Moyamoya Disease Susceptibility Gene RNF213 Links Inflammatory
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
A New Horizon of Moyamoya Disease and Associated Health Risks Explored Through RNF213
Environ Health Prev Med (2016) 21:55–70 DOI 10.1007/s12199-015-0498-7 REVIEW A new horizon of moyamoya disease and associated health risks explored through RNF213 1 1 2 1 Akio Koizumi • Hatasu Kobayashi • Toshiaki Hitomi • Kouji H. Harada • 3 4 Toshiyuki Habu • Shohab Youssefian Received: 18 September 2015 / Accepted: 18 November 2015 / Published online: 10 December 2015 Ó The Author(s) 2015. This article is published with open access at Springerlink.com Abstract The cerebrovascular disorder moyamoya dis- and also address the public health contributions to current ease (MMD) was first described in 1957 in Japan, and is unresolved issues of MMD. We also emphasize the typically considered to be an Asian-specific disease. importance of a more updated definition for MMD, of However, it is globally recognized as one of the major qualified cohort studies based on genetic epidemiology and causes of childhood stroke. Although several monogenic an awareness of the ethical issues associated with genetic diseases are known to be complicated by Moyamoya testing of carriers. angiopathy, the ring finger protein 213 gene (RNF213) was identified as a susceptibility gene for MMD. RNF213 is Keywords Moyamoya disease Á RNF213 R4810K Á Asian unusual, because (1) it induces MMD with no other rec- founder mutation Á Angiogenesis Á Hypoxia ognizable phenotypes, (2) the RNF213 p.R4810K variant is an Asian founder mutation common to Japanese, Korean and Chinese with carrier rates of 0.5–2 % of the general Introduction population but a low penetrance, and (3) it encodes a rel- atively largest proteins with a dual AAA? ATPase and E3 Moyamoya disease (MMD) is a steno-occlusive disease of Ligase activities. -
International Journal of Genomics and Data Mining
International Journal of Genomics and Data Mining Asadi S, et al. Int J Genom Data Min 01: 103. Research Article DOI: 10.29011/2577-0616.000103 Molecular Study of Genomics Mutations in RNF213, ACTA2, GUCY1A3 Genes in Patients Moyamoya Syndrome in Human Shahin Asadi1*, Mahsa Jamali1, Samaneh Sadeh Dell2, Manoush Tohidirad2 *1Young Researchers and Elite Club, Tabriz Branch, Islamic Azad University, Tabriz, Iran. 2Molecular Biology Genetics, Elite Club, Tabriz Branch, Islamic Azad University, Tabriz, Iran *Corresponding author: Shahin Asadi, Molecular Genetics, Elite Club, Tabriz Branch, Islamic Azad University, Tabriz, Iran, Tel: +98 9379923364; Email: [email protected]. Citation: Asadi S, Jamali M, Dell SS (2017) Molecular Study of Genomics Mutations in RNF213, ACTA2,GUCY1A3 Genes in patients Moyamoya Syndrome in Human.Int J Genom Data Min 01: 103. DOI: 10.29011/2577-0616.000103 Received Date: 17 February 2017; Accepted Date: 27 February 2017; Published Date: 06 March, 2017 Abstract In this study, we have analyzed 50 people. 20 patients Moyamoya disease and 30 Persons control group.The genes RNF213 on chromosome 17q25, ACTA2 on chromosome 10q23.3,GUCY1A3 on chromosome 4q32, analyzed in terms of genetic mutations made. In this study, people who have genetic mutations were targeted, with nervous dis- orders, Moyamoya disease. In fact, of all people with Moyamoya disease. 20 patients Moyamoya disease had a genetic mutation in the genes RNF213 on chromosome 17q25,ACTA2 on chromosome 10q23.3,GUCY1A3 on chromosome 4q32 Moyamoya disease. Any genetic mutations in the target genes control group, did not show. Keywords: Genetic study; Moyamoya disease; Mutations in and also by blood clots (thrombosis) [1]. -
RNF213 (NM 020954) Human Untagged Clone Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for SC126169 RNF213 (NM_020954) Human Untagged Clone Product data: Product Type: Expression Plasmids Product Name: RNF213 (NM_020954) Human Untagged Clone Tag: Tag Free Symbol: RNF213 Synonyms: ALO17; C17orf27; KIAA1618; MYMY2; MYSTR; NET57 Vector: pCMV6-XL5 E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: None Fully Sequenced ORF: >OriGene sequence for NM_020954 edited GCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGT GACAGGACATGTAGTATATAGCAGGCTGCCAGCGACTCCTGCTCTTGCTTCTGGATCTGC AGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAA ACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGAT TCTGAGAACAATAACTCCACAATGGCGTCGGCCTCGGAGGGTGAAATGGAGTGTGGGCAG GAGCTGAAGGAGGAAGGGGGCCCGTGCTTGTTCCCGGGCTCAGACAGTTGGCAAGAAAAC CCCGAGGAGCCCTGTTCCAAAGCCTCCTGGACCGTCCAAGAAAGCAAAAAGAAGAAAAGG AAGAAGAAAAAGAAGGGGAACAAGTCCGCTTCCTCAGAGCTGGCTTCCTTGCCCCTTTCT CCTGCCAGCCCCTGTCACCTGACTTTGCTTTCAAACCCATGGCCTCAGGACACAGCCCTG CCCCACAGCCAAGCCCAGCAGAGTGGCCCCACTGGCCAGCCGAGCCAGCCCCCGGGCACA GCCACCACGCCACTGGAGGGTGACGGCCTCTCCGCGCCCACCGAGGTTGGCGACAGCCCC CTGCAGGCCCAGGCTTTGGGAGAGGCAGGAGTGGCCACAGGAAGTGAGGCTCAGAGCAGC CCGCAATTCCAGGACCACACGGAAGGGGAGGACCAGGACGCTTCCATCCCCTCTGGGGGC AGAGGCCTGTCCCAGGAGGGGACCGGTCCCCCCACCTCTGCTGGTGAAGGCCATTCTAGG ACTGAAGATGCTGCCCAGGAGCTCCTGTTGCCTGAGTCAAAAGGAGGCAGCTCTGAGCCC GGGACAGAACTGCAGACCACCGAGCAACAGGCAGGGGCCTCAGCCTCTACGGCAGTTGAT -
Entrez ID Gene Name Fold Change Q-Value Description
Entrez ID gene name fold change q-value description 4283 CXCL9 -7.25 5.28E-05 chemokine (C-X-C motif) ligand 9 3627 CXCL10 -6.88 6.58E-05 chemokine (C-X-C motif) ligand 10 6373 CXCL11 -5.65 3.69E-04 chemokine (C-X-C motif) ligand 11 405753 DUOXA2 -3.97 3.05E-06 dual oxidase maturation factor 2 4843 NOS2 -3.62 5.43E-03 nitric oxide synthase 2, inducible 50506 DUOX2 -3.24 5.01E-06 dual oxidase 2 6355 CCL8 -3.07 3.67E-03 chemokine (C-C motif) ligand 8 10964 IFI44L -3.06 4.43E-04 interferon-induced protein 44-like 115362 GBP5 -2.94 6.83E-04 guanylate binding protein 5 3620 IDO1 -2.91 5.65E-06 indoleamine 2,3-dioxygenase 1 8519 IFITM1 -2.67 5.65E-06 interferon induced transmembrane protein 1 3433 IFIT2 -2.61 2.28E-03 interferon-induced protein with tetratricopeptide repeats 2 54898 ELOVL2 -2.61 4.38E-07 ELOVL fatty acid elongase 2 2892 GRIA3 -2.60 3.06E-05 glutamate receptor, ionotropic, AMPA 3 6376 CX3CL1 -2.57 4.43E-04 chemokine (C-X3-C motif) ligand 1 7098 TLR3 -2.55 5.76E-06 toll-like receptor 3 79689 STEAP4 -2.50 8.35E-05 STEAP family member 4 3434 IFIT1 -2.48 2.64E-03 interferon-induced protein with tetratricopeptide repeats 1 4321 MMP12 -2.45 2.30E-04 matrix metallopeptidase 12 (macrophage elastase) 10826 FAXDC2 -2.42 5.01E-06 fatty acid hydroxylase domain containing 2 8626 TP63 -2.41 2.02E-05 tumor protein p63 64577 ALDH8A1 -2.41 6.05E-06 aldehyde dehydrogenase 8 family, member A1 8740 TNFSF14 -2.40 6.35E-05 tumor necrosis factor (ligand) superfamily, member 14 10417 SPON2 -2.39 2.46E-06 spondin 2, extracellular matrix protein 3437 -
The Transcriptional Roles of ALK Fusion Proteins in Tumorigenesis
cancers Review The Transcriptional Roles of ALK Fusion Proteins in Tumorigenesis 1, 2, , 1, Stephen P. Ducray y , Karthikraj Natarajan y z, Gavin D. Garland z, 1, , 2,3, , Suzanne D. Turner * y and Gerda Egger * y 1 Division of Cellular and Molecular Pathology, Department of Pathology, University of Cambridge, Cambridge CB20QQ, UK 2 Department of Pathology, Medical University Vienna, 1090 Vienna, Austria 3 Ludwig Boltzmann Institute Applied Diagnostics, 1090 Vienna, Austria * Correspondence: [email protected] (S.D.T.); [email protected] (G.E.) European Research Initiative for ALK-related malignancies; www.erialcl.net. y These authors contributed equally to this work. z Received: 7 June 2019; Accepted: 23 July 2019; Published: 30 July 2019 Abstract: Anaplastic lymphoma kinase (ALK) is a tyrosine kinase involved in neuronal and gut development. Initially discovered in T cell lymphoma, ALK is frequently affected in diverse cancers by oncogenic translocations. These translocations involve different fusion partners that facilitate multimerisation and autophosphorylation of ALK, resulting in a constitutively active tyrosine kinase with oncogenic potential. ALK fusion proteins are involved in diverse cellular signalling pathways, such as Ras/extracellular signal-regulated kinase (ERK), phosphatidylinositol 3-kinase (PI3K)/Akt and Janus protein tyrosine kinase (JAK)/STAT. Furthermore, ALK is implicated in epigenetic regulation, including DNA methylation and miRNA expression, and an interaction with nuclear proteins has been described. Through these mechanisms, ALK fusion proteins enable a transcriptional programme that drives the pathogenesis of a range of ALK-related malignancies. Keywords: ALK; ALCL; NPM-ALK; EML4-ALK; NSCLC; ALK-translocation proteins; epigenetics 1. Introduction Anaplastic lymphoma kinase (ALK) was first successfully cloned in 1994 when it was reported in the context of a fusion protein in cases of anaplastic large cell lymphoma (ALCL) [1]. -
RNF213 Gene Silencing Upregulates Transforming Growth Factor Β1
EXPERIMENTAL AND THERAPEUTIC MEDICINE 22: 1024, 2021 RNF213 gene silencing upregulates transforming growth factor β1 expression in bone marrow‑derived mesenchymal stem cells and is involved in the onset of Moyamoya disease CHANGSHUI WANG1, CUILIAN SUN1, YUESHU ZHAO1, HUIMIN SONG1, ZHENGYOU LI2, FENG JIN1 and CHANGMENG CUI1 1Department of Neurosurgery, Affiliated Hospital of Jining Medical University, Jining, Shandong 272000; 2Department of Neurosyrgery, Shandong Province Western Hospital, Shandong Province ENT Hospital, Jinan, Shandong 250022, P.R. China Received August 27, 2020; Accepted December 12, 2020 DOI: 10.3892/etm.2021.10456 Abstract. Moyamoya disease (MMD) is a chronic and progres‑ any effect on VEGF gene expression. In conclusion, these find‑ sive cerebrovascular occlusion disease, the precise etiology of ings suggested that that RNF213 knockdown may contribute which is poorly understood. Ring finger protein 213 (RNF213) to aberrant TGF‑β1 expression via a pathway that remains has been previously identified as a susceptibility gene that to be unidentified, indicating that quantitative changes in serves an important role in angiogenesis, where it has been RNF213 gene expression may serve an important role in the shown to be closely associated with the onset of MMD. pathogenesis of MMD. Patients with MMD exhibit increased expression levels of various pro‑inflammatory molecules and angiogenic factors. Introduction Under certain conditions, bone marrow mesenchymal stem cells (BMSCs) have the ability to differentiate to form Moyamoya disease (MMD) was first defined by Suzuki neuron‑like and microglia‑like cells. In the present study, a and Takaku in 1999 (1) and presents as the presence of an total of 40 MMD patients and 40 healthy individuals were abnormal vascular network at the base of the brain. -
Anti-RNF213 / C17orf 27 Antibody (ARG64109)
Product datasheet [email protected] ARG64109 Package: 100 μg anti-RNF213 / C17orf 27 antibody Store at: -20°C Summary Product Description Goat Polyclonal antibody recognizes RNF213 / C17orf 27 Tested Reactivity Hu Tested Application IHC-P Host Goat Clonality Polyclonal Isotype IgG Target Name RNF213 / C17orf 27 Antigen Species Human Immunogen C-KTAAVLKWNRE Conjugation Un-conjugated Alternate Names MYMY2; EC 6.3.2.-; NET57; E3 ubiquitin-protein ligase RNF213; ALK lymphoma oligomerization partner on chromosome 17; KIAA1618; RING finger protein 213; Mysterin; ALO17; MYSTR; C17orf27 Application Instructions Application table Application Dilution IHC-P 2.5 µg/ml Application Note IHC-P: Antigen Retrieval: Steam tissue section in Citrate buffer (pH 6.0). * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Calculated Mw 591 kDa Properties Form Liquid Purification Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide. Buffer Tris saline (pH 7.3), 0.02% Sodium azide and 0.5% BSA Preservative 0.02% Sodium azide Stabilizer 0.5% BSA Concentration 0.5 mg/ml Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. www.arigobio.com 1/2 Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation Database links GeneID: 57674 Human Swiss-port # Q63HN8 Human Background This gene encodes a protein containing a C3HC4-type RING finger domain, which is a specialized type of Zn-finger that binds two atoms of zinc and is thought to be involved in mediating protein-protein interactions. -
PRODUCT SPECIFICATION Product Datasheet
Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST RN213 Mass Spectrometry Protein Standard Product Number QPrEST28728 Protein Name E3 ubiquitin-protein ligase RNF213 Uniprot ID Q63HN8 Gene RNF213 Product Description Stable isotope-labeled standard for absolute protein quantification of E3 ubiquitin-protein ligase RNF213. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding VGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKNQEADVQEVKASTLSPGG fusion tag) GVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLG HDRVLVEGIVCISKKHLDKYIPYKYVIYNGESFEYEFIYKH Theoretical MW 34031 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. -
ALK-Positive Anaplastic Large Cell Lymphoma with the Variant RNF213
Published Ahead of Print on June 28, 2017, as doi:10.3324/haematol.2016.146571. Copyright 2017 Ferrata Storti Foundation. ALK-positive anaplastic large cell lymphoma with the variant RNF213-, ATIC- and TPM3-ALK fusions is characterized by copy number gain of the rearranged ALK gene by Jo-Anne van de Krogt, Marlies Vanden Bempt, Julio Finalet Ferreiro, Nicole Mentens, Kris Jacobs, Ursula Pluys, Kathleen Doms, Ellen Geerdens, Anne Uyttebroeck, Pascal Pierre, Lu- cienne Michaux, Timothy Devos, Peter Vandenberghe, Thomas Tousseyn, Jan Cools, and Iwona Wlodarska Haematologica 2017 [Epub ahead of print] Citation: van de Krogt JA, Vanden Bempt M, Finalet Ferreiro J, Mentens N, Jacobs K, Pluys U, Doms K, Geerdens E, Uyttebroeck A, Pierre P, Michaux L, Devos T, Vandenberghe P, Tousseyn T, Cools J, and Wlodarska I. ALK-positive anaplastic large cell lymphoma with the variant RNF213-, ATIC- and TPM3-ALK fusions is characterized by copy number gain of the rearranged ALK gene. Haematologica. 2017; 102:xxx doi:10.3324/haematol.2016.146571 Publisher's Disclaimer. E-publishing ahead of print is increasingly important for the rapid dissemination of science. Haematologica is, therefore, E-publishing PDF files of an early version of manuscripts that have completed a regular peer review and have been accepted for publication. E-publishing of this PDF file has been approved by the authors. After having E-published Ahead of Print, manuscripts will then undergo technical and English editing, typesetting, proof correction and be presented for the authors' final approval; the final version of the manuscript will then appear in print on a regular issue of the journal. -
Anaplastic Lymphoma Kinase-Positive Anaplastic Large Cell Lymphoma With
Non-Hodgkin Lymphoma ARTICLE Anaplastic lymphoma kinase-positive anaplastic large cell lymphoma with the variant RNF213-, Ferrata Storti EUROPEAN HEMATOLOGY Foundation ATIC- and TPM3-ALK fusions is characterized by ASSOCIATION copy number gain of the rearranged ALK gene Jo-Anne van der Krogt,1,* Marlies Vanden Bempt,1,2,* Julio Finalet Ferreiro,1 Nicole Mentens,1,2 Kris Jacobs,1,2 Ursula Pluys,1 Kathleen Doms,1 Ellen Geerdens,1,2 Anne Uyttebroeck,3 Pascal Pierre,4 Lucienne Michaux,1 Timothy Devos,5 Peter Vandenberghe,1,5 Thomas Tousseyn,6,7 Jan Cools1,2 Haematologica 2017 and Iwona Wlodarska1 Volume 102(9):1605-1616 *JAvdK and MVB contributed equally to this work 1Center for Human Genetics, KU Leuven; 2Center for Cancer Biology, VIB, Leuven; 3Department of Pediatrics, University Hospitals Leuven; 4Department of Hematology, Cliniques Sud Luxembourg, Arlon; 5Department of Hematology, University Hospitals Leuven; 6Translational Cell and Tissue Research KU Leuven and 7Department of Pathology, University Hospitals Leuven, Belgium ABSTRACT naplastic lymphoma kinase (ALK)-positive anaplastic large cell lymphoma is characterized by 2p23/ALK aberrations, including Athe classic t(2;5)(p23;q35)/NPM1-ALK rearrangement present in ~80% of cases and several variant t(2p23/ALK) occurring in the remain- ing cases. The ALK fusion partners play a key role in the constitutive acti- vation of the chimeric protein and its subcellular localization. Using var- ious molecular technologies, we have characterized ALK fusions in eight recently diagnosed anaplastic large cell lymphoma cases with cytoplas- mic-only ALK expression. The identified partner genes included EEF1G (one case), RNF213/ALO17 (one case), ATIC (four cases) and TPM3 (two Correspondence: cases). -
NEUROSURGICAL FOCUS Neurosurg Focus 51 (3):E3, 2021
NEUROSURGICAL FOCUS Neurosurg Focus 51 (3):E3, 2021 Transcriptome-wide analysis of intracranial artery in patients with moyamoya disease showing upregulation of immune response, and downregulation of oxidative phosphorylation and DNA repair *Fumiaki Kanamori, MD,1 Kinya Yokoyama, MD, PhD,1 Akinobu Ota, PhD,2 Kazuhiro Yoshikawa, PhD,3 Sivasundaram Karnan, PhD,2 Mikio Maruwaka, MD, PhD,4 Kenzo Shimizu, MD,5 Shinji Ota, MD,6 Kenji Uda, MD, PhD,1 Yoshio Araki, MD, PhD,1 Sho Okamoto, MD, PhD,7 Satoshi Maesawa, MD, PhD,1 Toshihiko Wakabayashi, MD, PhD,1 and Atsushi Natsume, MD, PhD1 1Department of Neurosurgery, Nagoya University Graduate School of Medicine, Nagoya; 2Department of Biochemistry, Aichi Medical University School of Medicine, Nagakute; 3Division of Research Creation and Biobank, Research Creation Support Center, Aichi Medical University, Nagakute; 4Department of Neurosurgery, Toyota Kosei Hospital, Toyota; 5Department of Neurosurgery, Kasugai Municipal Hospital, Kasugai; 6Department of Neurosurgery, Handa City Hospital, Handa; and 7Aichi Rehabilitation Hospital, Nishio, Japan OBJECTIVE Moyamoya disease (MMD) is a rare cerebrovascular disease characterized by progressive occlusion of the internal carotid artery and the secondary formation of collateral vessels. Patients with MMD have ischemic attacks or intracranial bleeding, but the disease pathophysiology remains unknown. In this study, the authors aimed to identify a gene expression profile specific to the intracranial artery in MMD. METHODS This was a single-center, prospectively sampled, retrospective cohort study. Microsamples of the middle cerebral artery (MCA) were collected from patients with MMD (n = 11) and from control patients (n = 9). Using microarray techniques, transcriptome-wide analysis was performed. RESULTS Comparison of MCA gene expression between patients with MMD and control patients detected 62 and 26 genes whose expression was significantly (p < 0.001 and fold change > 2) up- or downregulated, respectively, in the MCA of MMD. -
RNF213 Gene Mutation of Circulating Tumor DNA in Early Diagnosis of NSCLC Using Targeted Next- Generation Sequencing
RNF213 gene mutation of circulating tumor DNA in early diagnosis of NSCLC using targeted next- generation sequencing Ning Jiang Second Hospital of Shandong University Shukang Zhao Shandong University Cheeloo College of Medicine Peichao Li Shandong University Cheeloo College of Medicine Yu Liu PLA 960th Hospital Hubo Shi Shandong Provincial Chest Hospital Chengke Zhang Second Hospital of Shandong University Yunshan Wang Second Hospital of Shandong University Chengjun Zhou Second Hospital of Shandong University Wenhao Zhang Shandong University Cheeloo College of Medicine Chuanliang Peng Second Hospital of Shandong University Weiquan Zhang Second Hospital of Shandong University Yingtao Hao Second Hospital of Shandong University Yunpeng Zhao Second Hospital of Shandong University Qifeng Sun Shandong Provincial Hospital Xiaogang Zhao ( [email protected] ) Research article Page 1/24 Keywords: Lung cancer; Early diagnosis; Targeted next generation sequencing (NGS); RNF213 gene; Circulating tumor DNA (ctDNA) Posted Date: July 16th, 2019 DOI: https://doi.org/10.21203/rs.2.11443/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 2/24 Abstract Introduction To distinguish early stage lung cancer from benign disease of the lung nodules, especially the lesions with ground-glass opacity (GGO) or ground-glass nodule (GGN), we assessed gene mutations of the ctDNA in peripheral blood by using targeted next-generation sequencing (NGS). Methods Single lung nodule patients without mediastinal lymph nodes or symptoms hardly diagnosed by chest CT and biomarker of lung cancer were enrolled. All patients received minimally invasive surgery but refused preoperative biopsy. Gene mutations of pre-operative blood samples were detected by targeted NGS.