chr1 + 134261486 134261562 77 browser details YourSeq 54 2406 2480 3000 89.1% chr9 + 49063774 49063847 74 browser details YourSeq 54 2402 2480 3000 83.4% chr12 + 24967230 24967306 77 browser details YourSeq 53 2399 2480 3000 83.1% chr15 - 16344038 16344117 80 browser details YourSeq 53 2402 2778 3000 64.8% chr13 - 95653556 95653636 81 browser details YourSeq 52 2402 2480 3000 78.0% chr2 + 18232119 18232189 71 browser details YourSeq 51 2405 2480 3000 84.7% chr17 - 33657616 33657689 74 browser details YourSeq 51 2405 2480 3000 83.6% chr15 - 11297667 11297740 74 browser details YourSeq 51 2402 2480 3000 84.7% chr1 - 52103912 52103988 77 browser details YourSeq 51 2404 2480 3000 86.9% chr3 + 79217551 79217625 75 browser details YourSeq 51 2406 2486 3000 81.5% chr18 + 70633438 70633518 81 browser details YourSeq 51 2403 2478 3000 84.7% chr12 + 100819755 100819828 74 browser details YourSeq 50 2403 2479 3000 81.5% chr19 + 26912336 26912410 75 browser details YourSeq 50 2404 2478 3000 84.0% chr10 + 79974978 79975188 211 Note: The 3000 bp section upstream of Exon 4 is BLAT searched against the genome. No significant similarity is found. BLAT Search Results (down) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr5 - 118121686 118124685 3000 browser details YourSeq 96 666 2212 3000 90.8% chr5 + 144386635 144405057 18423 browser details YourSeq 89 2120 2594 3000 75.0% chr12 + 79277904 79278189 286 browser details YourSeq 82 2115 2318 3000 74.0% chr10 - 111279964 111280080 117 browser details YourSeq 82 2114 2275 3000 81.2% chr11 + 28424491 28424639 149 browser details YourSeq 75 2115 2219 3000 88.7% chr10 - 62876307 62876414 108 browser details YourSeq 74 2114 2214 3000 85.5% chr19 - 29308341 29308439 99 browser details YourSeq 72 2114 2222 3000 78.8% chr18 - 10552844 10552942 99 browser details YourSeq 72 2115 2218 3000 89.3% chr12 - 23543041 23543163 123 browser details YourSeq 72 2115 2218 3000 89.3% chr12 - 22384021 22384143 123 browser details YourSeq 72 2113 2218 3000 84.9% chr17 + 46517191 46517295 105 browser details YourSeq 70 2122 2218 3000 88.1% chr11 - 46643791 46643896 106 browser details YourSeq 68 2114 2218 3000 89.5% chr13 + 33928580 33928689 110 browser details YourSeq 67 2114 2214 3000 81.9% chr1 - 176252197 176252293 97 browser details YourSeq 66 2131 2219 3000 84.9% chr15 - 91669891 91669977 87 browser details YourSeq 66 2131 2218 3000 94.7% chr1 + 94045861 94045953 93 browser details YourSeq 65 2142 2318 3000 72.0% chr1 + 185430149 185430243 95 browser details YourSeq 64 2117 2219 3000 80.7% chr11 - 23216825 23216922 98 browser details YourSeq 64 2117 2226 3000 84.1% chr11 + 3230637 3230746 110 browser details YourSeq 62 2116 2219 3000 76.0% chr16 - 31914251 31914336 86 Note: The 3000 bp section downstream of Exon 4 is BLAT searched against the genome. No significant similarity is found. Page 4 of 7 https://www.alphaknockout.com Gene and protein information: Fbxw8 F-box and WD-40 domain protein 8 [ Mus musculus (house mouse) ] Gene ID: 231672, updated on 12-Aug-2019 Gene summary Official Symbol Fbxw8 provided by MGI Official Full Name F-box and WD-40 domain protein 8 provided by MGI Primary source MGI:MGI:1923041 See related Ensembl:ENSMUSG00000032867 Gene type protein coding RefSeq status VALIDATED Organism Mus musculus Lineage Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus Also known as FBW6; FBW8; Fbx29; FBXO29; 4930438M06Rik Expression Ubiquitous expression in ovary adult (RPKM 39.6), subcutaneous fat pad adult (RPKM 36.4) and 28 other tissues See more Orthologs human all Genomic context Location: 5; 5 F See Fbxw8 in Genome Data Viewer Exon count: 11 Annotation release Status Assembly Chr Location 108 current GRCm38.p6 (GCF_000001635.26) 5 NC_000071.6 (118064981..118155458, complement) Build 37.2 previous assembly MGSCv37 (GCF_000001635.18) 5 NC_000071.5 (118514990..118605467, complement) Chromosome 5 - NC_000071.6 Page 5 of 7 https://www.alphaknockout.com Transcript information: This gene has 2 transcripts Gene: Fbxw8 ENSMUSG00000032867 Description F-box and WD-40 domain protein 8 [Source:MGI Symbol;Acc:MGI:1923041] Gene Synonyms 4930438M06Rik, FBW6, FBW8, FBXO29, Fbx29 Location Chromosome 5: 118,064,965-118,155,464 reverse strand. GRCm38:CM000998.2 About this gene This gene has 2 transcripts (splice variants), 193 orthologues, 27 paralogues, is a member of 1 Ensembl protein family and is associated with 23 phenotypes. Transcripts Name Transcript ID bp Protein Translation ID Biotype CCDS UniProt Flags Fbxw8-201 ENSMUST00000049474.8 5000 598aa ENSMUSP00000047012.7 Protein coding CCDS19609 Q8BIA4 TSL:1 GENCODE basic APPRIS P1 Fbxw8-202 ENSMUST00000201545.1 1937 No protein - Retained intron - - TSL:1 110.50 kb Forward strand 118.06Mb 118.08Mb 118.10Mb 118.12Mb 118.14Mb 118.16Mb Genes Tesc-201 >protein coding Hrk-202 >lncRNA (Comprehensive set... Tesc-202 >nonsense mediated decay Tesc-203 >retained intron Tesc-206 >lncRNGAm9754-201 >lncRNA Contigs < AC114993.18 < AC110254.11 Genes (Comprehensive set... < Fbxw8-201protein coding < Fbxw8-202retained intron < Gm26411-201snRNA Regulatory Build 118.06Mb 118.08Mb 118.10Mb 118.12Mb 118.14Mb 118.16Mb Reverse strand 110.50 kb Regulation Legend CTCF Enhancer Open Chromatin Promoter Promoter Flank Transcription Factor Binding Site Gene Legend Protein Coding merged Ensembl/Havana Non-Protein Coding RNA gene processed transcript Page 6 of 7 https://www.alphaknockout.com Transcript: ENSMUST00000049474 < Fbxw8-201protein coding Reverse strand 90.50 kb ENSMUSP00000047... MobiDB lite Low complexity (Seg) Superfamily F-box-like domain superfamily WD40-repeat-containing domain superfamily SMART F-box domain WD40 repeat Pfam F-box domain PROSITE profiles F-box domain WD40 repeat WD40-repeat-containing domain PROSITE patterns WD40 repeat, conserved site PANTHER PTHR44019:SF11 PTHR44019 Gene3D 1.20.1280.50 WD40/YVTN repeat-like-containing domain superfamily All sequence SNPs/i... Sequence variants (dbSNP and all other sources) Variant Legend missense variant synonymous variant Scale bar 0 60 120 180 240 300 360 420 480 598 We wish to acknowledge the following valuable scientific information resources: Ensembl, MGI, NCBI, UCSC. Page 7 of 7.
Load more

Recommended publications
  • FBXW8 (NM 153348) Human Recombinant Protein Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TP761689 FBXW8 (NM_153348) Human Recombinant Protein Product data: Product Type: Recombinant Proteins Description: Purified recombinant protein of Human F-box and WD repeat domain containing 8 (FBXW8), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug Species: Human Expression Host: E. coli Tag: N-His Predicted MW: 67.2 kDa Concentration: >50 ug/mL as determined by microplate BCA method Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Buffer: 50mM Tris, pH8.0,8M Urea. Storage: Store at -80°C. Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. RefSeq: NP_699179 Locus ID: 26259 UniProt ID: Q8N3Y1 RefSeq Size: 4871 Cytogenetics: 12q24.22 RefSeq ORF: 1794 Synonyms: FBW6; FBW8; FBX29; FBXO29; FBXW6 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 FBXW8 (NM_153348) Human Recombinant Protein – TP761689 Summary: This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1- cullin-F-box), which function in phosphorylation-dependent ubiquitination.
    [Show full text]
  • Nº Ref Uniprot Proteína Péptidos Identificados Por MS/MS 1 P01024
    Document downloaded from http://www.elsevier.es, day 26/09/2021. This copy is for personal use. Any transmission of this document by any media or format is strictly prohibited. Nº Ref Uniprot Proteína Péptidos identificados 1 P01024 CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 por 162MS/MS 2 P02751 FINC_HUMAN Fibronectin OS=Homo sapiens GN=FN1 PE=1 SV=4 131 3 P01023 A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=3 128 4 P0C0L4 CO4A_HUMAN Complement C4-A OS=Homo sapiens GN=C4A PE=1 SV=1 95 5 P04275 VWF_HUMAN von Willebrand factor OS=Homo sapiens GN=VWF PE=1 SV=4 81 6 P02675 FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens GN=FGB PE=1 SV=2 78 7 P01031 CO5_HUMAN Complement C5 OS=Homo sapiens GN=C5 PE=1 SV=4 66 8 P02768 ALBU_HUMAN Serum albumin OS=Homo sapiens GN=ALB PE=1 SV=2 66 9 P00450 CERU_HUMAN Ceruloplasmin OS=Homo sapiens GN=CP PE=1 SV=1 64 10 P02671 FIBA_HUMAN Fibrinogen alpha chain OS=Homo sapiens GN=FGA PE=1 SV=2 58 11 P08603 CFAH_HUMAN Complement factor H OS=Homo sapiens GN=CFH PE=1 SV=4 56 12 P02787 TRFE_HUMAN Serotransferrin OS=Homo sapiens GN=TF PE=1 SV=3 54 13 P00747 PLMN_HUMAN Plasminogen OS=Homo sapiens GN=PLG PE=1 SV=2 48 14 P02679 FIBG_HUMAN Fibrinogen gamma chain OS=Homo sapiens GN=FGG PE=1 SV=3 47 15 P01871 IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 41 16 P04003 C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sapiens GN=C4BPA PE=1 SV=2 37 17 Q9Y6R7 FCGBP_HUMAN IgGFc-binding protein OS=Homo sapiens GN=FCGBP PE=1 SV=3 30 18 O43866 CD5L_HUMAN CD5 antigen-like OS=Homo
    [Show full text]
  • Prostate Cancer Cell Proliferation Is Suppressed by Microrna‑3160‑5P Via Targeting of F‑Box and WD Repeat Domain Containing 8
    9436 ONCOLOGY LETTERS 15: 9436-9442, 2018 Prostate cancer cell proliferation is suppressed by microRNA‑3160‑5p via targeting of F‑box and WD repeat domain containing 8 PING LIN1*, LIJUAN ZHU1*, WENJING SUN1, ZHENGKAI YANG1, HUI SUN1, DONG LI1, RONGJUN CUI1,2, XIULAN ZHENG1,3 and XIAOGUANG YU1 1Department of Biochemistry and Molecular Biology, Harbin Medical University, Harbin, Heilongjiang 150081; 2Department of Biochemistry and Molecular Biology, Mudanjiang Medical University, Mudanjiang, Heilongjiang 157011; 3Department of Ultrasonography and Medical Oncology, Harbin Medical University Cancer Hospital, Harbin, Heilongjiang 150081, P.R. China Received January 19, 2016; Accepted December 15, 2017 DOI: 10.3892/ol.2018.8505 Abstract. MicroRNAs (miRNAs/miRs), which are endog- Introduction enous non-coding single-stranded RNAs 19-25 nucleotides in length, regulate gene expression by blocking translation Prostate cancer (PCa) is the most frequently diagnosed cancer or transcription repression. The present study revealed that in males. Furthermore, PCa is the second leading cause of miR-3160-5p was widely expressed in prostate cancer cells by cancer-associated mortality in males in the USA and there reverse transcription-quantitative polymerase chain reaction. were 220,800 reported cases of PCa in the USA in 2015 (1). There was a negative association between the expression of Additionally, the mortality and incidence rates of PCa have miR-3160-5p and F-box and WD repeat domain containing increased rapidly in China (2). Surgery and radiotherapy are 8 (Fbxw8) in prostate cancer DU145 cells. A luciferase successful treatments for early and localized tumors (3,4), but activity assay was used to verify that Fbxw8 is the target of the preferred therapy for advanced PCa is androgen-depri- miR-3160-5p.
    [Show full text]
  • The GALNT9, BNC1 and CCDC8 Genes Are Frequently Epigenetically Dysregulated in Breast Tumours That Metastasise to the Brain Rajendra P
    Pangeni et al. Clinical Epigenetics (2015) 7:57 DOI 10.1186/s13148-015-0089-x RESEARCH Open Access The GALNT9, BNC1 and CCDC8 genes are frequently epigenetically dysregulated in breast tumours that metastasise to the brain Rajendra P. Pangeni1, Prasanna Channathodiyil1, David S. Huen2, Lawrence W. Eagles1, Balraj K. Johal2, Dawar Pasha2, Natasa Hadjistephanou2, Oliver Nevell2, Claire L. Davies2, Ayobami I. Adewumi2, Hamida Khanom2, Ikroop S. Samra2, Vanessa C. Buzatto2, Preethi Chandrasekaran2, Thoraia Shinawi3, Timothy P. Dawson4, Katherine M. Ashton4, Charles Davis4, Andrew R. Brodbelt5, Michael D. Jenkinson5, Ivan Bièche6, Farida Latif3, John L. Darling1, Tracy J. Warr1 and Mark R. Morris1,2,3* Abstract Background: Tumour metastasis to the brain is a common and deadly development in certain cancers; 18–30 % of breast tumours metastasise to the brain. The contribution that gene silencing through epigenetic mechanisms plays in these metastatic tumours is not well understood. Results: We have carried out a bioinformatic screen of genome-wide breast tumour methylation data available at The Cancer Genome Atlas (TCGA) and a broad literature review to identify candidate genes that may contribute to breast to brain metastasis (BBM). This analysis identified 82 candidates. We investigated the methylation status of these genes using Combined Bisulfite and Restriction Analysis (CoBRA) and identified 21 genes frequently methylated in BBM. We have identified three genes, GALNT9, CCDC8 and BNC1, that were frequently methylated (55, 73 and 71 %, respectively) and silenced in BBM and infrequently methylated in primary breast tumours. CCDC8 was commonly methylated in brain metastases and their associated primary tumours whereas GALNT9 and BNC1 were methylated and silenced only in brain metastases, but not in the associated primary breast tumours from individual patients.
    [Show full text]
  • (^{\Text{Fbxw8}}\) Ubiquitin Ligase Signaling Mechanism Regulates Golgi Morphology and Dendrite Patterning
    An OBSL1-Cul7\(^{\text{Fbxw8}}\) Ubiquitin Ligase Signaling Mechanism Regulates Golgi Morphology and Dendrite Patterning The Harvard community has made this article openly available. Please share how this access benefits you. Your story matters Citation Litterman, Nadia, Yoshiho Ikeuchi, Gilbert Gallardo, Brenda C. O'Connell, Mathew E. Sowa, Steven P. Gygi, J. Wade Harper, and Azad Bonni. 2011. An OBSL1-Cul7\(^{\text{Fbxw8}}\) ubiquitin ligase signaling mechanism regulates Golgi morphology and dendrite patterning. PLoS Biology 9(5): e1001060. Published Version doi://10.1371/journal.pbio.1001060 Citable link http://nrs.harvard.edu/urn-3:HUL.InstRepos:7989737 Terms of Use This article was downloaded from Harvard University’s DASH repository, and is made available under the terms and conditions applicable to Other Posted Material, as set forth at http:// nrs.harvard.edu/urn-3:HUL.InstRepos:dash.current.terms-of- use#LAA An OBSL1-Cul7Fbxw8 Ubiquitin Ligase Signaling Mechanism Regulates Golgi Morphology and Dendrite Patterning Nadia Litterman1,2, Yoshiho Ikeuchi1, Gilbert Gallardo1, Brenda C. O’Connell1, Mathew E. Sowa1, Steven P. Gygi3, J. Wade Harper1, Azad Bonni1,2* 1 Department of Pathology, Harvard Medical School, Boston, Massachusetts, United States of America, 2 Program in Neuroscience, Harvard Medical School, Boston, Massachusetts, United States of America, 3 Department of Cell Biology, Harvard Medical School, Boston, Massachusetts, United States of America Abstract The elaboration of dendrites in neurons requires secretory trafficking through the Golgi apparatus, but the mechanisms that govern Golgi function in neuronal morphogenesis in the brain have remained largely unexplored. Here, we report that the E3 ubiquitin ligase Cul7Fbxw8 localizes to the Golgi complex in mammalian brain neurons.
    [Show full text]
  • Mid-Gestation Lethality of Atxn2l-Ablated Mice
    International Journal of Molecular Sciences Article Mid-Gestation lethality of Atxn2l-Ablated Mice Jana Key 1,2, Patrick N. Harter 3, Nesli-Ece Sen 1,2, Elise Gradhand 4, Georg Auburger 1,* and Suzana Gispert 1,* 1 Exp. Neurology, Medical Faculty, Goethe University, Theodor Stern Kai 7, 60590 Frankfurt am Main, Germany; [email protected] (J.K.); [email protected] (N.-E.S.) 2 Faculty of Biosciences, Goethe-University, Altenhöferallee 1, 60438 Frankfurt am Main, Germany 3 Institute of Neurology (Edinger-Institute), University Hospital Frankfurt, Goethe University, Heinrich-Hoffmann-Strasse 7, 60528 Frankfurt am Main, Germany; [email protected] 4 Dr. Senckenberg Institute for Pathology, University Hospital, Goethe University, Theodor-Stern-Kai-7, 60590 Frankfurt am Main, Germany; [email protected] * Correspondence: [email protected] (G.A.); [email protected] (S.G.); Tel.: +49-69-6301-7428 (G.A.); +49-69-6301-7417 (S.G.) Received: 19 June 2020; Accepted: 16 July 2020; Published: 20 July 2020 Abstract: Depletion of yeast/fly Ataxin-2 rescues TDP-43 overexpression toxicity. In mouse models of Amyotrophic Lateral Sclerosis via TDP-43 overexpression, depletion of its ortholog ATXN2 mitigated motor neuron degeneration and extended lifespan from 25 days to >300 days. There is another ortholog in mammals, named ATXN2L (Ataxin-2-like), which is almost uncharacterized but also functions in RNA surveillance at stress granules. We generated mice with Crispr/Cas9-mediated deletion of Atxn2l exons 5-8, studying homozygotes prenatally and heterozygotes during aging. Our novel findings indicate that ATXN2L absence triggers mid-gestational embryonic lethality, affecting female animals more strongly.
    [Show full text]
  • NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer
    Florida International University FIU Digital Commons FIU Electronic Theses and Dissertations University Graduate School 11-7-2018 Decipher Mechanisms by which Nuclear Respiratory Factor One (NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer Jairo Ramos [email protected] Follow this and additional works at: https://digitalcommons.fiu.edu/etd Part of the Clinical Epidemiology Commons Recommended Citation Ramos, Jairo, "Decipher Mechanisms by which Nuclear Respiratory Factor One (NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer" (2018). FIU Electronic Theses and Dissertations. 3872. https://digitalcommons.fiu.edu/etd/3872 This work is brought to you for free and open access by the University Graduate School at FIU Digital Commons. It has been accepted for inclusion in FIU Electronic Theses and Dissertations by an authorized administrator of FIU Digital Commons. For more information, please contact [email protected]. FLORIDA INTERNATIONAL UNIVERSITY Miami, Florida DECIPHER MECHANISMS BY WHICH NUCLEAR RESPIRATORY FACTOR ONE (NRF1) COORDINATES CHANGES IN THE TRANSCRIPTIONAL AND CHROMATIN LANDSCAPE AFFECTING DEVELOPMENT AND PROGRESSION OF INVASIVE BREAST CANCER A dissertation submitted in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY in PUBLIC HEALTH by Jairo Ramos 2018 To: Dean Tomás R. Guilarte Robert Stempel College of Public Health and Social Work This dissertation, Written by Jairo Ramos, and entitled Decipher Mechanisms by Which Nuclear Respiratory Factor One (NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer, having been approved in respect to style and intellectual content, is referred to you for judgment.
    [Show full text]
  • FBXW8 (Human) Recombinant Protein (Q01)
    Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic FBXW8 (Human) Recombinant subunits of ubiquitin protein ligase complex called SCFs Protein (Q01) (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box Catalog Number: H00026259-Q01 proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, Regulation Status: For research use only (RUO) and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The Product Description: Human FBXW8 partial ORF ( protein encoded by this gene contains a WD-40 domain, NP_699179, 499 a.a. - 598 a.a.) recombinant protein in addition to an F-box motif, so it belongs to the Fbw with GST-tag at N-terminal. class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Sequence: [provided by RefSeq] VWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQ TVMRNADLDSFTTHRRHRGLIRAYEFAVDQLAFQSPL PVCRSSCDAMATHYYDLALAFPYNHV Host: Wheat Germ (in vitro) Theoretical MW (kDa): 36.74 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
    [Show full text]
  • Polyclonal Antibody to FBXW8 (Center) - Aff - Purified
    OriGene Technologies, Inc. OriGene Technologies GmbH 9620 Medical Center Drive, Ste 200 Schillerstr. 5 Rockville, MD 20850 32052 Herford UNITED STATES GERMANY Phone: +1-888-267-4436 Phone: +49-5221-34606-0 Fax: +1-301-340-8606 Fax: +49-5221-34606-11 [email protected] [email protected] AP51638PU-N Polyclonal Antibody to FBXW8 (Center) - Aff - Purified Alternate names: F-box and WD-40 domain-containing protein 8, F-box only protein 29, F-box/WD repeat-containing protein 8, FBW6, FBW8, FBX29, FBXO29, FBXW6 Quantity: 0.4 ml Concentration: lot specific Background: This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. Uniprot ID: Q8N3Y1 NCBI: NP_036306 GeneID: 26259 Host / Isotype: Rabbit / Ig Immunogen: KLH conjugated synthetic peptide between 273-303 amino acids from the Central region of human FBXW8 Format: State: Liquid purified Ig fraction Purification: Affinity chromatography on Protein A Buffer System: PBS Preservatives: 0.09% (W/V) sodium azide Applications: ELISA: 1/1000.
    [Show full text]
  • FBXW8 (Center) Rabbit Polyclonal Antibody Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for AP51638PU-N FBXW8 (Center) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: FC, IHC, WB Recommended Dilution: ELISA: 1/1000. Western Blot: 1/100 - 1/500. Immunohistochemistry on paraffin sections: 1/50 - 1/100. Reactivity: Human, Mouse Host: Rabbit Isotype: Ig Clonality: Polyclonal Immunogen: KLH conjugated synthetic peptide between 273-303 amino acids from the Central region of human FBXW8 Specificity: This antibody reacts to FBXW8. Formulation: PBS State: Aff - Purified State: Liquid purified Ig fraction Preservative: 0.09% (W/V) sodium azide Concentration: lot specific Purification: Affinity chromatography on Protein A Conjugation: Unconjugated Storage: Store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer. Avoid repeated freezing and thawing. Stability: Shelf life: one year from despatch. Predicted Protein Size: 67394 Da Gene Name: Homo sapiens F-box and WD repeat domain containing 8 (FBXW8), transcript variant 2 Database Link: Entrez Gene 231672 MouseEntrez Gene 26259 Human Q8N3Y1 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 FBXW8 (Center) Rabbit Polyclonal Antibody – AP51638PU-N Background: This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1- cullin-F-box), which function in phosphorylation-dependent ubiquitination.
    [Show full text]
  • Ubiquitin Ligases at the Heart of Skeletal Muscle Atrophy Control
    molecules Review Ubiquitin Ligases at the Heart of Skeletal Muscle Atrophy Control Dulce Peris-Moreno , Laura Cussonneau, Lydie Combaret ,Cécile Polge † and Daniel Taillandier *,† Unité de Nutrition Humaine (UNH), Institut National de Recherche pour l’Agriculture, l’Alimentation et l’Environnement (INRAE), Université Clermont Auvergne, F-63000 Clermont-Ferrand, France; [email protected] (D.P.-M.); [email protected] (L.C.); [email protected] (L.C.); [email protected] (C.P.) * Correspondence: [email protected] † These authors contributed equally to the work. Abstract: Skeletal muscle loss is a detrimental side-effect of numerous chronic diseases that dramati- cally increases mortality and morbidity. The alteration of protein homeostasis is generally due to increased protein breakdown while, protein synthesis may also be down-regulated. The ubiquitin proteasome system (UPS) is a master regulator of skeletal muscle that impacts muscle contractile properties and metabolism through multiple levers like signaling pathways, contractile apparatus degradation, etc. Among the different actors of the UPS, the E3 ubiquitin ligases specifically target key proteins for either degradation or activity modulation, thus controlling both pro-anabolic or pro-catabolic factors. The atrogenes MuRF1/TRIM63 and MAFbx/Atrogin-1 encode for key E3 ligases that target contractile proteins and key actors of protein synthesis respectively. However, several other E3 ligases are involved upstream in the atrophy program, from signal transduction control to modulation of energy balance. Controlling E3 ligases activity is thus a tempting approach for preserving muscle mass. While indirect modulation of E3 ligases may prove beneficial in some situations of muscle atrophy, some drugs directly inhibiting their activity have started to appear.
    [Show full text]
  • Integrative Network Analysis for Survival-Associated Gene-Gene Interactions Across Multiple Genomic Profiles in Ovarian Cancer
    Jeong et al. Journal of Ovarian Research (2015) 8:42 DOI 10.1186/s13048-015-0171-1 RESEARCH Open Access Integrative network analysis for survival- associated gene-gene interactions across multiple genomic profiles in ovarian cancer Hyun-hwan Jeong, Sangseob Leem, Kyubum Wee and Kyung-Ah Sohn* Abstract Background: Recent advances in high-throughput technology and the emergence of large-scale genomic datasets have enabled detection of genomic features that affect clinical outcomes. Although many previous computational studies have analysed the effect of each single gene or the additive effects of multiple genes on the clinical outcome, less attention has been devoted to the identification of gene-gene interactions of general type that are associated with the clinical outcome. Moreover, the integration of information from multiple molecular profiles adds another challenge to this problem. Recently, network-based approaches have gained huge popularity. However, previous network construction methods have been more concerned with the relationship between features only, rather than the effect of feature interactions on clinical outcome. Methods: We propose a mutual information-based integrative network analysis framework (MINA) that identifies gene pairs associated with clinical outcome and systematically analyses the resulting networks over multiple genomic profiles. We implement an efficient non-parametric testing scheme that ensures the significance of detected gene interactions. We develop a tool named MINA that automates the proposed analysis scheme of identifying outcome- associated gene interactions and generating various networks from those interacting pairs for downstream analysis. Results: We demonstrate the proposed framework using real data from ovarian cancer patients in The Cancer Genome Atlas (TCGA).
    [Show full text]