DOCSLIB.ORG

Death Effector Domain-Containing Proteins DEDD and FLAME-3 Form Nuclear Complexes with the TFIIIC102 Subunit of Human Transcription Factor IIIC

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Death Effector Domain-Containing Proteins DEDD and FLAME-3 Form Nuclear Complexes with the TFIIIC102 Subunit of Human Transcription Factor IIIC Cell Death and Differentiation (2002) 9, 439 ± 447 ã 2002 Nature Publishing Group All rights reserved 1350-9047/02 $25.00 www.nature.com/cdd Death effector domain-containing proteins DEDD and FLAME-3 form nuclear complexes with the TFIIIC102 subunit of human transcription factor IIIC Y Zhan1,2,3, R Hegde1,2,3, SM Srinivasula1,2,3, Abbreviations: DED, death effector domain; EST, expressed T Fernandes-Alnemri1,2 and ES Alnemri*,1,2 sequence tags; CTD, C-terminal domain 1 Center for Apoptosis Research, Kimmel Cancer Institute, Thomas Jefferson University, Philadelphia, PA 19107, USA Introduction 2 Department of Microbiology and Immunology, Kimmel Cancer Institute, Thomas Jefferson University, Philadelphia, PA 19107, USA Death effector domain (DED)-containing proteins are im- 3 These authors contributed equally to this work portant components of the cell death receptor-signaling * Corresponding author: ES Alnemri, Thomas Jefferson University, Kimmel pathway.1,2 Ligation of the death receptors, such as TNF, Cancer Institute, Bluemle Life Sciences Building, Room 904, 233 S 10th Street, Philadelphia, PA 19107, USA. Tel: 215-503-4632; Fax: 215-923-1098; CD95 and TRAIL receptors, results in the recruitment of the E-mail: [email protected] adaptor molecule FADD/Mort-1 through homotypic interac- tions of its C-terminal death domain with the cytoplasmic Received 8.2.02; accepted 8.2.02 death domain of the death receptors.1,3,4 FADD, which also Edited by G Melino contains an N-terminal DED, transduces the activation signal from the death receptors to the DED-containing precursors (procaspases) of the initiator caspases 8 and 10, by direct Abstract interaction of its DED with their corresponding DEDs.1,5 The Death effector domain-containing proteins are involved in association of FADD with procaspase-8 and procaspase-10 important cellular processes such as death-receptor induced results in their auto-processing/activation and the release of apoptosis, NF-kB activation and ERK activation. Here we the mature caspases 8 and 10 from the membrane associated death receptor signaling complex into the cytoplasm.5±7 The report the identification of a novel nuclear DED-containing mature caspase-8 and -10 could then cleave several protein, FLAME-3. FLAME-3 shares significant sequence important cellular substrates such as Bid and the effector (46.6% identical) and structural homology to another DED- caspases 3, 6 and 7 resulting in initiation of the caspase containing protein, DEDD. FLAME-3 interacts with DEDD and cascade and apoptosis.8,9 Thus, the DED regions of the c-FLIP (FLAME-1) but not with the other DED-containing adaptor molecule FADD and the initiator caspases 8 and 10 proteins FADD, caspase-8 or caspase-10. FLAME-3 translo- represent the link between the death receptors and the cates to, and sequesters c-FLIP in the nucleus upon downstream cell death machinery. overexpression in human cell lines. Using the yeast two- Although some members of the family of DED-containing hybrid system to identify DEDD-interacting proteins, the proteins, such as FADD, caspase-8 and caspase-10, are TFIIIC102 subunit of human transcription factor TFIIIC was agonists of the death receptor pathway, yet others, such as identified as a DEDD- and FLAME-3-specific interacting the viral and cellular FLIP proteins, are dominant negative inhibitors or antagonists to this pathway.10 The viral and protein. Co-expression of either DEDD or FLAME-3 with cellular FLIP proteins inhibit the death receptor pathway by hTFIIIC102 in MCF-7 cells induces the translocation from the binding to the DED regions of FADD and/or caspases 8 cytoplasm and sequestration of hTFIIIC102 in the nucleus, and 10 preventing the formation of a productive death indicating that DEDD and FLAME-3 form strong heterocom- receptor signaling complex.10 c-FLIP-deficient mice do not plexes with hTFIIIC102 and might be important regulators of survive,11 suggesting that the anti-apoptotic activity of c- the activity of the hTFIIIC transcriptional complex. Consistent FLIP plays an important role in embryonic development. with this, overexpression of DEDD or FLAME-3 in 293 cells Beside regulation of apoptosis, other important functions inhibited the expression of a luciferase-reporter gene under for DED-containing proteins have been reported. Several the control of the NF-kB promoter. Our data provide the first studies have shown that the DED protein PEA-15 is direct evidence for the involvement of DED-containing involved in the regulation of integrin activation, ERK proteins in the regulation of components of the general activation, phospholipase D expression and glucose transport.12±15 Another DED protein, DEDD, was reported transcription machinery in the nucleus. to bind to DNA, inhibit RNA polymerase I activity in vivo Cell Death and Differentiation (2002) 9, 439 ± 447. DOI: 10.1038/ and inhibit transcription in an in vitro transcription sj/cdd/4401038 assay.16,17 DED-containing proteins FADD, cFLIP, Cas- pase-8 and vFLIP can also activate NF-kB pathway through their DEDs.18±20 These findings indicate that Keywords: Apoptosis; Death effector domain; TFIIIC; DEDD; DED-proteins are involved in diverse cellular processes FLAME-1; FLIP ranging from cell survival to cell death. DEDD and FLAME-3 interact with the TFIIIC transcriptional complex YZhanet al 440 In order to identify novel cellular DED-containing and DED-interacting proteins, we searched the National Center for Biotechnology Information GenBank expressed-se- quence tags (EST) database for sequences encoding uncharacterized DED-containing proteins related to DEDD. We report here the cloning and functional characterization of a previously uncharacterized DED-containing protein designated FLAME-3, which has high homology to DEDD. Using the yeast two-hybrid system we identified hTFIIIC102 subunit of TFIIIC transcription factor as DEDD- and FLAME-3- interacting protein. Consistent with this result we found that DEDD and FLAME-3 can sequester TFIIIC102 in the nuclei of transfected cells. Our results suggest that the interaction of DEDD and FLAME-3 with this subunit may regulate transcription of class III genes. Results Cloning, sequence analysis and tissue distribution of FLAME-3 Death effector domain (DED)-containing proteins play important roles in apoptosis and cellular signaling.1,10,21 To identify new DED-containing proteins, we searched the entire public GenBankTM EST database for sequence homologus to previously known DED-containing proteins, using the tBLASTN program. One human EST clone (AA090354) encoding a partial open reading frame with significant homology to the C-terminal domain of DEDD protein was identified. Based on its sequence, PCR primers were generated and 5'-RACE was performed with a human PBL library. This resulted in cloning of the entire open reading frame of this new protein, which was subsequently named FLAME-3 based on its overall sequence and structural homology with DEDD/FLAME-2. The human FLAME-3 (Figure 1A) is 46.6% identical to DEDD and its domain structure is very similar to that of DEDD (Figure 1B). FLAME-3 has an N-terminal death effector domain (DED, residues 25 ± 102), which is very similar to the DED Figure 1 Sequence alignment and domain structure of FLAME-3. (A)Co- domains present in other DED proteins such as DEDD, linear alignment of the predicted amino acid sequences of human and mouse FADD, caspase-8, caspase-10 and c-FLIP (FLAME-1) FLAME-3 proteins. Non-identical residues in the two sequences are shaded (Figure 1C). Following the DED, FLAME-3 contains three black. (B) Bar diagrams representing the domain structure of human FLAME-3 central nuclear localization sequences (NLSs, residues and DEDD proteins. The three NLSs in FLAME-3 (residues 104 ± 109, 131 ± 104 ± 109, 131 ± 134 and 153 ± 174) and a C-terminal 134 and 153 ± 174) and two NLSs in DEDD (residues 104 ± 107 and 164 ± 181) are indicated. (C) Amino acid sequence alignment of the DED of FLAME-3 with domain (CTD, residues 175 ± 326), which has no significant DEDs found in human DEDD, FADD, caspase-8, caspase-10 and c-FLIP. homology to any known protein except DEDD. Black shading indicates identical residues The mouse FLAME-3 was also identified by searching the GenBankTM EST database and a cDNA encoding its entire open reading frame was obtained by overlapping Northern blot analysis of multiple human tissues PCR. The human and mouse FLAME-3 proteins share 91% detected two FLAME-3 mRNA species of 1.6 and 2.0 identity with each other (Figure 1A). Interestingly, most of kilobase pairs (kb) in all tissues examined (Figure 2A). the amino acid substitutions in the human and mouse These two mRNA species could result from the use of sequences are present in the linker region, which contain alternative polyadenylation sites and/or alternative splicing the NLSs between the DED and CTD. The lack of of the FLAME-3 pre-mRNA. The highest level of expression significant substitutions in the sequences of the DED and of the FLAME-3 mRNA was found in peripheral blood CTD suggests that the overall structures of these domains leukocytes, spleen and testes and lower expression levels are critical for the function of FLAME-3. were detected in all other tissues tested. The high A BLAST search of the NCBI high-throughput genome expression of FLAME-3 mRNA in peripheral blood sequences revealed that the human FLAME-3 gene is leukocytes, spleen and testes is reminiscent of that of the located on chromosome 19. DEDD mRNA,22 suggesting that the two genes are under Cell Death and Differentiation DEDD and FLAME-3 interact with the TFIIIC transcriptional complex YZhanet al 441 DEDD nor GST ± FLAME-3 fusion proteins did interact with FADD or caspase-10 (Figure 3B). However, both fusion proteins interacted with c-FLIP and weakly with caspase-8.
Load more

Recommended publications
  • DEDD (NM 001039712) Human Untagged Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for SC310813 DEDD (NM_001039712) Human Untagged Clone Product data: Product Type: Expression Plasmids Product Name: DEDD (NM_001039712) Human Untagged Clone Tag: Tag Free Symbol: DEDD Synonyms: CASP8IP1; DEDD1; DEFT; FLDED1; KE05 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin Fully Sequenced ORF: >NCBI ORF sequence for NM_001039712, the custom clone sequence may differ by one or more nucleotides ATGGCGGGCCTAAAGCGGCGGGCAAGCCAGGTGTGGCCAGAAGAGCATGGTGAGCAGGAACATGGGCTGT ACAGCCTGCACCGCATGTTTGACATCGTGGGCACTCATCTGACACACAGAGATGTGCGCGTGCTTTCTTT CCTCTTTGTTGATGTCATTGATGACCACGAGCGTGGACTCATCCGAAATGGACGTGACTTCTTATTGGCA CTGGAGCGCCAGGGCCGCTGTGATGAAAGTAACTTTCGCCAGGTGCTGCAGCTGCTGCGCATCATCACTC GCCACGACCTGCTGCCCTACGTCACCCTCAAGAGGAGACGGGCTGTGTGCCCTGATCTTGTAGACAAGTA TCTGGAGGAGACATCAATTCGCTATGTGACCCCCAGAGCCCTCAGTGATCCAGAACCAAGGCCTCCCCAG CCCTCTAAAACAGTGCCTCCCCACTATCCTGTGGTGTGTTGCCCCACTTCGGGTCCTCAGATGTGTAGCA AGCGGCCAGCCCGAGGGAGAGCCACACTTGGGAGCCAGCGAAAACGCCGGAAGTCAGTGACACCAGATCC CAAGGAGAAGCAGACATGTGACATCAGACTGCGGGTTCGGGCTGAATACTGCCAGCATGAGACTGCTCTG CAGGGCAATGTCTTCTCTAACAAGCAGGACCCACTTGAGCGCCAGTTTGAGCGCTTTAACCAGGCCAACA CCATCCTCAAGTCCCGGGACCTGGGCTCCATCATCTGTGACATCAAGTTCTCTGAGCTCACCTACCTCGA TGCATTCTGGCGTGACTACATCAATGGCTCTTTATTAGAGGCACTTAAAGGTGTCTTCATCACAGACTCC CTCAAGCAAGCTGTGGGCCATGAAGCCATCAAGCTGCTGGTAAATGTAGACGAGGAGGACTATGAGCTGG
    [Show full text]
  • Structural and Functional Diversity of Caspase Homologues in Non-Metazoan Organisms
    Protoplasma DOI 10.1007/s00709-017-1145-5 REVIEW ARTICLE Structural and functional diversity of caspase homologues in non-metazoan organisms Marina Klemenčič1,2 & Christiane Funk1 Received: 1 June 2017 /Accepted: 5 July 2017 # The Author(s) 2017. This article is an open access publication Abstract Caspases, the proteases involved in initiation and supports the role of metacaspases and orthocaspases as im- execution of metazoan programmed cell death, are only pres- portant contributors to cell homeostasis during normal physi- ent in animals, while their structural homologues can be ological conditions or cell differentiation and ageing. found in all domains of life, spanning from simple prokary- otes (orthocaspases) to yeast and plants (metacaspases). All members of this wide protease family contain the p20 do- Keywords Algae . Cyanobacteria . Cell death . Cysteine main, which harbours the catalytic dyad formed by the two protease . Metacaspase . Orthocaspase amino acid residues, histidine and cysteine. Despite the high structural similarity of the p20 domain, metacaspases and orthocaspases were found to exhibit different substrate speci- ficities than caspases. While the former cleave their substrates Introduction after basic amino acid residues, the latter accommodate sub- strates with negative charge. This observation is crucial for BOut of life’s school of war: What does not destroy me, the re-evaluation of non-metazoan caspase homologues being makes me stronger.^ wrote the German philosopher involved in processes of programmed cell death. In this re- Friedrich Nietzsche in his book Twilight of the Idols or view, we analyse the structural diversity of enzymes contain- how to philosophize with a hammer. Even though ing the p20 domain, with focus on the orthocaspases, and reformatted to more common use, this phrase has been summarise recent advances in research of orthocaspases and used to describe the dual nature of caspase homologues metacaspases of cyanobacteria, algae and higher plants.
    [Show full text]
  • Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice
    University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Nutrition Publications and Other Works Nutrition 12-19-2010 Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P. Stewart Marshall University Hyoung Y. Kim University of Tennessee - Knoxville, [email protected] Arnold M. Saxton University of Tennessee - Knoxville, [email protected] Jung H. Kim Marshall University Follow this and additional works at: https://trace.tennessee.edu/utk_nutrpubs Part of the Animal Sciences Commons, and the Nutrition Commons Recommended Citation BMC Genomics 2010, 11:713 doi:10.1186/1471-2164-11-713 This Article is brought to you for free and open access by the Nutrition at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Nutrition Publications and Other Works by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. Stewart et al. BMC Genomics 2010, 11:713 http://www.biomedcentral.com/1471-2164/11/713 RESEARCH ARTICLE Open Access Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P Stewart1, Hyoung Yon Kim2, Arnold M Saxton3, Jung Han Kim1* Abstract Background: Type 2 diabetes (T2D) is the most common form of diabetes in humans and is closely associated with dyslipidemia and obesity that magnifies the mortality and morbidity related to T2D. The genetic contribution to human T2D and related metabolic disorders is evident, and mostly follows polygenic inheritance. The TALLYHO/ JngJ (TH) mice are a polygenic model for T2D characterized by obesity, hyperinsulinemia, impaired glucose uptake and tolerance, hyperlipidemia, and hyperglycemia.
    [Show full text]
  • C-Terminal Region (ARP58987 P050) Data Sheet
    CASP3 antibody - C-terminal region (ARP58987_P050) Data Sheet Product Number ARP58987_P050 Product Name CASP3 antibody - C-terminal region (ARP58987_P050) Size 50ug Gene Symbol CASP3 Alias Symbols CPP32; CPP32B; SCA-1 Nucleotide Accession# NM_032991 Protein Size (# AA) 277 amino acids Molecular Weight 12kDa Product Format Lyophilized powder NCBI Gene Id 836 Host Rabbit Clonality Polyclonal Official Gene Full Name Caspase 3, apoptosis-related cysteine peptidase Gene Family CASP This is a rabbit polyclonal antibody against CASP3. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: NLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFG CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, Description of Target large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.
    [Show full text]
  • Comparative Study of Apoptosis-Related Gene Loci in Human, Mouse and Rat Genomes
    ISSN 1672-9145 Acta Biochimica et Biophysica Sinica 2005, 37(5): 341–348 CN 31-1940/Q Comparative Study of Apoptosis-related Gene Loci in Human, Mouse and Rat Genomes Yan-Bin YIN, Yong ZHANG, Peng YU, Jing-Chu LUO, Ying JIANG*, and Song-Gang LI* Center of Bioinformatics, National Laboratory of Genetic Engineering and Protein Engineering, College of Life Sciences, Peking University, Beijing 100871, China Downloaded from Abstract Many genes are involved in mammalian cell apoptosis pathway. These apoptosis genes often contain characteristic functional domains, and can be classified into at least 15 functional groups, according to previous reports. Using an integrated bioinformatics platform for motif or domain search from three public mammalian proteomes (International Protein Index database for human, mouse, and rat), we system- atically cataloged all of the proteins involved in mammalian apoptosis pathway. By localizing those proteins http://abbs.oxfordjournals.org/ onto the genomes, we obtained a gene locus centric apoptosis gene catalog for human, mouse and rat. Further phylogenetic analysis showed that most of the apoptosis related gene loci are conserved among these three mammals. Interestingly, about one-third of apoptosis gene loci form gene clusters on mammal chromosomes, and exist in the three species, which indicated that mammalian apoptosis gene orders are also conserved. In addition, some tandem duplicated gene loci were revealed by comparing gene loci clusters in the three species. All data produced in this work were stored in a relational database and may be viewed at http://pcas.cbi.pku.edu.cn/database/apd.php. at Institute of Zoology, CAS on November 2, 2011 Key words apoptosis; gene cluster; comparative genomics; bioinformatics Apoptosis is a regulated program by which cells destroy between mouse and human, they revealed that most themselves [1].
    [Show full text]
  • FLIP and the Death Effector Domain Family
    Oncogene (2008) 27, 6216–6227 & 2008 Macmillan Publishers Limited All rights reserved 0950-9232/08 $32.00 www.nature.com/onc REVIEW FLIP and the death effector domain family JW Yu and Y Shi Department of Molecular Biology, Lewis Thomas Laboratory, Princeton University, Princeton, NJ, USA Death effector domains (DEDs) are protein interaction and stress that impinge on the mitochondria or modules found in a number of proteins known to regulate ‘extrinsically’ from extracellular ligands that activate apoptosis from death receptors. The core DED family death receptors at the cell surface. In either scenario, members that orchestrate programmed cell death from each pathway critically relies on the action of a family of death receptors include the adaptor protein FADD, the cysteine proteases known as caspases to initiate and initiator caspases procaspases-8 and -10 and the regulatory execute the cell death process through a two-step protein c-FLIP. Through homotypic DED interactions, cascade (Riedl and Shi, 2004). In the apoptotic these proteins assemble into the death-inducingsignaling proteolytic cascade, the initiator caspases (caspases-2, complex (DISC) to regulate initiator caspase activation -8, -9 and -10) cleave and consequently activate the and launch the apoptotic proteolytic cascade. A consider- effector caspases (caspases-3, -6 and -7), and the effector able body of evidence, however, is revealingthat the same caspases in turn cleave a large array of substrates to core group of DED-containing proteins also paradoxically dismantle and package the cell into apoptotic bodies. promotes survival and proliferation in lymphocytes and Activation of initiator caspases for both the intrinsic possibly other cell types.
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]
  • Elabscience®
    Tel:240-252-7368(USA) Fax:240-252-7376(USA) www.elabscience.com ® E-mail:[email protected] Elabscience Elabscience Biotechnology Inc. DEDD Polyclonal Antibody Catalog No. E-AB-67706 Reactivity H,M,R Storage Store at -20°C. Avoid freeze / thaw cycles. Host Rabbit Applications IHC Isotype IgG Note: Centrifuge before opening to ensure complete recovery of vial contents. Images Immunogen Information Immunogen Recombinant fusion protein of human DEDD (NP_001034801.1). GeneID 9191 Swissprot O75618 Synonyms DEDD,CASP8IP1,DEDD1,DEFT,FLDED1,KE05 Immunohistochemistry of paraffin- Product Information embedded Rat lung using DEDD Buffer PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Polyclonal Antibody at dilution of Purify Affinity purification 1:100 (40x lens). Dilution IHC 1:50-1:100 Background This gene encodes a protein that contains a death effector domain (DED). DED is a protein-protein interaction domain shared by adaptors, Immunohistochemistry of paraffin- regulators and executors of the programmed cell death pathway. embedded Human esophagus using Overexpression of this gene was shown to induce weak apoptosis. Upon DEDD Polyclonal Antibody at dilution stimulation, this protein was found to translocate from cytoplasm to of 1:100 (40x lens). nucleus and colocalize with UBTF, a basal factor required for RNA polymerase I transcription, in the nucleolus. At least three transcript variants encoding the same protein have been found for this gene. Immunohistochemistry of paraffin- embedded Mouse kidney using DEDD Polyclonal Antibody at dilution of 1:100 (40x lens). For Research Use Only Focus on your research Thank you for your recent purchase. If you would like to learn more about antibodies,please visit www.elabscience.com.
    [Show full text]
  • 1471-2164-8-141.Pdf
    BMC Genomics BioMed Central Research article Open Access The evolutionary conservation of the core components necessary for the extrinsic apoptotic signaling pathway, in Medaka fish Kazuhiro Sakamaki*1, Masami Nozaki2, Katsuya Kominami1,4 and Yutaka Satou3 Address: 1Department of Animal Development and Physiology, Graduate School of Biostudies, Kyoto University, Kyoto 606-8501, Japan, 2Department of Cell Biology, Research Institute for Microbial Diseases, Osaka University, Suita 565-0871, Japan, 3Department of Zoology, Graduate School of Science, Kyoto University, Kyoto 606-8502, Japan and 4Present address: Nihon Schering Research Center, Kobe 650-0047, Japan Email: Kazuhiro Sakamaki* - [email protected]; Masami Nozaki - [email protected]; Katsuya Kominami - [email protected]; Yutaka Satou - [email protected] * Corresponding author Published: 1 June 2007 Received: 16 January 2007 Accepted: 1 June 2007 BMC Genomics 2007, 8:141 doi:10.1186/1471-2164-8-141 This article is available from: http://www.biomedcentral.com/1471-2164/8/141 © 2007 Sakamaki et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: Death receptors on the cell surface and the interacting cytosolic molecules, adaptors and initiator caspases, are essential as core components of the extrinsic apoptotic signaling pathway. While the apoptotic machinery governing the extrinsic signaling pathway is well characterized in mammals, it is not fully understood in fish.
    [Show full text]
  • The Death Domain Superfamily in Intracellular Signaling of Apoptosis and Inflammation
    ANRV306-IY25-19 ARI 11 February 2007 12:51 The Death Domain Superfamily in Intracellular Signaling of Apoptosis and Inflammation Hyun Ho Park,1 Yu-Chih Lo,1 Su-Chang Lin,1 Liwei Wang,1 Jin Kuk Yang,1,2 and Hao Wu1 1Department of Biochemistry, Weill Medical College and Graduate School of Medical Sciences of Cornell University, New York, New York 10021; email: [email protected] 2Department of Chemistry, Soongsil University, Seoul 156-743, Korea Annu. Rev. Immunol. 2007. 25:561–86 Key Words First published online as a Review in Advance on death domain (DD), death effector domain (DED), tandem DED, January 2, 2007 caspase recruitment domain (CARD), pyrin domain (PYD), crystal The Annual Review of Immunology is online at structure, NMR structure immunol.annualreviews.org This article’s doi: Abstract 10.1146/annurev.immunol.25.022106.141656 The death domain (DD) superfamily comprising the death domain Copyright c 2007 by Annual Reviews. (DD) subfamily, the death effector domain (DED) subfamily, the Annu. Rev. Immunol. 2007.25:561-586. Downloaded from arjournals.annualreviews.org by CORNELL UNIVERSITY MEDICAL COLLEGE on 03/29/07. For personal use only. All rights reserved caspase recruitment domain (CARD) subfamily, and the pyrin do- 0732-0582/07/0423-0561$20.00 main (PYD) subfamily is one of the largest domain superfamilies. By mediating homotypic interactions within each domain subfam- ily, these proteins play important roles in the assembly and activation of apoptotic and inflammatory complexes. In this chapter, we review the molecular complexes assembled by these proteins, the structural and biochemical features of these domains, and the molecular in- teractions mediated by them.
    [Show full text]
  • Identification of a Zinc Finger Protein Whose Subcellular Distribution Is Regulated by Serum and Nerve Growth Factor
    Proc. Natl. Acad. Sci. USA Vol. 96, pp. 10705–10710, September 1999 Cell Biology Identification of a zinc finger protein whose subcellular distribution is regulated by serum and nerve growth factor ALEXANDRA CHITTKA*† AND MOSES V. CHAO*‡ *Cell Biology Program, Weill Graduate School of Cornell University Medical College, New York, NY 10021, Skirball Institute of Biomolecular Medicine, New York University School of Medicine, New York, NY 10016 Edited by Michael V. L. Bennett, Albert Einstein College of Medicine, Woods Hole, MA, and approved July 13, 1999 (received for review March 24, 1999) ABSTRACT A subclass of zinc finger proteins containing a 18). Here, we describe the structural features of SC-1, its asso- unique protein motif called the positive regulatory (PR) domain ciation with p75 neurotrophin receptor, and its subcellular local- has been described. The members include the PRDI-BF1͞ ization. We find the distribution of SC-1 is strongly regulated by Blimp-1 protein, the Caenorhabditis elegans egl-43 and EVI1 gene NGF binding to the p75 receptor and by growth conditions. products, and the retinoblastoma interacting protein RIZ. Here Interestingly, the localization of SC-1 is not under control of NGF we describe a member of this family, SC-1, that exhibits several binding to the TrkA receptor or by other neurotrophins, such as distinctive features. First, SC-1 interacts with the p75 neurotro- brain-derived neurotrophic factor and neurotrophin 3. These phin receptor and is redistributed from the cytoplasm to the observations define SC-1 as a protein that is differentially con- nucleus after nerve growth factor (NGF) treatment of trans- trolled by neurotrophin and serum conditions.
    [Show full text]
  • Interaction Profile-Based Protein Classification of Death Domain Drew Lett1, Michael Hsing2 and Frederic Pio*2
    BMC Bioinformatics BioMed Central Research article Open Access Interaction profile-based protein classification of death domain Drew Lett1, Michael Hsing2 and Frederic Pio*2 Address: 1Department of Computer Science, Simon Fraser University, 8888 University Drive, Burnaby, B.C. Canada, V5A 1S6 and 2Department of Molecular Biology and Biochemistry, Simon Fraser University, 8888 University Drive, Burnaby, B.C. Canada, V5A 1S6 Email: Drew Lett - [email protected]; Michael Hsing - [email protected]; Frederic Pio* - [email protected] * Corresponding author Published: 09 June 2004 Received: 07 February 2004 Accepted: 09 June 2004 BMC Bioinformatics 2004, 5:75 doi:10.1186/1471-2105-5-75 This article is available from: http://www.biomedcentral.com/1471-2105/5/75 © 2004 Lett et al; licensee BioMed Central Ltd. This is an Open Access article: verbatim copying and redistribution of this article are permitted in all media for any purpose, provided this notice is preserved along with the article's original URL. Abstract Background: The increasing number of protein sequences and 3D structure obtained from genomic initiatives is leading many of us to focus on proteomics, and to dedicate our experimental and computational efforts on the creation and analysis of information derived from 3D structure. In particular, the high-throughput generation of protein-protein interaction data from a few organisms makes such an approach very important towards understanding the molecular recognition that make-up the entire protein-protein interaction network. Since the generation of sequences, and experimental protein-protein interactions increases faster than the 3D structure determination of protein complexes, there is tremendous interest in developing in silico methods that generate such structure for prediction and classification purposes.
    [Show full text]