DOCSLIB.ORG

(12) Patent Application Publication (10) Pub. No.: US 2013/0330349 A1 Neufeld Et Al

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
(12) Patent Application Publication (10) Pub. No.: US 2013/0330349 A1 Neufeld Et Al US 2013 0330349A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2013/0330349 A1 Neufeld et al. (43) Pub. Date: Dec. 12, 2013 (54) HIGHAFFINITY MOLECULES CAPABLE OF Publication Classification BNDING ATYPE A PLEXN RECEPTOR AND USES OF SAME (51) Int. Cl. (75) Inventors: SNEutels,1ryat-11Von as; Noa rRabinoWIcz, E. Kigel, C07K 6/28 (2006.01) Haifa (IL); Asya Varshavsky, Haifa A 6LX39/395 (2006.01) (IL); Ofra Kessler, Haifa (IL) (52) U.S. Cl. (73) Assignee: Rappaport Family Institute for CPC ....... C07K 16/2863 (2013.01); A61K.39/39558 Research in the Medical Sciences, (2013.01) Haifa (IL) USPC ... 424/139.1; 530/387.3: 530/387.9; 435/375 (21) Appl. No.: 14/000,914 (22) PCT Filed: Feb. 23, 2012 (57) ABSTRACT (86). PCT No.: PCT/IL12/SOO57 A high affinity molecule is provided. The high affinity mol S371 (c)(1), ecule comprises a binding domain which binds a type-A (2), (4) Date: Aug. 22, 2013 plexin receptor, wherein said binding domain inhibits prolif Related U.S. Application Data erative signals through said type-A plexin receptor but does (60) Provisional application No. 61/445,567, filed on Feb. not interfere with binding of a neuropilin or semaphorin 6A to 23, 2011. said type-A plexin receptor. Patent Application Publication Dec. 12, 2013 Sheet 1 of 9 US 2013/0330349 A1 à 5 e S s o n ionowolysive,0Povny ked Patent Application Publication Dec. 12, 2013 Sheet 2 of 9 US 2013/0330349 A1 ced S. S. SeO eO WOS80 peue OZ 0,90(S_ o d #007 cy ress O KeGUOld S90% Patent Application Publication Dec. 12, 2013 Sheet 3 of 9 US 2013/0330349 A1 89'91-' pel/SUOleOn.9 Patent Application Publication Dec. 12, 2013 Sheet 6 of 9 US 2013/0330349 A1 sessssssss i #001 se Ya UOSS8).dxe WNiu WeWeSOUO)19tu |3044-„3044, 19MS:80 Patent Application Publication Dec. 12, 2013 Sheet 7 of 9 US 2013/0330349 A1 & res a Co o co Co (u0)0npu%) UOlegeIO deO |CU00 WOefueyOp:0 - SeNe WNWYew8S Y s XXX. Ss s Ss S&ss s sessass Xss s s s 3. cd co go go c d to go go r cyd N was I (u010npu%) IOleIeygoid 80 as “ara”ugaya rea o Co. o. ab Cox |OBU00 WOI-85ue,000 - Sele WNWWeweS Patent Application Publication Dec. 12, 2013 Sheet 8 of 9 US 2013/0330349 A1 9A-YOVH-70- :e?esÁIIIeo ASA-YO:{ENA 9A-70VH-70- Patent Application Publication Dec. 12, 2013 Sheet 9 of 9 US 2013/0330349 A1 US 2013/0330349 A1 Dec. 12, 2013 HGHAFFINITY MOLECULES CAPABLE OF selected from the group consisting of a type A plexin receptor, BNDING ATYPE A PLEXN RECEPTOR AND a semaphorin a co-receptor of the type A plexin receptor and USES OF SAME a ligand of the co-receptor. 0012. According to some embodiments of the invention, FIELD AND BACKGROUND OF THE wherein the co-receptor is an FGFR or a VEGFR-2. INVENTION 0013. According to some embodiments of the invention, the high affinity molecule is selected from the group consist 0001. The present invention, in some embodiments ing of an antibody, a peptide, an aptamer and a small mol thereof, relates to high affinity molecules capable of binding ecule. a type A plexin receptor and uses of same. 0014. According to some embodiments of the invention, 0002 The human plexin gene family comprises at least the type-A plexin receptor comprises Plexin-A4. nine members in four subfamilies. 0015. According to some embodiments of the invention, 0003. The extracellular domains of plexins encompasses the binding of the binding domainto the type-A plexin recep about 500 amino acid semaphorin domains. The highly con tor comprises an affinity of at least 10 M. served cytoplasmic moieties of plexins (about 600 amino 0016. According to some embodiments of the invention, acids), however share no homology with any other known the antibody comprises a monoclonal antibody. protein. 0017. According to some embodiments of the invention, 0004 Plexin-B1 is a receptor for the transmembrane the antibody comprises a bispecific antibody. semaphorin Sema4D (CD 100), and plexin-C1 is a receptor 0018. According to some embodiments of the invention, for the GPI-anchored semaphorin Sema7A (Sema-K1). Type the bispecificantibody binds the type-A plexin receptor and at A plexins tranduce class-6 semaphorin signaling and also least one of an FGFR and semaphorin 6B. interact with neuropilins as co-receptors and tranduce the 0019. According to some embodiments of the invention, signal of class 3 semaphorins. the bispecific antibody binds a type-A1 plexin receptor and at 0005. The human gene related to the class 6 semaphorin least one of VEGFR-2 and semaphorin 6D. family termed semaphorin 6B or SEMA6B was cloned in 0020. According to some embodiments of the invention, 2001 by Correa wt al. (Genomics, 2001, 1:73(3):343-8. Two the bispecific antibody binds to distinct epitopes on the splice variants of this gene were identified. This protein sig type-A plexin receptor. nals by interacting with Plexin A4. The gene was found to be expressed in neural tissues. 0021. According to some embodiments of the invention, 0006 WO 2001/14420 teaches compositions and methods the high affinity binding molecule binds an epitope on an related to newly isolated plexins. Plexin specific binding extracellular domain of the Type A plexin receptor, the extra agents are disclosed and their use in the treatment of onco cellular domain being selected from the group consisting of a logical diseases is envisaged. Specifically disclosed is the sema domain (pfam number PFO1403) and an IgG domain. nucleic acid sequence and amino acid sequence of plexin A4. 0022. According to some embodiments of the invention, WO 2001/14420 also contemplates suppressing or altering the high affinity molecule induces internalization of the aberrant cell growth involving a signaling between plexin and plexin receptor. neuropilin using an agent (e.g., an antibody) which interferes 0023. According to an aspect of some embodiments of the with the binding between a plexin and a neuropilin. present invention there is provided an isolated antibody com 0007 U.S. Patent Application 20060228710 provides a prising an antigen recognition domain which binds a type A comprehensive list of molecular targets, such as Semaphorin plexin receptor, wherein the antibody induces internalization 6B, which can be used in the diagnosis and treatment of of the type A plexin receptor upon binding thereto. CaCC. 0024. According to some embodiments of the invention, 0008 U.S. Patent Application 20060127902 discloses a the type-A plexin receptor is selected from the group consist method of treating glioma using an antisemaphorin 6B anti ing of Plxn-A1, Plxn-A2, Plxn-A3 and Plxin-A4. body. 0025. According to some embodiments of the invention, the isolated antibody binds an epitope on an extracellular 0009 WO 2007000672 discloses peptidic antagonists of domain of the Type A plexin receptor, the domain being class III Sempahorins/neuropilins complexes comprising an selected from the group consisting of a sema domain (pfam amino acid sequence which is derived from the transmem number PFO1403) and an IgG domain. brane domain of plexin-A4 and uses thereof in the treatment 0026. According to an aspect of some embodiments of the of diseases associated with abnormal angiogenesis. present invention there is provided a method of reducing angiogenesis in a tissue, the method comprising contacting SUMMARY OF THE INVENTION the tissue with the high affinity molecule or composition or 0010. According to an aspect of some embodiments of the the antibody, thereby reducing angiogenesis in the tissue. present invention there is provided a high affinity molecule 0027. According to some embodiments of the invention, comprising a binding domain which binds a type-A plexin the contacting is effected ex-vivo. receptor, wherein the binding domain inhibits proliferative 0028. According to some embodiments of the invention, signals through said type-A plexin receptor but does not the tissue comprises a cancer tissue. interfere with binding of a neuropilin or semaphorin 6A to the 0029. According to an aspect of some embodiments of the type-A plexin receptor. present invention there is provided a method of treating an 0011. According to an aspect of some embodiments of the angiogenesis-related disorderina Subject in need thereof, the present invention there is provided a composition of matter method comprising administering to the Subject a therapeu comprising at least two distinct high affinity molecules the at tically effective amount of the high affinity biding molecule least two distinct high affinity molecules capable of binding or composition or the isolated antibody, thereby treating the and inhibiting signaling from a plexin signaling molecule angiogenesis-related disorder. US 2013/0330349 A1 Dec. 12, 2013 0030. According to an aspect of some embodiments of the lar network formed were assessed at various time points. present invention there is provided a method of treating can Represented photos of tube formation assay with HUVEC cer in a Subject in need thereof, the method comprising that were knocked down with shRNA for plexin-A1, plexin administering to the subject a therapeutically effective A3 or plexin-A4. FIG. 3B Spheroids (500 cells/spheroid) amount of the high affinity binding molecule or composition containing HUVEC expressing a non-targeted shRNA (sh or the isolated antibody of claim, thereby treating cancer. control) or HUVEC expressing a plexin-A4 targeting shRNA 0031. According to an aspect of some embodiments of the (sh-plexA4) were seeded on collagen and stimulated to sprout present invention there is provided a pharmaceutical compo with 5 ng/ml bFGF.
Load more

Recommended publications
  • Mutations in CHMP2B in Lower Motor Neuron Predominant Amyotrophic Lateral Sclerosis (ALS)
    This is a repository copy of Mutations in CHMP2B in lower motor neuron predominant amyotrophic lateral sclerosis (ALS). White Rose Research Online URL for this paper: http://eprints.whiterose.ac.uk/10846/ Article: Cox, L.E., Ferraiuolo, L., Goodall, E.F. et al. (13 more authors) (2010) Mutations in CHMP2B in lower motor neuron predominant amyotrophic lateral sclerosis (ALS). Plos One, 5 (3). Art no.e9872. ISSN 1932-6203 https://doi.org/10.1371/journal.pone.0009872 Reuse Unless indicated otherwise, fulltext items are protected by copyright with all rights reserved. The copyright exception in section 29 of the Copyright, Designs and Patents Act 1988 allows the making of a single copy solely for the purpose of non-commercial research or private study within the limits of fair dealing. The publisher or other rights-holder may allow further reproduction and re-use of this version - refer to the White Rose Research Online record for this item. Where records identify the publisher as the copyright holder, users can verify any specific terms of use on the publisher’s website. Takedown If you consider content in White Rose Research Online to be in breach of UK law, please notify us by emailing [email protected] including the URL of the record and the reason for the withdrawal request. [email protected] https://eprints.whiterose.ac.uk/ Mutations in CHMP2B in Lower Motor Neuron Predominant Amyotrophic Lateral Sclerosis (ALS) Laura E. Cox1, Laura Ferraiuolo1, Emily F. Goodall1, Paul R. Heath1, Adrian Higginbottom1, Heather Mortiboys1, Hannah C. Hollinger1, Judith A. Hartley1, Alice Brockington1, Christine E.
    [Show full text]
  • Plexin A4 (PLXNA4) (NM 181775) Human Tagged ORF Clone Lentiviral Particle Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC206375L2V Plexin A4 (PLXNA4) (NM_181775) Human Tagged ORF Clone Lentiviral Particle Product data: Product Type: Lentiviral Particles Product Name: Plexin A4 (PLXNA4) (NM_181775) Human Tagged ORF Clone Lentiviral Particle Symbol: PLXNA4 Synonyms: FAYV2820; PLEXA4; PLXNA4A; PLXNA4B; PRO34003 Vector: pLenti-C-mGFP (PS100071) ACCN: NM_181775 ORF Size: 1566 bp ORF Nucleotide The ORF insert of this clone is exactly the same as(RC206375). Sequence: OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_181775.2, NP_861440.1 RefSeq Size: 2020 bp RefSeq ORF: 1569 bp Locus ID: 91584 UniProt ID: Q9HCM2 Protein Families: Druggable Genome MW: 58.1 kDa This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 Plexin A4 (PLXNA4) (NM_181775) Human Tagged ORF Clone Lentiviral Particle – RC206375L2V Gene Summary: Coreceptor for SEMA3A.
    [Show full text]
  • Itraq-BASED QUANTITATIVE ANALYSIS of HIPPOCAMPAL POSTSYNAPTIC DENSITY-ASSOCIATED PROTEINS in a RAT CHRONIC MILD STRESS MODEL of DEPRESSION
    Neuroscience 298 (2015) 220–292 iTRAQ-BASED QUANTITATIVE ANALYSIS OF HIPPOCAMPAL POSTSYNAPTIC DENSITY-ASSOCIATED PROTEINS IN A RAT CHRONIC MILD STRESS MODEL OF DEPRESSION X. HAN, a,b,c W. SHAO, a,b,c Z. LIU, a,b,c S. FAN, a,b,c displayed differences in the abundance of several types of J. YU, b,c J. CHEN, b,c R. QIAO, b,c J. ZHOU b,c* AND proteins. A detailed protein functional analysis pointed to a,b,c,d P. XIE * a role for PSD-associated proteins involved in signaling a Department of Neurology, The First Affiliated Hospital, and regulatory functions. Within the PSD, the N-methyl-D-as- Chongqing Medical University, Chongqing, China partate (NMDA) receptor subunit NR2A and its downstream targets contribute to CMS susceptibility. Further analysis b Institute of Neuroscience and the Collaborative Innovation Center for Brain Science, Chongqing Medical University, Chongqing, China of disease relevance indicated that the PSD contains a com- c plex set of proteins of known relevance to mental illnesses Chongqing Key Laboratory of Neurobiology, Chongqing, China including depression. In sum, these findings provide novel d Department of Neurology, Yongchuan Hospital, Chongqing insights into the contribution of PSD-associated proteins Medical University, Chongqing, China to stress susceptibility and further advance our understand- ing of the role of hippocampal synaptic plasticity in MDD. Ó 2015 IBRO. Published by Elsevier Ltd. All rights reserved. Abstract—Major depressive disorder (MDD) is a prevalent psychiatric mood illness and a major cause of disability and suicide worldwide. However, the underlying pathophys- iology of MDD remains poorly understood due to its hetero- Key words: major depressive disorder, chronic mild stress, genic nature.
    [Show full text]
  • Plexin A4 (PLXNA4) (NM 181775) Human Recombinant Protein – TP761981 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TP761981 Plexin A4 (PLXNA4) (NM_181775) Human Recombinant Protein Product data: Product Type: Recombinant Proteins Description: Purified recombinant protein of Human plexin A4 (PLXNA4), transcript variant 2,full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug Species: Human Expression Host: E. coli Tag: N-GST and C-His Predicted MW: 86 kDa Concentration: >50 ug/mL as determined by microplate BCA method Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Buffer: 25mM Tris, pH8.0, 150 mM NaCl, 10% glycerol,1% Sarkosyl. Storage: Store at -80°C. Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. RefSeq: NP_861440 Locus ID: 91584 UniProt ID: Q9HCM2 RefSeq Size: 2020 Cytogenetics: 7q32.3 RefSeq ORF: 1566 Synonyms: FAYV2820; PLEXA4; PLXNA4A; PLXNA4B; PRO34003 Summary: Coreceptor for SEMA3A. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance in the developing nervous system. Class 3 semaphorins bind to a complex composed of a neuropilin and a plexin. The plexin modulates the affinity of the complex for specific semaphorins, and its cytoplasmic domain is required for the activation of down-stream signaling events in the cytoplasm (By similarity).[UniProtKB/Swiss-Prot Function] Protein Families: Druggable Genome This product is to be used for laboratory only.
    [Show full text]
  • © 2014 Jonathan Guo-Han Mun
    © 2014 Jonathan Guo-Han Mun HYPOGLYCEMIA-INDUCED CHANGES IN GLUCOSE METABOLISM IN THE HYPOTHALAMUS BY JONATHAN GUO-HAN MUN DISSERTATION Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in Nutritional Sciences in the Graduate College of the University of Illinois at Urbana-Champaign, 2014 Urbana, Illinois Doctoral Committee: Professor Rodney W. Johnson, Chair Professor J. Lee Beverly, Director of Research Associate Professor Justin S. Rhodes Associate Professor Manabu T. Nakamura ABSTRACT Hypoglycemia is the most common acute complication associated with insulin-dependent diabetes mellitus (Type 1 and advanced Type 2), which affects 300,000-500,000 individuals of all ages in the United States, with 30,000 new cases each year (1). It is characterized by low blood glucose concentration (less than 70 mg/dL or 4 mM) that can be attributed to a mismatch of insulin, food intake, sleep, and physical activity and can result in serious morbidity or death (2). The glucose counterregulatory response is the primary defense against hypoglycemia and involves (A) secretion of epinephrine and glucagon to elevate blood glucose concentration and (B) sympathetic activation to prompt the individual to take action against hypoglycemia through symptoms that include hunger, shaking, rapid heart rate, and sweating (2). Recurrent episodes of hypoglycemia result in failure of the counterregulatory response, which increases the frequency and severity of subsequent hypoglycemia. The underlying physiology by which this occurs is not well understood (3), but changes occurring in the ventromedial hypothalamus (VMH), a brain region that is responsible for initiating the counterregulatory response to hypoglycemia (4) is the most promising target.
    [Show full text]
  • Taqman® Human Protein Kinase Array
    TaqMan® Gene Signature Arrays TaqMan® Human Protein Kinase Array This array is part of a collection of TaqMan® Gene Signature these kinases are from receptor protein-tyrosine kinase (RPTK) Arrays that enable analysis of hundreds of TaqMan® Gene families: EGFR, InsulinR, PDGFR, VEGFR, FGFR, CCK, NGFR, Expression Assays on a micro fluidic card with minimal effort. HGFR, EPHR, AXL, TIE, RYK, DDR, RET, ROS, LTK, ROR and MUSK. The remaining 15 kinases are Ser/Thr kinases from the Protein kinases are one of the largest families of genes in kinase families: CAMKL, IRAK, Lmr, RIPK and STKR. eukaryotes. They belong to one superfamily containing a eukaryotic protein kinase catalytic domain. The ability of kinases We have also selected assays for 26 non-kinase genes in the to reversibly phosphorylate and regulate protein function Human Protein Kinase Array. These genes are involved in signal has been a subject of intense investigation. Kinases are transduction and mediate protein-protein interaction, transcrip- responsible for most of the signal transduction in eukaryotic tional regulation, neural development and cell adhesion. cells, affecting cellular processes including metabolism, References: angiogenesis, hemopoiesis, apoptosis, transcription and Manning, G., Whyte, D.B., Martinez, R., Hunter, T., and differentiation. Protein kinases are also involved in functioning Sudarsanam, S. 2002. The Protein Kinase Complement of the of the nervous and immune systems, in physiologic responses Human Genome. Science 298:1912–34. and in development. Imbalances in signal transduction due to accumulation of mutations or genetic alterations have Blume-Jensen, P. and Hunter, T. 2001. Oncogenic kinase been shown to result in malignant transformation.
    [Show full text]
  • Viewers: This Article Was Reviewed by Lan Hu, Tim Beissbarth and Dimitar Vassilev
    Polewko-Klim et al. Biology Direct (2018) 13:17 https://doi.org/10.1186/s13062-018-0222-9 RESEARCH Open Access Integration of multiple types of genetic markers for neuroblastoma may contribute to improved prediction of the overall survival Aneta Polewko-Klim1*, Wojciech Lesinski´ 1, Krzysztof Mnich2, Radosław Piliszek2 andWitoldR.Rudnicki1,2,3 Abstract Background: Modern experimental techniques deliver data sets containing profiles of tens of thousands of potential molecular and genetic markers that can be used to improve medical diagnostics. Previous studies performed with three different experimental methods for the same set of neuroblastoma patients create opportunity to examine whether augmenting gene expression profiles with information on copy number variation can lead to improved predictions of patients survival. We propose methodology based on comprehensive cross-validation protocol, that includes feature selection within cross-validation loop and classification using machine learning. We also test dependence of results on the feature selection process using four different feature selection methods. Results: The models utilising features selected based on information entropy are slightly, but significantly, better than those using features obtained with t-test. The synergy between data on genetic variation and gene expression is possible, but not confirmed. A slight, but statistically significant, increase of the predictive power of machine learning models has been observed for models built on combined data sets. It was found while using both out of bag estimate and in cross-validation performed on a single set of variables. However, the improvement was smaller and non-significant when models were built within full cross-validation procedure that included feature selection within cross-validation loop.
    [Show full text]
  • PRODUCT SPECIFICATION Prest Antigen PLXNA4 Product Datasheet
    PrEST Antigen PLXNA4 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen PLXNA4 Product Number APrEST94436 Gene Description plexin A4 Alternative Gene DKFZp434G0625PRO34003, FAYV2820, KIAA1550, PLXNA4A, PLXNA4B Names Corresponding Anti-PLXNA4 (HPA075592) Antibodies Description Recombinant protein fragment of Human PLXNA4 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVSVQVDRAKI HQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVW Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 27 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • “Vesículas Extracelulares De Origen Cerebral Aisladas Desde Suero Presentan Perfil Proteico Diferencial En Dos Modelos De Estrés En Ratas.”
    “Vesículas extracelulares de origen cerebral aisladas desde suero presentan perfil proteico diferencial en dos modelos de estrés en ratas.” Tesis entregada a la Universidad de Chile en cumplimiento de los requisitos para optar al grado de Doctor en Farmacología Facultad de Ciencias Químicas y Farmaceuticas por CRISTÓBAL RAUL GÓMEZ MOLINA Octubre, 2020 DIRECTOR DE TESIS: DRA. ÚRSULA WYNEKEN H. 1 Agradecimientos Quisiera agradecer en primer lugar a mí familia, por el apoyo constante y sostenido en todas las instancias profesionales de mi vida. A mis padres por darme los valores y principios que rigen mi vida. A mi madre, por su fuerza, apoyo incondicional, y amor infinito, que fue capaz de criar a dos hijos cumpliendo el rol de padre y madre a la vez. A mi padre, que, si bien nos acompañó por poco tiempo, logro inculcar en mí el amor por la ciencia y el conocimiento. Y a mi hermana Camila por su alegría y apoyo incondicional. A la Dra. Wyneken, por ser mí guía y tutora, y por la paciencia que tuvo durante este largo proceso. A mis compañeros y amigos del laboratorio de Neurociencias: Soledad, Bárbara, Verónica, Catalina, Ariel, Alejandro, Roberto, Juan Pablo, Carlos, etc., por su apoyo en todo lo que necesité durante este proceso. Agradezco de manera especial a Mauricio, ya que sin su motivación esta tesis no habría llegado a término. A las instituciones que han apoyado la realización de este postgrado, a CONICYT con su beca para estudios de Doctorado en Chile y su beca de apoyo a la realización de la Tesis doctoral.
    [Show full text]
  • Prdc Cdna Insert Product Line
    hPlexin A4 VersaClone cDNA Catalog Number: RDC1214 Specifications: Description This shuttle vector contains the complete ORF for the gene of interest, Gene: hPLXNA4 along with a Kozak consensus sequence for optimal translation initiation. It is inserted NotI to AscI. The gene insert is flanked with Accession: NP_065962 convenient multiple cloning sites which can be used to easily cut and transfer the gene cassette into your desired expression vector. Insert size: 5697bp Preparation and Storage Concentration: 10µg at 0.2μg/μL Formulation cDNA is provided in 10 mM Tris-Cl, pH 8.5 Shipping Ships at ambient temperature Stability 1 year from date of receipt when stored at -20°C to -80°C Storage Use a manual defrost freezer and avoid repeated hPlexin A4 cDNA freeze-thaw cycles. Plasmid PLXNA4 plexin A4 [ Homo sapiens (human) ] HpaI HindIII SspI BamHI Also known as: PLEXA4; PLXNA4A; BmtI NheI NotI PLXNA4B; FAYV2820; PRO34003 EagI BsiWI Summary: AMP EcoNI PLXNA4 is a member of the Plexin family of semaphorin signal transducers. It is found on sensory, COLE1 PshAI autonomic and motor neurons and oligodendrocytes, plus T cells and RDC1214 dendritic cells. PLXNA4 regulates cell 8431 bps Eco47III migration, activation, and axon XhoI guidance via repulsion. It serves as a PspXI SalI receptor for transmembrane XbaI BssHII NsiI semaphorins, Sema6A and 6B, and AscI hPlexin-A4 (1-1894) as a coreceptor with neuropilin 1 for the secreted semaphorin, Sema3A. NruI SphI Alternatively spliced transcripts AccIII encoding different proteins have been described.
    [Show full text]
  • PRODUCT SPECIFICATION Prest Antigen
    PrEST Antigen PLXNA4 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen PLXNA4 Product Number APrEST87605 Gene Description plexin A4 Alternative Gene DKFZp434G0625PRO34003, FAYV2820, KIAA1550, PLXNA4A, PLXNA4B Names Corresponding Anti-PLXNA4 (HPA052141) Antibodies Description Recombinant protein fragment of Human PLXNA4 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IRAKHGGKEHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFIL DNVQSLLILNKTNFTYYPNPV Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 26 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • Dissertation Submitted to the Combined Faculties for the Natural
    Dissertation submitted to the Combined Faculties for the Natural Sciences and for Mathematics of the Ruperto-Carola University of Heidelberg, Germany for the degree of Doctor of Natural Sciences presented by Diplom-Biochemiker Johannes Hermle born in: Offenbach a.M., Germany Oral-examination: July 26, 2017 siRNA SCREEN FOR IDENTIFICATION OF HUMAN KINASES INVOLVED IN ASSEMBLY AND RELEASE OF HIV-1 Referees: Prof. Dr. Hans-Georg Kräusslich Prof. Dr. Dirk Grimm ii Meiner Familie iii Summary Summary The replication of the human immunodeficiency virus type 1 (HIV-1) is as yet not fully understood. In particular the knowledge of interactions between viral and host cell proteins and the understanding of complete virus-host protein networks are still imprecise. An integral picture of the hijacked cellular machinery is essential for a better comprehension of the virus. And as a prerequisite, new tools are needed for this purpose. To create such a novel tool, a screening platform for host cell factors was established in this work. The screening assay serves as a powerful method to gain insights into virus-host-interactions. It was specifically tailored to addressing the stage of assembly and release of viral particles during the replication cycle of HIV-1. It was designed to be suitable for both RNAi and chemical compound screening. The first phase of this work comprised the setup and optimization of the assay. It was shown, that it was robust and reliable and delivered reproducible results. As a subsequent step, a siRNA library targeting 724 human kinases and accessory proteins was examined. After the evaluation of the complete siRNA library in a primary screen, all primary hits were validated in a second reconfirmation screen using different siRNAs.
    [Show full text]