DOCSLIB.ORG

Clinical Associations of Serum Interleukin-17 in Systemic Lupus

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Clinical Associations of Serum Interleukin-17 in Systemic Lupus Vincent et al. Arthritis Research & Therapy 2013, 15:R97 http://arthritis-research.com/content/15/4/R97 RESEARCHARTICLE Open Access Clinical associations of serum interleukin-17 in systemic lupus erythematosus Fabien B Vincent1*, Melissa Northcott2, Alberta Hoi2, Fabienne Mackay1 and Eric F Morand2 Abstract Introduction: Serum interleukin (IL)-17 concentrations have been reported to be increased in systemic lupus erythematosus (SLE), but associations with clinical characteristics are not well understood. We characterized clinical associations of serum IL-17 in SLE. Methods: We quantified IL-17 in serum samples from 98 SLE patients studied cross-sectionally, and in 246 samples from 75 of these patients followed longitudinally over two years. Disease activity was recorded using the SLE Disease Activity Index (SLEDAI)-2k. Serum IL-6, migration inhibitory factor (MIF), and B cell activating factor of the tumour necrosis factor family (BAFF) were also measured in these samples. Results: Serum IL-17 levels were significantly higher in SLE patients compared to healthy donors (P <0.0001). No correlation was observed between serum IL-17 and SLEDAI-2k, at baseline or during longitudinal follow-up. However, we observed that SLEDAI-2k was positively correlated with IL-17/IL-6 ratio. Serum IL-17 was significantly increased in SLE patients with central nervous system (CNS) disease (P = 0.0298). A strong correlation was observed between serum IL-17 and IL-6 (r = 0.62, P <0.0001), and this relationship was observed regardless of disease activity and persisted when integrating cytokine levels over the period observed (r = 0.66, P <0.0001). A strong correlation of serum IL-17 was also observed with serum BAFF (r = 0.64, P <0.0001), and MIF (r = 0.36, P = 0.0016). Conclusions: Serum IL-17 concentration correlates poorly with SLE disease activity but is significantly elevated in patients with CNS disease. IL-17/IL-6 ratio may be more useful than IL-17 or IL-6 alone to characterize Th17-driven disease, such as SLE. The association of other cytokines with serum IL-17 suggests that IL-17 may drive activation of diverse immune pathways in SLE. Keywords: Autoimmunity, B cell activating factor of the tumour necrosis factor (TNF) family (BAFF), interleukin-6, interleukin-17, macrophage migration inhibitory factor (MIF), systemic lupus erythematosus (SLE), T helper 17 (Th17) Introduction effector cells, [3,4] there has been much interest regard- Systemic lupus erythematosus (SLE) is a chronic idio- ing the role of the Th17 axis in the pathogenesis of pathic systemic autoimmune disorder characterized by autoimmune disease. IL-17 has been associated with the multiple organ damage, particularly the joints, skin, pathogenesis of a range of autoimmune diseases, includ- brain and kidneys [1]. This condition is characterized by ing rheumatoid arthritis (RA) [5], systemic sclerosis [6], both innate and adaptive immune dysregulation multiple sclerosis (MS) [7], and SLE [8]. IL-17 is recog- (reviewed in Vincent et al. [2]), but the relative impor- nized to have a central role in lupus-prone mouse mod- tance of cytokines operative in these systems is els [9,10] and therefore presumed to be involved in unknown. Interleukin (IL)-17 is the prototypic T helper human SLE pathogenesis (reviewed in Nalbandian et al. 17 (Th17) cell pro-inflammatory cytokine. Since the [8]). Although not observed in all studies [6], serum IL- identification of Th17 cells as a third subset of CD4+ T 17 levels have been found to be elevated in SLE patients compared to controls [11-13]. Correlations between * Correspondence: [email protected] serum IL-17 levels and SLE disease activity and anti- 1 Department of Immunology, Monash University, Central Clinical School, double stranded DNA (anti-dsDNA) antibody levels Alfred Medical Research and Education Precinct (AMREP), 89 Commercial Road, Melbourne, VIC, 3004, Australia have previously been reported in some studies [11,13]. Full list of author information is available at the end of the article © 2013 Vincent et al.; licensee BioMed Central Ltd. This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Vincent et al. Arthritis Research & Therapy 2013, 15:R97 Page 2 of 9 http://arthritis-research.com/content/15/4/R97 However, research into the potential relationships -20°C until use. Measurements of C-reactive protein between IL-17 and the clinical expression of SLE has (CRP), erythrocyte sedimentation rate (ESR), creatinine been limited, and data from longitudinally followed and anti-dsDNA antibodies (Abs) titres (normal <7; Farr cohorts is lacking. Cytokines with diverse effects on the assay, Anti-dsDNA kit, Trinity Biotech, Wicklow, Ire- immune system such as IL-6 [14-17], B cell activating land), were performed. Healthy control samples were factor of the tumour necrosis factor family (BAFF), and obtains from the Australian Red Cross Blood Service. macrophage migration inhibitory factor (MIF) have each been shown to have some interplay with IL-17 [18,19], Serum cytokine quantification and to have potential roles in the pathogenesis or clini- Sandwich enzyme-linked immunosorbent assay (ELISA) cal expression of SLE [2,20]. However, it is not clear was used to determine serum concentrations of IL-16, whether IL-17 regulates the expression of other cyto- IL-17, MIF, and BAFF. ELISA was performed using kines in patients with SLE. R&D human IL-17 DuoSet ELISA development kit In this study, we aimed to examine the associations (R&D Systems, Minneapolis, MN, USA). Ninety-six-well between serum IL-17 levels and disease expression in ELISA plates (Immunoplates, Nunc, Roskilde, Denmark) SLE in terms of disease activity and organ involvement. were coated with monoclonal mouse anti-human IL-17 We also analysed the relationship between serum IL-17 antibody. Plates were blocked with 1% bovine serum levels and serum levels of IL-6, BAFF, and MIF. The albumin in phosphate-buffered saline after overnight results indicate that although serum IL-17 levels do not incubation at 4°C. After washing, samples and standards correlate with standard measures of disease activity, it is of recombinant human IL-17 were added to the plate increased in patients with CNS disease, and is strongly and incubated overnight. Biotinylated goat anti-human associated with serum concentrations of IL-6, BAFF, IL-17 antibodies and streptavidin conjugated to horse- and MIF. Finally, our findings suggest that IL-17/IL-6 radish peroxidase were used for detection, followed by ratio may be a novel biomarker for disease activity in 3,3’,5,5’- tetramethylbenzidine (Sigma-Aldrich, Sydney, SLE. NSW, Australia) to develop colour. Plates were read at 450nm against standard curves for IL-17. The detection Material and methods limit of the assay was 16 pg/mL. Patients and clinical assessments The above ELISA protocol was similarly completed Patients aged over 18 fulfilling the 1982 American Col- using the human IL-6 DuoSet ELISA development kit lege of Rheumatology (ACR) criteria [21] for the classifi- (R&D Systems, Minneapolis, MN, USA). Similarly, MIF cation of SLE were recruited between May 2007 and concentrations were measured using mouse monoclonal June 2009 from the Lupus Clinic of Monash Medical anti-human MIF antibodies (R&D Systems, Minneapolis, Centre, Melbourne, Australia. Written informed consent MN, USA) for capture and goat biotinylated anti-human was obtained from each individual. Disease-related MIF antibodies (R&D Systems, Minneapolis, MN, USA) damage was recorded at baseline using the Systemic for detection. Recombinant human MIF was used as a Lupus International Collaborating Clinics (SLICC) SLE standard (R&D Systems, Minneapolis, MN, USA). 1% Damage Index (SDI) [22]. Other baseline variables col- bovine serum albumin in 5% sucrose-phosphate-buffered lected included patient age, gender, ethnicity and disease saline was used as a blocking agent. For BAFF, a similar duration. Disease activity was recorded at each clinic ELISA protocol was performed, using purified mouse visit using the SLE Disease Activity Index-2000 (SLE- anti-human BAFF antibodies (BD Biosciences, San Jose, DAI-2k) [23]. Patients were recorded as having renal or CA, USA) for coating the plates, and standards of central nervous system (CNS) involvement if they had recombinant human BAFF (R&D Systems, Minneapolis, evidence of involvement in ACR renal or CNS criteria, MN, USA), and biotinylated goat anti-human BAFF or on any renal or CNS domains of the SLEDAI-2k or antibodies (R&D Systems, Minneapolis, MN, USA). The SLICC-SDI at any time during the study period. Active detection limit of the assay was 1.5ng/ml. Each sample renal disease was defined as a non-zero score in any of was tested in duplicate. the renal components of the SLEDAI-2k. Patient follow- up was as scheduled by the treating physician. Patients Statistical analysis received standard-of-care therapy. The Human Research Data are expressed as median and interquartile range Ethics Committee, Southern Health, approved the study (IQR), except where otherwise indicated. As serum cyto- protocol and materials. kine concentrations were not normally distributed, non- parametric analysis was used in this study. Spearman’s Samples rank test was used to analyze correlations between vari- Paired sera and SLEDAI-2k scores were collected from ables. Mann-Whitney U tests and chi-square tests were patients at routine medical visits. Sera were stored at used to compare groups of continuous and categorical Vincent et al. Arthritis Research & Therapy 2013, 15:R97 Page 3 of 9 http://arthritis-research.com/content/15/4/R97 data respectively. A P value of <0.05 was considered sta- tistically significant. All tests were two-tailed unless otherwise stated. Statistical analyses were performed using GraphPad software (Prism Version 5.0D, 2010, San Diego, CA, USA).
Load more

Recommended publications
  • Interleukin (IL)17A, F and AF in Inflammation: a Study in Collageninduced Arthritis and Rheumatoid Arthritis
    bs_bs_banner Clinical and Experimental Immunology ORIGINAL ARTICLE doi:10.1111/cei.12376 Interleukin (IL)-17A, F and AF in inflammation: a study in collagen-induced arthritis and rheumatoid arthritis S. Sarkar,* S. Justa,* M. Brucks,* Summary J. Endres,† D. A. Fox,† X. Zhou,* Interleukin (IL)-17 plays a critical role in inflammation. Most studies to date F. Alnaimat,* B. Whitaker,‡ have elucidated the inflammatory role of IL-17A, often referred to as IL-17. J. C. Wheeler,‡ B. H. Jones§ and IL-17F is a member of the IL-17 family bearing 50% homology to IL-17A S. R. Bommireddy* and can also be present as heterodimer IL-17AF. This study elucidates the *Section of Rheumatology, Department of Medicine, and the Arizona Arthritis Center, distribution and contribution of IL-17A, F and AF in inflammatory arthritis. University of Arizona, Tucson, AZ, †Divison of Neutralizing antibody to IL-17A alone or IL-17F alone or in combination Rheumatology, Department of Internal Medicine, was utilized in the mouse collagen-induced arthritis (CIA) model to eluci- University of Michigan, Ann Arbor, MI, and date the contribution of each subtype in mediating inflammation. IL-17A, F ‡Biologics Research and §Immunology Discovery and AF were all increased during inflammatory arthritis. Neutralization of Research, Janssen Research and Development, IL-17A reduced the severity of arthritis, neutralization of IL-17A+IL-17F had Spring House, PA, USA the same effect as neutralizing IL-17A, while neutralization of IL-17F had no effect. Moreover, significantly higher levels of IL-17A and IL-17F were detected in peripheral blood mononuclear cells (PBMC) from patients with rheumatoid arthritis (RA) in comparison to patients with osteoarthritis (OA).
    [Show full text]
  • Inflammation-Dependent IL18 Signaling Restricts Hepatocellular Carcinoma Growth by Enhancing the Accumulation and Activity of Tumor-Infiltrating Lymphocytes
    Published OnlineFirst February 18, 2016; DOI: 10.1158/0008-5472.CAN-15-1548 Cancer Tumor and Stem Cell Biology Research Inflammation-Dependent IL18 Signaling Restricts Hepatocellular Carcinoma Growth by Enhancing the Accumulation and Activity of Tumor- Infiltrating Lymphocytes Geoffrey J. Markowitz1, Pengyuan Yang1,2,3, Jing Fu3, Gregory A. Michelotti4, Rui Chen1, Jianhua Sui5, Bin Yang2, Wen-Hao Qin3, Zheng Zhang6, Fu-Sheng Wang6, Anna Mae Diehl4, Qi-Jing Li7, Hongyang Wang3, and Xiao-Fan Wang1 Abstract Chronic inflammation in liver tissue is an underlying cause of IL18R1 deletion increased tumor burden. Mechanistically, we hepatocellular carcinoma. High levels of inflammatory cytokine foundthatIL18exertedinflammation-dependent tumor-sup- IL18 in the circulation of patients with hepatocellular carcinoma pressive effects largely by promoting the differentiation, activ- correlates with poor prognosis. However, conflicting results have ity, and survival of tumor-infiltrating T cells. Finally, differences been reported for IL18 in hepatocellular carcinoma development in the expression of IL18 in tumor tissue versus nontumor and progression. In this study, we used tissue specimens from tissueweremorepredictiveofpatientoutcomethanoverall hepatocellular carcinoma patients and clinically relevant mouse tissue expression. Taken together, our findings resolve a long- models of hepatocellular carcinoma to evaluate IL18 expression standing contradiction regarding a tumor-suppressive role for and function. In a mouse model of liver fibrosis that recapitulates IL18 in established hepatocellular carcinoma and provide a a tumor-promoting microenvironment, global deletion of the mechanistic explanation for the complex relationship between IL18 receptor IL18R1 enhanced tumor growth and burden. Sim- its expression pattern and hepatocellular carcinoma prognosis. ilarly, in a carcinogen-induced model of liver tumorigenesis, Cancer Res; 76(8); 1–12.
    [Show full text]
  • Interleukin-33 Signaling Exacerbates Experimental Infectious Colitis by Enhancing Gut Permeability and Inhibiting Protective Th17 Immunity
    www.nature.com/mi ARTICLE OPEN Interleukin-33 signaling exacerbates experimental infectious colitis by enhancing gut permeability and inhibiting protective Th17 immunity Vittoria Palmieri1, Jana-Fabienne Ebel1, Nhi Ngo Thi Phuong1, Robert Klopfleisch2, Vivian Pham Vu3,4, Alexandra Adamczyk1, Julia Zöller1, Christian Riedel5, Jan Buer1, Philippe Krebs3, Wiebke Hansen1, Eva Pastille1 and Astrid M. Westendorf 1 A wide range of microbial pathogens is capable of entering the gastrointestinal tract, causing infectious diarrhea and colitis. A finely tuned balance between different cytokines is necessary to eradicate the microbial threat and to avoid infection complications. The current study identified IL-33 as a critical regulator of the immune response to the enteric pathogen Citrobacter rodentium.We observed that deficiency of the IL-33 signaling pathway attenuates bacterial-induced colitis. Conversely, boosting this pathway strongly aggravates the inflammatory response and makes the mice prone to systemic infection. Mechanistically, IL-33 mediates its detrimental effect by enhancing gut permeability and by limiting the induction of protective T helper 17 cells at the site of infection, thus impairing host defense mechanisms against the enteric pathogen. Importantly, IL-33-treated infected mice supplemented with IL-17A are able to resist the otherwise strong systemic spreading of the pathogen. These findings reveal a novel IL-33/IL-17A crosstalk that controls the pathogenesis of Citrobacter rodentium-driven infectious colitis. Manipulating the dynamics of cytokines may offer new therapeutic strategies to treat specific intestinal infections. 1234567890();,: Mucosal Immunology (2021) 14:923–936; https://doi.org/10.1038/s41385-021-00386-7 INTRODUCTION epithelial cells, and endothelial cells in response to injury6.
    [Show full text]
  • IL-1Β Induces the Rapid Secretion of the Antimicrobial Protein IL-26 From
    Published June 24, 2019, doi:10.4049/jimmunol.1900318 The Journal of Immunology IL-1b Induces the Rapid Secretion of the Antimicrobial Protein IL-26 from Th17 Cells David I. Weiss,*,† Feiyang Ma,†,‡ Alexander A. Merleev,x Emanual Maverakis,x Michel Gilliet,{ Samuel J. Balin,* Bryan D. Bryson,‖ Maria Teresa Ochoa,# Matteo Pellegrini,*,‡ Barry R. Bloom,** and Robert L. Modlin*,†† Th17 cells play a critical role in the adaptive immune response against extracellular bacteria, and the possible mechanisms by which they can protect against infection are of particular interest. In this study, we describe, to our knowledge, a novel IL-1b dependent pathway for secretion of the antimicrobial peptide IL-26 from human Th17 cells that is independent of and more rapid than classical TCR activation. We find that IL-26 is secreted 3 hours after treating PBMCs with Mycobacterium leprae as compared with 48 hours for IFN-g and IL-17A. IL-1b was required for microbial ligand induction of IL-26 and was sufficient to stimulate IL-26 release from Th17 cells. Only IL-1RI+ Th17 cells responded to IL-1b, inducing an NF-kB–regulated transcriptome. Finally, supernatants from IL-1b–treated memory T cells killed Escherichia coli in an IL-26–dependent manner. These results identify a mechanism by which human IL-1RI+ “antimicrobial Th17 cells” can be rapidly activated by IL-1b as part of the innate immune response to produce IL-26 to kill extracellular bacteria. The Journal of Immunology, 2019, 203: 000–000. cells are crucial for effective host defense against a wide and neutrophils.
    [Show full text]
  • Proinflammatory T Helper Type 17 Cells Are Effective B-Cell Helpers
    Proinflammatory T helper type 17 cells are effective B-cell helpers Meike Mitsdoerffera, Youjin Leea, Anneli Jägera, Hye-Jung Kimb, Thomas Kornc, Jay K. Kollsd, Harvey Cantorb,1, Estelle Bettellie,1, and Vijay K. Kuchrooa,1 aCenter for Neurologic Diseases, Brigham and Women’s Hospital, Harvard Medical School, Boston, MA 02115; bDana-Farber Cancer Institute, Boston, MA 02115; cDepartment of Neurology, Technical University Munich, 81675 Munich, Germany; dLouisiana State University Health Sciences Center, New Orleans, LA 70112; and eBenaroya Research Institute, Seattle, WA 98101 Contributed by Harvey Cantor, July 1, 2010 (sent for review May 11, 2010) T helper type 17 (TH17) cells are highly proinflammatory effector collaboration. TH1 and TH2 cells are known to provide B-cell T cells that are characterized by the production of high amounts of help, and their signature cytokines IFN-γ and IL-4 induce class IL-17A, IL-17F, IL-21, and IL-22. Furthermore, TH17 cells have been switch recombination to IgG2a or IgG1 and IgE, respectively (9, associated with a number of autoimmune diseases. However, it is 10). Using IFN-γ and IL-4 reporter mice, Reinhardt et al. (11) not clear whether TH17 cells can also serve as effective helper cells. demonstrated that B cells form conjugates with antigen-activated, Here we show that TH17 cells can function as B-cell helpers in cytokine-producing effector T cells and that the profile of cyto- that they not only induce a strong proliferative response of B cells kine production defines isotype class switching in conjugated B in vitro but also trigger antibody production with class switch cells.
    [Show full text]
  • IL-17-Producing Cells in Tumor Immunity: Friends Or Foes?
    Immune Netw. 2020 Feb;20(1):e6 https://doi.org/10.4110/in.2020.20.e6 pISSN 1598-2629·eISSN 2092-6685 Review Article IL-17-Producing Cells in Tumor Immunity: Friends or Foes? Da-Sol Kuen 1,2, Byung-Seok Kim 1, Yeonseok Chung 1,2,* 1Laboratory of Immune Regulation, Institute of Pharmaceutical Sciences, Seoul National University, Seoul 08826, Korea 2BK21 Plus Program, Institute of Pharmaceutical Sciences, Seoul National University, Seoul 08826, Korea Received: Dec 29, 2019 Revised: Jan 25, 2020 ABSTRACT Accepted: Jan 26, 2020 IL-17 is produced by RAR-related orphan receptor gamma t (RORγt)-expressing cells *Correspondence to including Th17 cells, subsets of γδT cells and innate lymphoid cells (ILCs). The biological Yeonseok Chung significance of IL-17-producing cells is well-studied in contexts of inflammation, Laboratory of Immune Regulation and BK21 Plus Program, Institute of Pharmaceutical autoimmunity and host defense against infection. While most of available studies in tumor + Sciences, Seoul National University, 1 Gwanak- immunity mainly focused on the role of T-bet-expressing cells, including cytotoxic CD8 ro, Gwanak-gu, Seoul 08826, Korea. T cells and NK cells, and their exhaustion status, the role of IL-17-producing cells remains E-mail: [email protected] poorly understood. While IL-17-producing T-cells were shown to be anti-tumorigenic in Copyright © 2020. The Korean Association of adoptive T-cell therapy settings, mice deficient in type 17 genes suggest a protumorigenic Immunologists potential of IL-17-producing cells. This review discusses the features of IL-17-producing This is an Open Access article distributed cells, of both lymphocytic and myeloid origins, as well as their suggested pro- and/or anti- under the terms of the Creative Commons tumorigenic functions in an organ-dependent context.
    [Show full text]
  • Evolutionary Divergence and Functions of the Human Interleukin (IL) Gene Family Chad Brocker,1 David Thompson,2 Akiko Matsumoto,1 Daniel W
    UPDATE ON GENE COMPLETIONS AND ANNOTATIONS Evolutionary divergence and functions of the human interleukin (IL) gene family Chad Brocker,1 David Thompson,2 Akiko Matsumoto,1 Daniel W. Nebert3* and Vasilis Vasiliou1 1Molecular Toxicology and Environmental Health Sciences Program, Department of Pharmaceutical Sciences, University of Colorado Denver, Aurora, CO 80045, USA 2Department of Clinical Pharmacy, University of Colorado Denver, Aurora, CO 80045, USA 3Department of Environmental Health and Center for Environmental Genetics (CEG), University of Cincinnati Medical Center, Cincinnati, OH 45267–0056, USA *Correspondence to: Tel: þ1 513 821 4664; Fax: þ1 513 558 0925; E-mail: [email protected]; [email protected] Date received (in revised form): 22nd September 2010 Abstract Cytokines play a very important role in nearly all aspects of inflammation and immunity. The term ‘interleukin’ (IL) has been used to describe a group of cytokines with complex immunomodulatory functions — including cell proliferation, maturation, migration and adhesion. These cytokines also play an important role in immune cell differentiation and activation. Determining the exact function of a particular cytokine is complicated by the influence of the producing cell type, the responding cell type and the phase of the immune response. ILs can also have pro- and anti-inflammatory effects, further complicating their characterisation. These molecules are under constant pressure to evolve due to continual competition between the host’s immune system and infecting organisms; as such, ILs have undergone significant evolution. This has resulted in little amino acid conservation between orthologous proteins, which further complicates the gene family organisation. Within the literature there are a number of overlapping nomenclature and classification systems derived from biological function, receptor-binding properties and originating cell type.
    [Show full text]
  • Decrease in Mucosal IL17A, IFN and IL10 Expressions in Active Crohn's
    nutrients Article Decrease in Mucosal IL17A, IFNγ and IL10 Expressions in Active Crohn’s Disease Patients Treated with High-Dose Vitamin D Alone or Combined with Infliximab Mia Bendix 1,*, Anders Dige 1, Søren Peter Jørgensen 1, Jens Frederik Dahlerup 1 , Bo Martin Bibby 2, Bent Deleuran 3,4 and Jørgen Agnholt 1 1 Department of Hepatology and Gastroenterology, Aarhus University Hospital, 8200 Aarhus, Denmark; [email protected] (A.D.); [email protected] (S.P.J.); [email protected] (J.F.D.); [email protected] (J.A.) 2 Department of Public Health—Department of Biostatistics, Aarhus University, 8000 Aarhus, Denmark; [email protected] 3 Department of Rheumatology, Aarhus University Hospital, 8200 Aarhus, Denmark; [email protected] 4 Department of Biomedicine, Aarhus University, 8000 Aarhus, Denmark * Correspondence: [email protected] Received: 5 November 2020; Accepted: 26 November 2020; Published: 30 November 2020 Abstract: Background: Vitamin D treatment may reduce Crohn’s disease (CD) activity by modulating the mucosal immune function. We investigated if high-dose vitamin D +/ infliximab modulated − the mucosal cytokine expression in active CD. Methods: Forty CD patients were randomized into: infliximab + vitamin D; infliximab + placebo-vitamin D; placebo-infliximab + vitamin D or placebo-infliximab + placebo-vitamin D. Infliximab (5 mg/kg) and placebo-infliximab were administered at weeks 0, 2 and 6. Oral vitamin D was administered as bolus 200,000 international units (IU) per week 0 followed by 20,000 IU/day for 7 weeks or placebo. Endoscopy with biopsies was performed at weeks 0 and 7 where endoscopic activity was measured and mucosal mRNA cytokine expression was examined.
    [Show full text]
  • Il1f10 (NM 153077) Mouse Tagged ORF Clone – MR223925 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MR223925 Il1f10 (NM_153077) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Il1f10 (NM_153077) Mouse Tagged ORF Clone Tag: Myc-DDK Symbol: Il1f10 Synonyms: MGC130267; MGC130268 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MR223925 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTGCTCCCTTCCCATGGCAAGATACTACATAATCAAGGATGCACATCAAAAGGCTTTGTACACACGGA ATGGCCAGCTCCTGCTGGGAGACCCTGATTCAGACAATTATAGTCCAGAGAAGGTCTGTATCCTTCCTAA CCGAGGCCTAGACCGCTCCAAGGTCCCCATCTTCCTGGGGATGCAGGGAGGAAGTTGCTGCCTGGCGTGT GTAAAGACAAGAGAGGGACCTCTCCTGCAGCTGGAGGATGTGAACATCGAGGACCTATACAAGGGAGGTG AACAAACCACCCGTTTCACCTTTTTCCAGAGAAGCTTGGGATCTGCCTTCAGGCTTGAGGCTGCTGCCTG CCCTGGCTGGTTTCTCTGTGGCCCAGCTGAGCCCCAGCAGCCAGTGCAGCTCACCAAAGAGAGTGAACCC TCCACCCATACTGAATTCTACTTTGAGATGAGTCGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >MR223925 protein sequence Red=Cloning site Green=Tags(s) MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLAC VKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEP STHTEFYFEMSR myc-FLAG tag Restriction Sites: SgfI-MluI This product is to
    [Show full text]
  • IL1F10 Monoclonal Antibody
    Product Datasheet IL1F10 Monoclonal Antibody Catalog No: #42049 Orders: [email protected] Description Support: [email protected] Product Name IL1F10 Monoclonal Antibody Host Species Mouse Clonality Monoclonal Purification protein G purifed Applications IHC Species Reactivity Hu Specificity specific for Human IL1F10 denatured and native forms Immunogen Type protein Immunogen Description Recombinant Human IL1F10 protein Target Name IL1F10 Other Names IL-1F10, Family of interleukin 1-theta, FIL1 theta Interleukin-1 HY2, IL-1HY2, Interleukin-1 theta, IL-1 theta Interleukin-38, IL-38 Accession No. Swiss-Prot#: Q8WWZ1 Concentration 1.0mg/mL Formulation Preservative: 0.03% Proclin 300 Constituents: 50% Glycerol, 0.01M PBS, PH 7.4 Storage Store at -20°C Application Details Immunohistochemistry: 1:20 - 1:200 Images Immunohistochemical analysis of paraffin-embedded Human Colon cancer tissue using #42049 at dilution of 1:200. Address: 8400 Baltimore Ave. Suite 302 College Park MD 20740 USA http://www.sabbiotech.com 1 Immunohistochemical analysis of paraffin-embedded Human live cancer tissue using #42049 at dilution of 1:200. Immunohistochemical analysis of paraffin-embedded Human spleen tissue using #42049 at dilution of 1:200. Background Cytokine with immunomodulatory activity. Alone, does not induce cytokine production, but reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans. Reduces IL36G-induced production of IL8 by peripheral blood mononuclear cells. Increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS). Ligand for IL-36R/IL1RL2. References "IL-38 binds to the IL-36 receptor and has biological effects on immune cells similar to IL-36 receptor antagonist." van de Veerdonk F.L., Stoeckman A.K., Wu G., Boeckermann A.N., Azam T., Netea M.G., Joosten L.A., van der Meer J.W., Hao R., Kalabokis V., Dinarello C.A.
    [Show full text]
  • Title Epithelial TRAF6 Drives IL-17-Mediated Psoriatic
    Epithelial TRAF6 drives IL-17-mediated psoriatic Title inflammation( Dissertation_全文 ) Author(s) Matsumoto, Reiko Citation 京都大学 Issue Date 2019-03-25 URL https://doi.org/10.14989/doctor.k21634 Right Type Thesis or Dissertation Textversion ETD Kyoto University RESEARCH ARTICLE Epithelial TRAF6 drives IL-17–mediated psoriatic inflammation Reiko Matsumoto,1 Teruki Dainichi,1 Soken Tsuchiya,2 Takashi Nomura,1 Akihiko Kitoh,1 Matthew S. Hayden,3 Ken J. Ishii,4,5 Mayuri Tanaka,4,5 Tetsuya Honda,1 Gyohei Egawa,1 Atsushi Otsuka,1 Saeko Nakajima,1 Kenji Sakurai,1 Yuri Nakano,1 Takashi Kobayashi,6 Yukihiko Sugimoto,2 and Kenji Kabashima1,7 1Department of Dermatology, Kyoto University Graduate School of Medicine, Kyoto, Japan. 2Department of Pharmaceutical Biochemistry, Kumamoto University Faculty of Life Sciences, Kumamoto, Japan. 3Section of Dermatology, Department of Surgery, Dartmouth-Hitchcock Medical Center, Lebanon, New Hampshire, USA. 4Laboratory of Adjuvant Innovation, National Institutes of Biomedical Innovation, Health and Nutrition, Osaka, Japan. 5Laboratory of Vaccine Science, WPI Immunology Frontier Research Center, Osaka University, Osaka, Japan. 6Department of Infectious Disease Control, Faculty of Medicine, Oita University, Oita, Japan. 7Singapore Immunology Network (SIgN) and Institute of Medical Biology, Agency for Science, Technology and Research (A*STAR), Biopolis, Singapore. Epithelial cells are the first line of defense against external dangers, and contribute to induction of adaptive immunity including Th17 responses. However, it is unclear whether specific epithelial signaling pathways are essential for the development of robust IL-17–mediated immune responses. In mice, the development of psoriatic inflammation induced by imiquimod required keratinocyte TRAF6. Conditional deletion of TRAF6 in keratinocytes abrogated dendritic cell activation, IL-23 production, and IL-17 production by γδ T cells at the imiquimod-treated sites.
    [Show full text]
  • Local and Systemic Effects of IL-17 in Joint Inflammation
    www.nature.com/cmi Cellular & Molecular Immunology REVIEW ARTICLE Local and systemic effects of IL-17 in joint inflammation: a historical perspective from discovery to targeting Pierre Miossec 1 The role of IL-17 in many inflammatory and autoimmune diseases is now well established, with three currently registered anti-IL-17- targeted therapies. This story has taken place over a period of 20 years and led to the demonstration that a T cell product could regulate, and often amplify, the inflammatory response. The first results described the contribution of IL-17 to local features in arthritis. Then, understanding was extended to its systemic effects, with a focus on cardiovascular aspects. This review provides a historical perspective of these discoveries focused on arthritis, which started in 1995, followed 10 years later by the description of Th17 cells. Today, IL-17 inhibitors for three chronic inflammatory diseases have been registered. More options are now being tested in ongoing and future clinical trials. Inhibitors of IL-17 family members and Th17 cells ranging from antibodies to small molecules are under active development. The identification of patients with IL-17-driven disease is a key target for the improved selection of patients expected to have a strongly positive response. Keywords: Interleukin-17; Th17 cells; Inflammation; Arthritis, targeting Cellular & Molecular Immunology (2021) 18:860–865; https://doi.org/10.1038/s41423-021-00644-5 1234567890();,: INTRODUCTION IL-8.2,8 Analysis of its structure and functions showed that this Human IL-17, a proinflammatory cytokine identified in 1995 as a protein was a new molecule with cytokine characteristics that was product of activated T cells,1 is involved in the pathogenesis of then named IL-17.9 At the same time, the receptor for IL-17 was rheumatoid arthritis (RA)2 and many other autoimmune and identified and again shown to be a new molecule differing from inflammatory diseases.
    [Show full text]