THE TWEED Coffee Volume 3 #24 Thursday, February 24, 2011 Delights Advertising and news enquiries: Phone: (02) 6672 2280 [email protected] Get your FREE [email protected] coupons on page 11! www.tweedecho.com.au LOCAL & INDEPENDENT Council votes for koala habitat protection
Luis Feliu ‘Th e immediate protection provided by this new tree preservation order is incredibly im- A move to create extra tree preservation areas portant,’ she said, adding also that the unani- for koala habitat to protect the Tweed’s dwin- mous agreement by councillors was ‘extremely dling koala population has been described as heartening’. a major step forward in the protection of the Th e study was prepared by Biolink Ecological iconic animal. Consultants with help from the advisory group Tweed councillors unanimously agreed last and is the fi rst of two stages for a fi nal and week to adopt council’s Tweed Coast Koala comprehensive Koala Plan of Management for Habitat Study as an interim measure to protect the Tweed Coast, which councillors also agreed the area’s koala population, which some cam- to proceed with. paigners fear face extinction. As an immediate measure recommended by the study, councillors agreed to create a tree Jenny Hayes preservation order (TPO) for 1,870 hectares of founder of vital koala habitat not covered by earlier TPOs the Tweed council adopted in 1990 and 2004. group Team A council spokesman said the new protected Koala: ‘A fan- area brings the total koala habitat area covered tastic step… to 9,760 hectares and landholders need consent now we are to clear vegetation in those areas. dealing with Th e order will also cover any koala food trees statistics and (swamp mahogany, forest red-gum, tallowwood facts.’ and grey gum) that are more than three metres Photo Jeff tall within a fi ve-kilometre strip along the full Dawson length of the Tweed coastline. Th e study defi nes the Tweed Coast’s current Dr Kingston said this plan of management koala population and maps its remaining habi- would provide the vital steps to curb and reverse tat as well as key threats and identifi es suitable the koala population’s rapid decline. sites for habitat restoration. It also outlines mea- Friends of the Koala president and advisory sures needed to preserve the remaining popula- group member Lorraine Vass also welcomed The fl ip side of tions, believed to number only around 144. the TPO, saying ‘we’re pleased the penny has Council’s biodiversity program leader, Dr fi nally dropped and the dire situation of the Mark Kingston, said with that number already coast’s remaining koalas is at last understood urban sprawl below the minimum viable population size of and accepted by Council’. 170 individuals, the koala’s current status would ‘Local extinction is a real possibility. When justify its nomination as an ‘endangered’ popu- the consultant proposes the current status Luis Feliu Back-fl ipping from front to back, Kaneya lation. would likely meet the criteria for listing as an Poudal, Osmar New and Mark Long; Jack Care Team Koala campaign founder Jenny Hayes endangered population, there can be no doubt,’ Acrobatics coach Hamilton Barnett believes handstanding and Hamilton Barnett sitting. praised the study as a ‘fantastic step towards Mrs Vass said. many teenagers have what it takes to be skilled Photo Jeff ‘Ouch’ Dawson protecting the endangered population’. Th e study is available at the shire’s three pub- urban high fl yers: it’s something they do on a ‘Now we are dealing with statistics and facts. lic libraries in Murwillumbah, Tweed Heads daily basis. old Uki local said. We were speculating that koala numbers were and Kingscliff as well as online on council’s ‘Th ey’re all naturally trying out this stuff Hamilton has been running Xtreme Teen diminishing at a rapid rate and now we have website (www.tweed.nsw.gov.au) by clicking among themselves so providing a safe forum Acrobatic Forum for aound 20 youngsters at facts,’ said Ms Hayes, a member of the Tweed on ‘Your Environment’ on the top of the page, for this physical theatre or street performance the Hoopla Circus space in Murwillumbah for Coast Koala Advisory Group which is made up then ‘Fauna and Flora Management’ then ‘Koala off ers them something diff erent,’ the 41-year- continued on page 2 of council and community members. Management’.
Specialises in eczema, psoriasis, sensitive skin, wrinkles, burns, scarring and sun-damaged skin. s /RGANIC 2OSEHIP &ACELIFT 0ACK s /RGANIC !ROMATHERAPY s /RGANIC 2OSEHIP "ODY #ARE 0ERFUMES AND %SSENTIAL /IL AND 3UN 0RODUCTS "LENDS s /RGANIC ,IPSTICK AND -AKEUP s /RGANIC 2OSEHIP .UTRITIONAL 10% OFF s "EAUTY AND (EALTH %QUIPMENT 3UPPLEMENTS STOREWIDE! Unit 2/23 Enterprise Ave, Tweed Heads t1300 552 386 tFx: 07 5523 9155 [email protected] t www.rosehipskincare.com
Lightforce Computers Has MacBook Pro 13” & 15” Central park planned for Kingscliff Bundles ON SALE! Murray Simpson Remember...We BEAT Apple’s Everyday The Tweed Shire Council is Website & Apple Store Product PRICES* ‘shovel-ready’ to get cracking on the long-matured Kingscliff Now! Foreshore masterplan – all it MC371X/A is waiting for now is the green $2050. MBPro 15” LED light from the state govern- when Intel Core i5 2.4 ghz ment to start its sand replen- Purchased 320gb hd / 4gb RAM ishment program. w/Applecare 256mb Video RAM ‘We’re ready to go and shovel Includes iLife 11 ready, it’s now down to the state government,’ declared mayor Special Bundle Price: Includes Applecare ($449 rrp) Kevin Skinner last week. iWork Productivity Suite ($129 rrp) STM Sleeve ($49 rrp) The masterplan has been A total $2736rrp value for Only $25! percolating away since 2000 or MacBookPro Applecare: Only $449 -$408 when the council engaged con- sultants to develop the coast- Now! MC374X/A line hazard defi nition study. $ MBPro 13” LED Central to the masterplan is 1430. Intel C2D 2.4 ghz a sand nourishment program when 250gb hd / 4gb RAM to make the Kingscliff Central Purchased Sand nourishment at the depleted Kingscliff beach foreshore is a big part of the foreshore w/Applecare Includes iLife 11 Park a reality. Engineers plan pumping masterplan to ameliorate damage such as this. Our Most sand from the Tweed River plan is the Kingscliff Central the Cudgen Headland SLSC. SLSC. About 500 metres of Popular Laptop south of the Boyds Bay Bridge. Park on the site of the King- Th e boardwalk will be acces- vegetated dune up to 60 metres Special Bundle Price: Includes Applecare ($268 rrp) This requires a state gov- scliff Beach holiday Park. sible by wheelchair and bicycle, wide had been lost. Th is was iWork Productivity Suite ($129 rrp) STM Sleeve ($49 rrp) ernment extractive licence on Th e council agreed last week and will provide access to the due to the loss of off shore sand, A total $1966rrp value for Only $189! which royalties would normal- to place the concept plan on beach. rather than storm activity. ly be paid to the Crown. or MacBookPro Applecare: Only $329 -$289 public exhibition because of Kingscliff was chosen in Late last year the council & Upgrade to 8gb RAM for $560 Only $399! the wide public interest. 2006 as the first area for a Sand lost from dunes sought a waiver of the royalties foreshore masterplan due to ‘Th is meant the beach tried and also sought help in footing Lightforce Computers Sand nourishment the soaring level of property to level itself out by pulling the $6 million bill for the sand Authorised Reseller Features of the plan include development. sand from the dunal system,’ nourishment program. Authorised Service Provider an underground pile wall in Th e masterplan provides a the report said. So far there’s been no re- front of the Cudgen Headland staged program of works to be ‘Th e foreshore erosion will Authorised iPad Reseller sponse from the government. SLSC, which has already been carried out as funds become continue until there is enough Cr Joan van Lieshout 1/10 Brigantine St. in the Arts & Industry Estate built, and a massive sand nour- available. sand moving into the off shore quipped that they get their Byron Bay 6685 8796 • See Website for easy Directions ishment program to off set the A council report said there defi cit area.’ sand from Kirra. hrs: m-th 9-6 • fri 9-5 • sat 9-1 www.lightforce.com.au eff ects of erosion. had been significant erosion Th e area near the Cudgen * Centrepiece of the master- Apple Beating prices are for cash/EFT - excludes CC Service Fees, Apple sales, refurbs, etc. A boardwalk will run the since 2009 of the southern Creek appeared to have stabi- length of the beach protection section of the beach from the lised but the beach profi le was area from north of the King- north training wall of Cudgen steeper further north and ero- scliff Beach club to south of Creek to the Cudgen Headland sion was continuing. Cane land bid for trail bike track Murray Simpson past 10 years. Cr Longland said he was Cr Warren Polglase said it concerned about the proxim- A long battle by dirt trail-bike was high time something was ity of the track to the cem- riders to find a permanent done for bike riders. etery and wondered if the home in the Tweed has tak- ‘Th ey’ve been hunted from noise would impose on local en a step closer to resolution place to place for 10 years,’ he families. END OF SUMMER SPECIAL with the Tweed Shire Council said. A move three-and-a-half opening negotiations with the ‘We should be prepared to years ago for a dirt trail bike FEBRUARY ONLY Canegrowers Association over provide a facility where boys track on nearby bushland, a site off Eviron Road near and girls can enjoy their sport which was also close the Condong. which is well monitored by the Tweed Valley Lawn Ceme- 12 MONTH FULL GYM MEMBERSHIP The site is owned by the motor bike association.’ tery, was quashed by the then council’s waste fund and is The council voted 4-3 to council administrators after $ * currently the scene of a quarry press ahead with the nego- receiving complaints from 750 (Normally $945) operation. tiations with the canegrowers neighbours. Part of the site has been despite objections from Crs They claimed the noise used in a cane growing share Barry Longland, Joan van would disturb mourners and farmer arrangement for the Lieshout and Katie Milne. cemetery visitors. BE QUICK Th e fl ip side of urban sprawl (from page 1) REC CLUB "ÞÊÓäÊ iLiÀà «ÃÊ the past six months. it makes for an adrenalin- stration crew wowed the large Membership includes: >Û>>Lit ‘This offers teenage boys pumping set of skills. Fitness, crowd with their highpowered Fitness Assessment & Tailored Program something outside of team strength, focus, determination mini tramp act. Access to over 35 Group Fitness Classes per week sport, and being a male coach and a good dose of guts come Hamilton, who trained in Spin / BodyPump® / Zumba / Aqua Zumba / Yoga I felt there was a void there for together for acrobatic moves acrobatics at Circus Oz learn- Pilates / Boxing Fitness / Circuit Training that age group. that see teenagers literally fl y- ing his skills from a Chinese Indoor & Outdoor Heated Pool / Fully Equipped Gymnasium ‘They learn to tumble, flip ing through the air. acrobat, says he wanted to Adult Swim Squads / Tennis Courts and fly. The training teaches ‘Xtreme Teen is a safe nurture the natural interest the skills of Parkour, the urban place to learn and develop teenage boys have in ‘busting SIMPLY CUT OUT & PRESENT THIS AD sport of overcoming obstacles the tricks teenagers discover extreme moves’ while teaching with maximum speed and ef- through YouTube. Th e sessions them how to do it safely. TO RECEIVE THIS GREAT PRICE ficiency. What that means is build self-esteem and are non- He said the program has also leaping, vaulting and climbing competitive, encouraging boys been opened up to nearly teens *Based on individual membership paid upfront. objects with acrobatic ease and of all skill levels to achieve their for boys ages 10-12 years. To Offer ends 28th February 2011 or on sign-up of 20 new Members. grace. best while having fun.’ check it out visit www.youtube. äÓÊÈÈÇ{ÊÈÈÊUÊÜÜÜ°V>ÃÕ>À>ÀiVVÕL°V°>Õ ‘Combine this with train- At last year’s Ukitopia Festi- com/xtremeteen1 or call Ham- ing in mini tramp aerials and val, the Xtreme Teen demon- ilton on 0439 021 233. 2 February 24, 2011 Th e Tweed Shire Echo
Major facelift for Fingal riverside FREE TRAINING Th e old Fingal Head boathar- bour, one of the many popular riverside parks along the Tweed Avail Now River, has had a big spruce up thanks to a $450,000 upgrade Upskill Your Apprentice Today! Free training available for 1st and 2nd year Apprentices which was offi cially opened last Friday. ☑ Your choice of Accredited Training Course The popular family picnic ☑ Apprentice wages fully paid whilst training area now has new play equip- ☑ Transport allowance provided ment, an all-access toilet block, ☑ Meal allowance provided barbecues and shaded seating *Offer Limited. Conditions apply and a sealed carpark. This program is jointly funded by the NSW Government and the Australian An arching concrete path- Government and administered by the NSW Department of Education & Training way built along the natural For further information contact your local line of the old harbour toward ON-Q Human Resources offi ce the river allows for ‘stunning Free call 1800 761 561 panoramic views’ according to [email protected] | www.onqhr.com.au council landscape architect Ian A premium provider of specialised employment solutions Bentley to the local community for over 22 years. The work, jointly funded by Tweed Shire Council and a $150,000 federal government Advice from grant under its regional infra- Fingal Public School students Tatiania Brown, Rosie Lomas, Isabelle Cora and Zeke Wilkin- structure program, was de- son with Aunty Kath Lena at the upgrade opening on Friday. Photo Jeff ‘Downgrade’ Dawson clared open by Tweed mayor the Chief Kevin Skinner and the Rich- Th e mayor also praised the tures a swing, sand digger jects at Kingscliff ’s Jack Bayliss mond MP, Justine Elliot. eff orts of students from Fin- and climbing structure with Park and Pottsville’s Ambrose Product Tester Cr Skinner said the old in- gal Head Public School who natural features includ- Brown Park. frastructure at the park had helped brighten up the park by ing large climbable rocks, a Justine Elliot, who lives in Dear Product Tester, passed its use-by date and the painting the bollards around timber bridge with musical the coastal village, said her I’ve been reading your facelift would make the popu- the play equipment which in- chimes, stepping pads and children, aged 12 and 10, regu- advice and you seem like lar and attractive family desti- cludes a mosaic they designed grass mounds. larly played in the old park and an up front sort of a bloke, nation with its safe swimming at the entrance. Th e harbour refurbishment were ‘absolutely amazed’ by its I have an embarrassing problem. I can’t keep my even more popular. The new playground fea- follows similar council pro- transformation. tinnies cold! I’m desperate mate, Coastal development to be restricted Johno Murray Simpson of thousands of dollars off the with the 2050 and 2100 hazard In the 2050 hazard zone all Dear Johno, value of the shire’s most valu- lines on the landward. development will be subject There’s lots of scenarios a man can put up with, like Tough new restrictions on able beachfront properties. All building will be banned to a coastal risk management building on the Tweed’s dress He said the matter should within the immediate hazard report. No building will be al- the time we ran out of food at the back of Bourke, circle coastal strip have been be deferred till the DCPs had zone. Existing buildings will not lowed within 20 metres of the but stone the crows mate you can’t drink warm beer. fl agged to cope with the threat been draft ed so property own- be allowed to carry out major current erosion escarpment and Lucky you wrote to me. I have just what you need. of rising sea levels. ers knew what they could do in renovations. Only minor works must be at least six metres back You need to stop what you’re doing and immediately Planning staff have tabled a their own back yards. are permitted and these must from the 2050 hazard line. come in and see us at Outdoorism. We have these raft of new regulations aff ect- Th e hazard zone DCPs went be capable of swift removal or Owners must be prepared to ‘you beaut’ fridge freezers in stock, and Blimey ing any development in coastal on public exhibition last week demolition if the seas threaten. demolish or relocate buildings you can even make your own ice if you run short, hazard zones. for a period of 60 days aft er the The planned retreat of any should the erosion escarpment while you’re in the Outback. They’re even Australian The hazard zones identi- council unanimously endorsed existing buildings is recom- encroach. made, trust an Aussie to know how to keep your beer fi ed by the University of New the concept layout for public mended. In the 2100 hazard zone all cool. South Wales’s Water Research exhibition. No development will be al- developments will also be sub- Life’s too short to drink warm beer. Laboratory (WRL) cut a swathe The DCP recognises three lowed if it results in people ject to a coastal risk manage- through million-dollar proper- distinct zones – the immedi- permanently living or work- ment report. No subdivisions Your mate, ties at Fingal, Casuarina, King- ate hazard zone, the year 2050 ing within the zone unless that will be permitted if they en- Tony scliff and Cabarita. hazard zone and the year 2100 work is undertaken on a short- croach on the 2100 hazard line. Th e council last September hazard zone. term or intermittent basis. Planners urge a cautious ap- For genuine advice on a great range of adventure deferred recognising the haz- WRL scientists estimated sea All developments would be proach to all development in gear for campers, hikers and travellers see ard zones until the planners had levels will rise four centimetres subject to a coastal risk man- this zone stressing consider- formulated a development con- over the next 40 years and by agement report. Open car parks ation be given to minimising trol plan for fear of its eff ects on nine centimetres by 2100. and car ports would be counte- environmental degradation. local property values. Th ree hazard lines have been nanced but not enclosed garag- Last year council natural re- Former mayor Warren Pol- drawn down the length of the es. Th e DCP makes allowances sources manager David Oxen- glase warned their adoption Tweed Coast – the immediate for surf clubs, marine rescue ham urged the council to adopt 7HARF 3TREET -URWILLUMBAH s had the potential of wiping tens hazard line on the seaward side bases and picnic tables. the zone without delay. WE DELIVER TO YOUR DOOR NEW WE CAN SERVICE YOUR WHEELCHAIRS & USED SCOOTER WALKERS SCOOTERS OXYGEN CONCENTRATORS GREAT UÊ AFFORDABLE RANGE OF UÊ PORTABLE BATHROOM UÊ NO TANKS! AIDS UÊ RUNS OFF MAINS FROM FROM FROM BATTERIES OR CAR $89 $139 $299 CIGARETTE LIGHTER
UÊÀiÊUÊ,i«>ÀÃÊUÊ7 iiV >ÀÃÊUÊ7>}Ê`ÃÊUÊ >Ì ÀÊ`ÃÊUÊÊiÊ-iÀÛViÊUÊ ÌiViÊ >ÀiÊUÊ i`V>Ê i}Üi>ÀÊ UÊ >ÞÊ Û}Ê`à Call Carole, Ivy, Andrew or Wendi for friendly, experienced help from locals 1/29 BOYD ST TWEED HEADS UÊäÇÊxxÎÈÊnn{£ÊUÊÜÜÜ°Ü>Ü iiðV°>Õ www.tweedecho.com.au
COVERING TWEED, GOLD COAST & NORTHERN RIVERS Allira embraces her second chance UÊÊ-ÌVÃÌÃÊvÊiÜÊ>`Ê ÕÃi`ʵÕ>ÌÞÊÃVÌiÀÃÊ Kate McIntosh vÀÊ-"*, ,]Ê GET ,/-]Ê 6 , Ê MOBILE IN >`Ê*, STYLE! Allira Smiley is like many typi- UÊ7 iiV >ÀÃÉÜ>iÀà cal teenagers – she is looking UÊ vÌÊV >Àà forward to studying at univer- UÊ >ÞÊÛ}Ê>`à sity and is keen to go back- UÊ*ÜiÀÊV >Àà packing in Europe. UÊÊÕ}iÊÀ>}iÊë>ÀiÊ But the soft -spoken 16-year- «>ÀÌÃÊ>`Ê>VViÃÃÀià Visit our showroom UÊÀiiÊ iÊ`ià to view our great old Bilinga resident who un- UÊÊÌiÀiÃÌÊvÀiiÊwÊ>ViÊ range of scooters derwent a liver transplant last V`ÌÃÊ>««Þ® and mobility aids year has had to overcome more UÊÊ Ý«iÀÌÊÃiÀÛV}ÊqÊ>Ê HIRE EQUIPMENT than most to get where she is >iÃÊ>`Ê`ià NOW AVAILABLE today. Last year Allira was admitted SCOOTERS to hospital aft er complaining of headaches and feeling gener- & Mobility ally unwell. YOUR TRIED & TRUSTED LOCAL MOBILITY Her condition rapidly deteri- SPECIALISTS FOR OVER 10 YEARS orated and she was transferred "«iÊ `>ÞÊÌÊÀ`>ÞÊn°Îä>ÊqÊ{°Îä«Ê >`Ê->ÌÕÀ`>ÞÊn°Îä>ÊqÊ£ÓÊ from Tweed Hospital to Bris- 3/25 Industry Drive, bane’s Princess Alexandra Hos- Tweed Heads South pital where she was diagnosed with Wilson’s Disease – a her- 07 5524 4398 ed itary disorder that causes the Allira Smiley underwent a liver transplant when she was just 15 years old. Photo Kate McIntosh 1800 726 000 body to retain too much cop- www.scootersandmobility.com.au per, causing liver failure. getting out, many organ dona- ‘Universally, it is a positive very lucky that I’m alive,’ she At the time, her condition tions do not go ahead as family thing to come out of a very aw- said. was so critical that she would members are not aware of their ful time in their life,’ he said. In 2010, 309 Australians do- have died within 24 hours if loved one’s wishes. Allira spent three months in nated organs, benefi ting some a suitable donor had not been ‘We know that 90 per cent Brisbane during her difficult 931 transplant recipients. found. of people in the community recovery process. 5 Star ‘I don’t remember a lot about support organ donation, but Despite also missing six Low donor rate Celebrity Century it,’ she said. when it comes to giving con- months of school, the grade On the world scale, Australia ‘I was really scared. I just sent only about 50 per cent will 12 student at Palm Beach Cur- rates low for organ and tissue wanted to go home.’ go ahead,’ he said. rumbin High School is deter- donation. In 2010, the Austra- Allira spoke about her ex- mined to catch up and is hop- lian population had 13.8 donors perience this week as part of Talk with next of kin ing to study forensic science. per million compared with an Organ Donation Week, which He encourages people to talk As a result of her condition average of 20 to 35 donors per aims to promote awareness about their wishes in relation she will remain on medication million in Europe and the US. Visiting 4 Stunning French Polynesia Islands around organ and tissue do- to organ donation with their for the rest of her life and is For further information on nation. next of kin. not allowed to drink alcohol or organ donation, please visit PACIFIC ISLAND PARADISE Area director of organ dona- Despite the oft en tragic cir- play contact sports. www.donatelife.gov.au or to
3 Nights Hotel in Honolulu tion for the North Coast, Dr cumstances of organ donation, But Allira knows that she is record your decision to donate Lahaina (Maui) – Papeete (Tahiti) Michael Lindley-Jones, says for Dr Lindley-Jones says many one of the lucky ones because go to www.donorregister.gov. Moorea – Raiatea – Bora Bora - Sydney every organ donor, ten people families took comfort from the doctors found a liver in time to au or call 1800 777 203 or pick
21 Nights – Departs 8th November 2011 will benefi t. positives that came out of the save her life. up a brochure at any Medicare He says while the message is decision. ‘It’s defi nitely made me feel offi ce. FLY, CRUISE & STAY from $3,799pp Oceanview from $4,189pp Balcony from $4,739pp Student block planned Wide range of studies and Prices are per person, twin share and include one way air Brisbane to Honolulu, 3 nights accom in Honolulu, 18 night cruise, port charges and taxes. students at SCU orientation Conditions apply, subject to change. but uni to move out Luis Feliu Cross University as aff ordable accommodation. A multi-storey residential Three objections were Beachcomber Arcade, 122 Griffith St, Coolangatta block aimed at Tweed Heads’ lodged with the main issue university student market has being shortage of parking in been given the green light by Boyd Street. But council plan- !FF;E
Australians have recently witnessed some of the most destructive and devastating forces of nature. As a result, the rebuilding of flood-affected regions across Australia is going to be an immense national challenge. The Gillard Government will rebuild those affected communities and regions.
Rebuilding The cost to fix essential infrastructure such as roads, bridges, ports and railway lines is going to run into the billions of dollars. That’s why a flood levy is needed – to support the massive rebuilding effort and get flood ravaged communities back on their feet.
In hard times, Australians pull together
Authorised by Justine Elliot MP, 107 Minjungbal Drive, Tweed Heads South NSW 2486 This material has been produced by Justine Elliot MP using her printing and communications entitlement Local News Rally protesters to appeal convictions Story and photo Luis Feliu Mr Dakin said the couple’s Criminal Law, Traffi c Law & Court Work ‘passion for a cause’ was not a Family Law, Property, Two prominent opponents of mitigating factor and he did not Conveyancing, Wills and Probate the controversial world rally run accept they were acting on be- in the Tweed-Kyogle shires in half of the majority as the rally Mullumbimby Offi ce Tweed Offi ce 2009 say they will appeal their was an issue for elected repre- p 02 6684 6111 p 07 5536 6111 f 02 6684 6122 f 07 5536 6112 conviction on graffi ti off ences sentatives. Suite 6, 97 Stuart St, 10/69 Wharf St, aft er a magistrate in Byron Bay He said the pair was entitled Mullumbimby NSW 2482 Tweed Heads NSW 2485 Court found a malicious dam- to protest but that having ‘mis- Cameron Bell, Principal age charge against them proved guided views’ they were repre- With Integrity & Light Kate Brady LLB (Hons) and fi ned them $400 each. senting the majority was bound Scott Sledge and Danielle to ‘clash with the criminal jus- Voinot, of Lillian Rock, were tice system’. found guilty last Friday of hav- Mr Dakin said he took into ing painted anti-rally slogans account the previous good on a road barrier on Kyogle character of the couple and Dr Rod Whitehead Road on the night of Septem- No Rally Group members Scott Sledge and Danielle Voinot their age and the ‘passion’ with ^Đ,ŽŶ;ĂŶĂĚĂͿ͕^Đ;Y>Ϳ ber 2, 2009, before the three- outside Byron Bay courthouse last Friday after they were fi ned which they pursued their views ͻNaturopathically Approved Removal of Amalgam day event was to be run through $400 on a malicious damage charge in relation to anti-rally and that it was an isolated in- ͻŽƐŵĞƟĐ^ŽůƵƟŽŶƐLJŽƵĐĂŶƚƌƵƐƚ the Tweed Valley. slogans painted on Kyogle Road in September 2009. They will cident. ͻDŽĚĞƌŶ͕ƌĞůĂdžĞĚ͕ďŝŽĐŽŵƉĂƟďůĞĚĞŶƟƐƚƌLJ Outside the court, the cou- appeal against the convictions. Mr Sledge said outside the ͻ͚KŶƚŚĞƐƉŽƚ͛ďƵůŬďŝůůŝŶŐĨŽƌEPCƉĂƟĞŶƚƐ ple said they were disappointed court that he did not condone ͻ͚KŶƚŚĞĚĂLJ͛ĞŵĞƌŐĞŶĐLJĂƉƉŽŝŶƚŵĞŶƚƐ and considering an appeal. Yes- fi ti painted that night along a and a local resident returning graffi ti ‘but I understand that terday they said the No Rally 30-kilometre stretch of the road. home saw their car. Th e resident some residents along the rally Dr Brian TraceyǁŽƌŬŝŶŐ&ƌŝĚĂLJƐ Group, of which Mr Sledge was Mr Dakin accepted defence had noticed a ‘No Rally’ sticker routes who had strong feelings ϳͬϭϰDŝĚĚůĞƚŽŶ^ƚƌĞĞƚ͕LJƌŽŶĂLJͻ02 6680 7774 a former president, had unani- lawyer John Weller’s submission on the vehicle and called police about the way the event was mously voted to back their ap- that the prosecution case relied suspecting they had painted the forced on them’. peal and raise funds for any on circumstantial evidence in graffi ti. ALL NATURAL further legal battle. that no forensic evidence linked In his summing up, Mr Dak- Protest ‘blackboard’ a paint roller, headlamp, paint in said the evidence was cir- Some of those opposed to StopStop SmokingSmoking Lengthy case tins and a set of gloves items cumstantial but found it ‘hard the rally, he said, had ‘used the In summing up the lengthy found at the scene to the ac- to accept’ why the couple had roadway as a blackboard to ex- in 24 Hours with muzzSTOP Tell a Friend case, magistrate Michael Dakin cused, but said evidence from returned to the scene some time press their disapproval because Genuiine 98% SSuccess RRate said he was satisfi ed the pair, police who interviewed the aft er being confronted by the an out-of-touch state govern- Our very high success rate is due to the fact ALL US C L aged in their early sixties, car- couple the day aft er the road- resident near the bridgeworks ment simply was not listening’. that muzzSTOP removes all the NICOTINE SPECIA & other addictive TOXINS that cause you FOR ried out the graffi ti at a site near way was painted and a witness who they had found ‘menac- Mr Sledge said the No Rally OFFER! to crave another cigarette . . . bridgeworks where their car who saw the couple’s car at the ing’ and intimidating when he Group saw the ‘conviction on Don’’t Waiit CALL 1300muzzSTOP NNoo CCravingsravings had been seen on the night by scene of some of the road paint- initially approached them in his the basis of political activism as NNoo SStresstress a nearby local, but that the evi- setting a dangerous precedent’. NNoo WWeighteight GGainain 11330000 668899 997788 ing was ‘overwhelming’. four-wheel-drive vehicle on the dence did not prove they were Police had told the court that night. ‘Th ere was no hard evidence, wwwwww..mmuuzzzzSSTTOOPP..ccoomm responsible for all the graf- at the couple’s house the fol- just circumstantial… the com- lowing day, they found items ‘Graffi ti war’ munity expects a higher stand- similar to those picked up by Mr Dakin said there was ‘no ard of proof,’ he said. t Accredited high quality care in a the local resident at the scene doubt’ it was to retrieve a paint He said police had taken no Northern Rivers home environment Family Day Care of some of the graffi ti and had roller, gloves and headlamp left action against reported inci- t Supported by the largest scheme also seen white paint smudges at the scene which the resident dents of hooning and breach of in NSW on their car’s door and on a seat. said he found there. Th e couple road rules by rally drivers and t Flexible hours Th e couple had earlier told had earlier told the court they supporters. the court they had been paint- had returned to the scene to Th e rally, he said, was eventu- t Childcare benefi t available ing anti-rally slogans on ban- see if the occupants of the four- ally moved to Coffs Harbour t Become a carer and work from ners and placards in Kingscliff wheel-drive vehicle had been because of widespread oppo- home that day and paint had smeared involved in a long-running sition to it and many people had been upset the state gov- t Free training & fi nancial support over their car and clothes. Th ey ‘graffi ti war’ between anti-rally provided said they had stopped to change and pro-rally people and said ernment had forced it onto the drivers near some fresh graffi ti they saw a man painting over community, abrogating 12 ex- on Kyogle Road on the night slogans on the road barrier. isting laws. Seniors launch ‘not approved by owners’ TWEED 4 Park Street Tweed Heads Phone 07 5536 1865 Luis Feliu She suggested there was con- home-owning residents pay for fl ict of interest with Cr Polglase the use of these facilities. LISMORE 150 Laurel Avenue Lismore Phone 02 6621 6437 Serving the Community since 1980 A complaint has been lodged as manager of the park and the ‘The park has a residents’ ‘A division of Northern Rivers Childcare Services Inc.’ with Tweed Shire Council over fact council was involved in a committee which is the only its plan to launch this year’s court appeal over a proposed body officially authorised by Seniors Week at a private facil- expansion of the park. the Consumer Traders and ATTENTION HOME OWNERS, FARMERS, ity run by a councillor. Staging the two-hour Tenancy Tribunal to make de- Noble Lakeside Park resi- launch there could be seen cisions aff ecting the residents GARDENERS, POOL OWNERS AND LAWN LOVERS: dent Roma Newton lodged to ‘enhance the profi le’ of the of this community, and then WATER TANKS HAVE NEVER BEEN SO the complaint this week with councillor and developer in its only aft er consulting with the council’s probity officer Neil bid to expand. residents at an internal public AFFORDABLE Baldwin, saying the residen- In her complaint, Ms New- meeting. NSW Government tial park she lives in, run by Cr ton said she supported coun- ‘It is surprising any responsi- rural and residential Warren Polglase, was a private cil’s recognition of seniors but ble organisation would accept rebates available for and not a public facility. ‘surely it should not include an off er to use any premises water tanks for the The official launch of the disruption to the lives of elder- without requiring confirma- garden/pool etc. council-sponsored event will ly and increasingly frail sen- tion that the offerer had the be held at the park on March iors, especially on their own authority and the right to make 5000 ltr round tanks 20. private home ground. those premises available. $47500 Ms Newton said that as a ‘It would appear the so- ‘Nor does the social club, as senior citizen herself, she did cial club has acted outside its an entity, have the right to re- after rebate not object to the event but charter. Th e residents of this strict admittance to this park’s GET IN BEFORE IT that permission for council park pay for the use of park facility to 100 residents on any ENDS SOON to use the park was given by facilities. Th e social club is not occasion. All 400 have equal the residents’ social commit- a resident owner of the park admittance rights. Yet this re- 400 Tweed Valley Way Murwillumbah teee instead of its home-owner and does not pay for the use of striction is being imposed on www.duraplas.com.au 02 6672 6977 committee. the facilities off ered. Only the us.’
6 February 24, 2011 Th e Tweed Shire Echo
Why is a levy necessary? A lot of Australians have supported individuals during the flood crisis through generous donations. These will help fellow Australians get their flood affected homes and lives back in order. But billions of dollars are still needed to fix vital infrastructure such as roads and bridges damaged by the floods and storms. The Commonwealth will meet two-thirds of these repair costs through budget cuts. The other third will be covered through the modest and temporary levy.
Levy facts 1 Low-incomeLo earners will not pay the levy. The levy only applies to income above $50,000
2 TheTh levy will not apply to victims of the floods. People in flood affected areas who meetm the Australian Government Disaster Recovery Payment criteria this financial year will be exempt from the levy 3 60%60 of taxpayers will pay less than $1 a week 4 PeoplePe earning $80,000 for example will only pay $2.88 a week - less than a cup of coffee 5 TheT h levy will only apply for the 2011-2012 financial year 6 EveryEv cent raised through the levy will go directly to flood affected regions across AuAustralia to repair critical infrastructure such as roads, bridges and rail.
In hard times, Australians pull together
Authorised by Justine Elliot MP, 107 Minjungbal Drive, Tweed Heads South NSW 2486 This material has been produced by Justine Elliot MP using her printing and communications entitlement Comment Libs make bigotry a political weapon o, shrill the triumphalists totally unplanned and there was tralians, of course, were even unscrupulous and opportunist of the conservative press, no policy to deal with it. more marginalised but being politicians for their own cynical Volume 3 #24 February 24, 2011 S multiculturalism is dead. So just what is multicultural- less noticeable could have their advantage. Which brings us, in- It has proved to be a complete ism? The Tory pundits shake problems ignored for longer. evitably, to Scott Morrison. disaster. their beetled brows and say it is But although these issues were It is uncontested that Mor- We know this because we all too diffi cult, too complex to important, they did not impede rison raised in shadow cabinet Not a good look have it from no lesser authori- explain. But in fact it’s so simple the great march forward. the matter of fear and loathing ties than the prime ministers you can set it to music: America was the fl ag bearer, of Muslims within some Aus- On the surface, the planned launch by Tweed Shire Council of both Great Britain and We are one, but we are many, and aft er the second world war tralian communities. It is also next month of Seniors Week at Kingscliff ’s Noble Lakeside Germany. David Cameron And from all the lands of Australia followed suit. Un- pretty certain that he did not Park where many seniors live sounds like a good idea, but claims that multiculturalism earth we come; til then, migration had been go on to say: ‘Of course such at- a complaint by a resident reveals a diff erent slant in which promotes division rather than We share a dream and sing predominantly British with a titudes are divisive and danger- council protocol is called into question. unity; Angela Merkel asserts with one voice: trickle of other mainly north- ous, born of ignorance and nur- The resident is absolutely right in saying permission for that it has utterly failed. What You are, I am, we are ern Europeans. The post-war tured by bigotry, and we should the launch by council should have been sought from the else is there to say? Australian. reconstruction scheme broad- join with the government and residents’ committee, an incorporated body, rather than the Well, just one thing, and Mal- present a united front to do eve- social committee which has no legal standing there and is colm Fraser has dared to say it: As Immigration Minister Chris Bowen rything possible to educate and not the lawful mouthpiece for residents. they don’t know what they are pointed out last week, there is a peculiar inform those who hold such Then the question of transparancy arises in that the park talking about, because neither genius in the Australian version of wrong-headed views.’ of their countries has ever had a Given his record, it seems owner is currently involved in a Land and Environment policy of multiculturalism. multiculturalism and its ties to nation likely that reports that he ad- Court appeal after the joint regional planning panel last What they have had is immi- building and citizenship. vised his colleagues to seek out year rejected his controversial bid to expand the park. That gration programs – or perhaps ways to use whatever prejudice panel had overruled council’s approval of the extension and the lack of them – which have by Mungo MacCallum and hate they could uncover as residents are part of this appeal. collapsed in a heap of unin- weapons to wedge the govern- We know council is a stickler on issues of probity or con- tended consequences and so- Or, as the Americans put it ened the intake to include large ment are at least pointing in the fl ict, given all the recent ruckus with code of conduct citings cial unrest, because no one ever even more concisely in the mot- numbers of southern Euro- right direction. After all, this by councillors, bans on protest placards in council and legal tried to make them balanced to on their great seal: E Pluribus peans, and ventured into the is One Nation policy, and One threats to residents over confi dential documents – so why and inclusive. Unum – out of many, one. Th e Middle East. It took another 20 Nation’s demented Queensland hasn’t the council executive looked at the perception of In Germany’s case, the trou- two definitions are especially years before the White Australia mouthpiece Ian Nelson is al- holding the launch at a private place run by a sitting council- ble was the so-called guest pertinent because they come Policy was eff ectively killed off ready claiming credit for inspir- lor who is employed by and acts for a developer currently in worker scheme: cheap labour from the only two countries ever and multiculturalism offi cially ing Morrison’s outburst against a court battle with the state planning panel and residents? was imported from countries to have consciously embarked enshrined as a word and as a bringing asylum seekers to at- Another park resident says many in the park do not object such as Turkey. No attempt was on a policy of multiculturalism law, but in fact the concept had tend the funerals of their close made to integrate the newcom- and the two which most vigor- been developing for far longer. relatives, and for trying to get to the launch or involvement by the park in the event as ers, who were never meant to ously defend its outcome. As Immigration Minister Abbott to drop aid to Indone- many residents are involved with Seniors Week activi- stay for long anyway; but the Both were the result of war. Chris Bowen pointed out last sian schools which teach poli- ties, organising or playing in bands, but the right thing for economy could not do without After the first world war the week, there is a peculiar ge- cies of moderation. council to do would have been to ask the residents’ commit- them, and they formed ghet- United States opened its doors nius in the Australian version This latter policy will give tee otherwise it could be seen that Cr Warren Polglase, who toes which became the breed- to the homeless and tempest- of multiculturalism and its ties aid and comfort to Muslim ex- manages the park, is holding some sort of sway over council, ing ground for resentment and tossed of Europe and the new to nation building and citizen- tremists and so incite greater and the park owner could reap some sort of fi nancial benefi t discontent. world became the great melting ship. It is more than an idea paranoia among the vulnerable from showcasing or promoting the park in such a way while In England the problem arose pot. The immigrants did not whose time has come; it is an in Australia, fully in line with the court case is continuing. from the end of the empire; Har- shed their identities – rather inescapable fact of life, and one what Morrison is reportedly Council is fully aware of this sort of confl ict and its rami- old MacMillan’s winds of change they gloried in them. Genera- of which Australia should be advocating. And Gary Hum- fi cations. It was not that long ago when Cr Polglase was drove many thousands to seek tions later many still describe hugely proud. phreys, the Liberal senator for then mayor, that the council’s new corporate identity and refuge in what they had been themselves as Polish Americans Of course from time to time the ACT, presented a petition logo was planned, behind the scenes, to be launched at a told was their home country. or Italian Americans, but they there are hiccups; the boat people calling for an end to all Mus- private location at Chinderah owned by a prominent Tweed In particular Asians fl ed from are all, unarguably, Americans. have constituted one, just as the lim immigration. It was signed the newly independent coun- The noble experiment had far greater infl ux of Mexicans has by just three people, none of businessman, and seen as the unoffi cial headquarters of tries in Africa, and the fl oods its setbacks: a complicating fac- produced rumblings in the Unit- whom live within 300 kilome- the National Party in the Tweed, of which the mayor was a arrived before the doors could tor was the presence of a large ed States. But there is no reason tres of Humphrey’s electorate. member. be closed. Now, of course, not number of African Americans, to believe that these setbacks will But, he said smugly, he was just The venue was hastily changed to public land at the last even Australians are welcome; involuntary immigrants who be any more severe than others doing his duty. minute, after some councillors questioned whether it was but those who made it cannot were for a long time denied their have been in the past – unless, At least the bastards are con- a good look for council’s image to offi cially rebrand itself in be deported. Once again, it was rightful place. Indigenous Aus- of course, they are exploited by sistent. the backyard of the Solo Waste Centre run by longtime sup- porter of the then mayor, party chief Idwall Richards. HAVE YOUR WEDDING Tweed Shire Echo Publisher David Lovejoy Editor Luis Feliu FEATURED IN Advertising Manager Angela Cornell Accounts Manager Simon Haslam Production Manager Ziggi Browning ‘The job of a newspaper is to comfort the affl icted and affl ict the comfortable.’ – Finley Peter Dunne 1867–1936 © 2011 Echo Publications Pty Ltd PO Box 545, Murwillumbah 2484 Phone 02 6672 2280 email: [email protected] Printer: Horton Media Australia Ltd HELP THE GREENS MAKE HISTORY Visit the website and click the This election, help bring transparency and better planning back to NSW and Tweed. promotional star on the front The Greens work for the community, and don’t accept donations from corporations. page to fi nd out more. You can support Andrea Vickers and the Tweed Greens by donating to our campaign. TO DONATE, CALL TERRY ON 0429 965 720 www.tweedbyronweddings.com Authorised by Terry Morgan, 3 Tern Court, Tweed Heads West 2485
8 February 24, 2011 Th e Tweed Shire Echo
Letters to the Editor are at particular risk, with peo- Email: [email protected] ple under 26 holding only 15 Deadline: Noon, Tuesday per cent of driver licences in Our koalas must and can be saved Letters longer than 200 words may NSW but comprising 36 per be cut and pseudonyms are not cent of all road fatalities in this A report (just released) by re- It is now vital that we focus family thing’ work out. Basi- koalas must cross to reach acceptable. state, therefore are more than nowned koala ecologist Ste- on their habitat – this means cally they just love their patch other colonies or to search for Please include your full name, twice as likely to die on our phen Phillips paints a grim preserving the areas where we – and they’ve been this way for juicier food trees. address and phone number. roads as other licence holders. picture for the last remaining know they still live and breed. thousands of years – so who 4. Keep them well fed and Th ey also comprise 32 per cent koalas on the Tweed Coast. Koala habitat areas are now are we to think that ‘relocation’ safe closer to home by aug- Ill-considered opinion of those injured in all road ac- Until the last few years the area protected under state law but is an option? (It’s been tried menting their forests (and the Mr Selway’s letter to the edi- cidents in NSW. between Terranora and Potts- astonishingly the Tweed Shire and it failed.) surrounding area) with koalas’ tor (February 17) deserves a Lack of experience is only ville supported several koala Council does not have any We’re left with the simple favourite trees. response. A landowner of a one part of the equation, the colonies surviving in the wild. form of koala management choice – do we want koalas on 5. Draw up a ‘Koala Man- rural property is not required other being driver attitudes, Th is latest study fi nds that their plan to identify and preserve the Tweed, or not? agement Plan’ that outlines to derive an ‘income’ from the especially the ‘need for speed’ numbers have now halved! these areas! The study has found that the most strategic and eff ec- property as a prerequisite to promoted by motorcar racing At an estimated total popu- Our Tweed Coast koalas only three colonies remain tive ways to put these measures their activities being deemed and parts of the automotive in- lation of only 144, their long- are a remarkably enduring that are big enough and have into action. agricultural. dustry. Motor sports promote term survival now hangs pre- bunch. Th e study has sighted enough food trees to sustain Finally – and this shouldn’t If the Colbys’ property is a pro-speeding message which cariously in the balance. three generations of koalas koalas. It strongly recommends have to be said – any new de- zoned rural, then their eques- shapes driver attitudes. But they can be saved With making their homes and liv- the following measures be put velopments on land close to trian pad would be consistent Research by the ANU re- a few practical measures this ing in the same location. When in place with urgency. known koala colonies must with permissible uses within vealed a link between an in- report explains how we can our koalas fi nd a good place to 1. Tree preservation orders adopt ‘best practice’ koala the zoning. terest in motor sports and an increase their number to 170 live – like many of us in this throughout the shire for the friendly measures. These are There has never been any attitude that speeding is safe. A – the population needed for beautiful area – they stay put. (only four) tree types koalas not diffi cult or costly (in the suggestion that the Colbys are major problem with motor rac- long-term viability. Th is will be the key to their eat. big scheme) and they are well operating a business. It appears ing is that spectators who wish Their decline (in order of survival. 2. When fires do occur in known and well tried with to me their dressage horses are to emulate the behaviour of the fatality) has been caused by Like us they keep a certain their known neighbourhoods, positive results. an interest about which they motor racing drivers oft en do recent coastal fi res, motor ac- distance from their neighbour protect them by putting the fi re So, although reading this are passionate. so on public roads. Th is then cidents and lastly dog attacks but still require another colo- out (not just ‘controlling’ it) to might make saving our koalas As for the reference to the puts the burden of risk on to (that happen unseen or heard ny nearby to make the whole prevent a repeat of 2009 when all sound quite simple, be as- Colbys being ‘new owners’, so other road users. in isolated bushland). ‘fi nding a mate and starting a a major koala area at Cudgen sured – koalas will be gone from far as I am aware, they have Th e Northern Rivers Guard- was incinerated – and the koa- the Tweed if you do no more lived on the property for 13 ians condemns the use of pub- ate. Such an option now ex- To compound the situa- las with it. than just read this letter. years. Mr Selway appears to lic money to support motor ists in Australia as we struggle tion the recent fl ood crisis in 3. Speed controls and/or ef- Marion Riordan support Cr Milne’s ill-consid- racing, as this money would be with abnormal cost increases, Queensland and elsewhere will fective underpasses on roads Condong ered opinion that long-term more wisely invested in help- eg. council rates, waste water, impose economic strains on residents of the Tweed are ing reduce the massive burden mortgage rates and bank fees, the entire nation, hence defi cit deserving of more favourable of road trauma rather than en- petrol profi teering and weekly budgeting may be an appropri- treatment from council than courage risky driving. Govern- rises in basic foodstuff s. ate instrument to implement Kingscliff the ‘blow ins’. ments are sending the wrong Many of these costs were as at this time. At least Tony Campus Jim Dwyer message when they spend our a direct result of the Howard Abbott’s shrill voice will not Bilambil Heights tax dollars to sponsor motor government’s preoccupation claim ‘another new tax’. Defi cit racing, like V8 Super Cars and with financial surpluses to funding of several billions of Stopping the carnage rally racing. If they are seri- the detriment of infrastruc- dollars would in fact bolster The National Road Safety ous about wanting to reduce ture spending on hospitals, the economy giving stimulus A Taste of France Council has called for a new the road toll the National Road schools, port facilities, railways to the agricultural/rural com- king classes. sation and coo strategy to achieve a 50 per Safety Council should recom- and road transport and mental munity, restoring the viability French conver cent reduction in traffi c fatali- mend against public funding health. of the mining sector, a major ties over the next decade. Th e of motor racing. The inordinate cost of liv- assistant to the infrastructure Council says governments at Just to hand. Maybe the poli- ing increases is a significant of local and state governments Commencing: 5 March 2011, all levels should double invest- ticians are starting to connect problem for low and middle and a compassionate gesture to ment in black spot programs the dots: Liberal candidate for class workers. Obscene re- devastated home owners. Saturday mornings for 8 weeks. and also criticises elements of Auburn, Ned Attie, has report- muneration packages paid to Mal Rae Cost: $420 all inclusive. the automotive industry for edly told a community group company directors, CEOs and Bundall
senior directors are precursors 3 encouraging speeding and opposing the V8 Supercars For more information contact 2 3 dangerous driving. event that if the coalition is to the creation of a two-tier so- Tough for farmers Kingscliff Campus on 02 6674 7200. Road trauma costs the na- elected it would be moved to ciety, namely the wealthy and It is a tough world if you are a NC262 tion $27 billion annually, with Eastern Creek. the poor. Workers produce the dairy farmer in Australia try- around 1,500 fatalities and Scott Sledge real wealth for companies and ing to earn a living when they 131 601 30,000 seriously injured each Lillian Rock Australia and not the insatia- are forced to sell milk at a low northcoast.tafensw.edu.au year. ble greed of a growing army price and if the price gets any Northern Rivers Guardians, Bring on the defi cit of couch potatoes. Instead of lower many will be forced to a grass roots activist organisa- Australian governments of all placing a salary cap on these sell out and mostly likely for- tion, supports any measure persuasions are obsessed with high flyers perhaps a 70 per eign interest will buy their that reduces injury and fatality the notion of surplus budgets. cent income tax imposition farm. Don’t tell Mama on our roads, particularly strat- Defi cit budgeting is common- would curb their greed. Jobs/ Th e reason I say this is be- egies that diminish the risk to place around the globe and employment is the crux of our cause in the past two years Solid Teak Buddhas long-term prosperity. young people. Young drivers at times becomes appropri- continued overleaf Handcraft ed in Cambodia THE ULTIMATE French polished WINTER to perfection EXPERIENCE BARGAINS TO 2ND & 3RD YEAR BE HAD... Totara APPRENTICE CHEFS Sauvignon Blanc LIVE, WORK & PLAY MAKE AN in the NSW Snow Fields 2010 OFFER! RECRUITING NOW MUST CLEAR $99/Dozen Free call 1800 761 561 Email [email protected] TO MAKE *Price valid until March 1, 2011 Apply online www.onqhr.com.au S23B18276 WAY FOR NEW 32 Marine Parade, Kingscliff äÓ®ÊÈÈÇ{Ên{ääÊUÊÜÜÜ°i>ÕiÃÜià «°V°>Õ STOCK This program is jointly 54A Byron St, Bangalow (next to the Fire Station) funded by the NSW Government & the Australian Government & administered by the NSW Department of Education & Training. 02 6687 2553
www.tweedecho.com.au
continued from page 9 It appears that rights of the standing. After all, he died for more than $9 billion in prized people are being ignored by the the sins of the world and each agricultural assets plus water Tweed Shire Council, who ap- one in it, even those who don’t rights have been sold to off- pear to be hand in glove with believe he exists. We who fol- shore interests and one of the Tweed Coast Holiday Parks low him try to love as he loved these is the Queensland Cattle Reserve Trust. but because we are human we Company which holds 22 cattle This council seems to have fail continually. properties. the reputation of being bullies, There are many kinds of On top of this some of Aus- and I find it incredible that love. The original Greek tralia’s best known brands, these people were sacked once, words, which we have trans- such as Golden Circle, SPC, and reappear to once again ig- lated loosely into ‘love’, cov- Dairy Farmers, CSR Sugar and nore the complaints of a large ered different emotions such Sun Rice, just to name some, number of its community. as ‘Eros’ (sexual love), ‘Philia’ have also passed into foreign Perhaps someone should set (brotherly love), and ‘Agape’ ownership with buyers looking up a petition (if it has not al- (Love of God for man, also the to buy more of our assets. ready been submitted). I would selfless love that causes one The main reason they are certainly sign on the dotted person to sacrifice themselves buying is to feed their own line. and their own best interest for population because they know Give a thought, Mr Mayor, another). the world population will keep set aside your politics and save We are male and female. increasing and the demand for this pristine area for this gen- Because we are both halves food will become even greater, eration and many to come, of a whole, society functions which is fair enough. However, and take your caravan park best when those two roles are it is hard to understand why and buildings etc, and save the clearly identified. Philia and our politicians allowed more fauna and all relevant plants Eros are necessary for a good than 49 per cent of these valu- and trees. marriage between a man and able assets to be sold and at the Audrey Johnson a woman and Philia for a good rate they are being snapped up Cabarita Beach parent child relationship. Australia would eventually end When Philia and Eros ex- up with none. Deep love and concern ist between two men, two J B Gray I wish to correct your heading women or parent and a child, Pottsville ‘Greens are a broad church’ at or Eros between an adult and the beginning of Lyn Dickin- a child, the laws of nature are Set aside politics son’s letter in last week’s Echo. broken. Society suffers. Sexu- We moved from the Gold The Greens are not a church al identity becomes confused Coast to escape the overpopu- at all but a political party with and often damaged beyond re- lation and constant traffic to specific agendas much the pair. Young people growing up find tranquillity in this won- same as any other political need that sense of identity. derful village. party. Their political agenda I have only deep love and We are both in our late eight- certainly has environmental concern and certainly do not ies, and have lived here for over elements but it also has a social condemn those caught up in two years. This beautiful envi- engineering agenda. this lifestyle or those damaged ronment should not be spoilt Jesus Christ loves and ac- by it. and end up as the next Gold cepts the human beings of this Gwenyth May Thomson Coast. planet with love and under- Pottsville Beach Cyclone Yasi Cassowary Appeal Right now, we need your help to save the Cassowaries of Mission Beach in Far North Queensland. Their rainforest home has been devastated by Cyclone Yasi and they face starvation unless we act now. Rainforest Rescue is helping to provide food for the Cassowaries and is restoring their rainforest habitat. Cyclone Yasi has stripped the rainforest trees bare. Once the Cassowaries have eaten the fallen rainforest fruit, they will be forced to leave the forest in search of food. This could be disastrous for the already dwindling population. In the aftermath of Cyclone Larry in 2006, a large number of Cassowaries were hit by vehicles or attacked by dogs once they left the forest. One-third of the Cassowary population died of starvation. Please help to save this magnificent species. They are already threatened with extinction and it is estimated that only 1,000 remain in the wild. Please donate now and help fund the food for these iconic rainforest birds. The food will be placed at remote feeding stations to ensure that the Cassowaries do not wander into town and get hit by cars. We are also planting trees to provide essential Cassowary habitat and purchasing rainforest properties to ensure Cassowary habitat is protected. Help feed the Cassowaries of Mission Beach in the aftermath of Cyclone Yasi. $25 will provide Cassowary food for one day and ensure the survival of this endangered species. Rainforest Rescue is a local not-for-profit organisation committed to protecting rainforests forever. We create opportunities for individuals To make a tax deductible and businesses to support successful projects to donation visit protect and restore our www.rainforestrescue.org.au rainforests. or call 1300 763 611
10 February 24, 2011 The Tweed Shire Echo
Even our coffee Coffee Lover is magical coupons Shop K1 Banora Central Cnr Fraser and Leisure Dr Buy one coffee, Banora Point get one FREE! Only 7 minutes Open from Mullumbimby! 6.30am - 5.30pm Monday to Friday 81 Monet Drive 6.30am - 5.00pm Saturday Offer ends March 31, 2011 www.crystalcastle.com.au 7.30am - 4.00pm Sunday (02) 6684 3111 Buy 1 regular
© Intellectual Plus. All Rights Reserved zarraffas.com coffee, get 1 regular coffee F REE!
Valid until March 31, 2011 KITCHEN & CABINS Mavis’s Buy one coffee, get one FREE! Delicious home-made salads, wraps, soups, pies and more! Offer ends March 31, 2011 Open 7 days 64 Mt Warning Road, Mt Warning FREE coffee for Tweed Phone (02) 6679 5664 / Fax (02) 6679 5665 Shire residents on Kingscliff Shopping Village Lunch Wed to Sun / Dinner Fri & Sat / Fully licensed presentation of T: 02 6674 5577 E: [email protected] this voucher. www.maviseskitchen.com.au
Valid until March 31, 2011 Limit one per person
Coffee & Cake $9.50 Est. 1993 KITCHENMavis’s & CABINS
Voted Best Breakfast Restaurant by Valid until June 30, 2011 Restaurant & Caterers Association of Australia Present this coupon for 247A TWEED a F REE UPSIZE from SHOPPING CENTRE Short to Tall, or Tall to KIRKWOOD ROAD ENTRANCE Grande menu beverages. Shop 1 t94 Marine Parade 0428 160 036 Valid until March 31, 2011 Not valid with any other offers. tKingscliff t02 6674 1993 Extras will incur relevant charges. www.tweedecho.com.au Th e Tweed Shire Echo February 24, 2011 11 A CONCRETE SWIMMING POOL RWKHUJUHDWIHDWXUHVLQFRUSRUDWHGLQWRWKHELGHWWKHELGHW THAT CAN BE INSTALLED IN JUST WRLOHWVHDWKDVPDQ\KHDOWKEHQHILWV+HH[SODLQHGKRZ ONE DAY! WKHVHDWZRUNHG RQFH\RXKDGILQLVKGRLQJ\RXUEXVLQHVV NORTHERN RIVERS GARDEN & LAWN MAINTENANCE %HOLHYHLWRUQRW$XVWUDOLDQ3OXQJH3RROVKDYHDSURGXFW ¶VLPSO\SUHVVWKHERWWRPRUIHPLQLQHZDVKEXWWRQDQG WKDWFDQGRMXVWWKDW WKHELGHWSURYLGHVDVWUHDPRI ZDUPZDWHUWRFOHDQ\RX For a free quote call today WKRURXJKO\7KHQZLWKWKHSUHVVRI DQRWKHUEXWWRQ :LWKEDFN\DUGVJHWWLQJVPDOOHU$XVWUDOLDQ3OXQJH ZDUPDLUJHQWO\GULHV\RX1RPRUHWRLOHWSDSHU· Competitively priced lawn mowing 3RROVRIIHUDFRPSDFWVW\OLVKDQGHQYLURQPHQWDOO\ and maintenance IULHQGO\SURGXFWWKDWZLOOPRGHUQLVHDJDUGHQDQG $OWKRXJK7KH%LGHW6KRSRIIHUHGWRVHQGRXWDEURFKXUH Yard cleanup, tree planting, weed SDFN0DEHOGHFLGHGWRRUGHUDELGHWVHDWVWUDLJKWDZD\ FUHDWHDGLVWLQFWLYHGHVLJQHOHPHQWWKDWZLOOFRQQHFW spraying 6KHHDVLO\LQVWDOOHGWKHVHDWKHUVHOI DQGLWILWWHGSHUIHFWO\ Landscaping, regeneration inc WKHKRPHZLWKWKHHQWHUWDLQLQJDUHDVDWDQXQEHDWDEOH RQKHUH[LVWLQJWRLOHWERZO0DEHOVDLGWKHELGHWZDVRQH fertilisation & soil improvements SULFH$OWHUQDWLYHO\WKHSRROVFDQEHXWLOLVHGLQGRRUVWR RI WKHEHVWLQYHVWPHQWVVKHKDGPDGHLQKHUSHUVRQDO PD[LPLVHDOO\HDUXVDJH We will beat any quote guaranteed KHDOWKDQGK\JLHQHDQGQRORQJHUILQGVJRLQJWRWKHORR so call today! ,I \RXUHTXLUHDSRROIRUWKHFKLOGUHQE\GD\DQGD DQLVVXH¶*LYHLWDJR·VKHVD\V¶,GLGDQG,FRXOGQ·WEH URPDQWLFVSDE\QLJKWWKHSRROFDQEHFXVWRPGHVLJQHGWR KDSSLHU·)RUDQLQKRPHGHPRRUIRUDIXOOEURFKXUHDQG 0( s -/" VXLW\RXUQHHGVZLWKDGGLWLRQDOVHDWLQJVSDMHWVYDULDEOH DSULFHOLVWFDOO7KH%LGHW6KRSRQ 2UFRPH GHSWK XSWRP DQGKHDWLQJSURYLVLRQ VHHKRZWKHELGHWVZRUNDWRXUGLVSOD\FHQWUHLQ$XVWUDOLD 6RLI \RXUQHHGVDUHVPDOODQG\RXZDQWWRVDYHWLPH )DLU6RXWKSRUW Interior Design Course PRQH\DQGVSDFHWKHQFDOOQRZWRDUUDQJHDTXRWHIRU \RXUVLWH)RUIXUWKHULQIRUPDWLRQFRQWDFW MR PROPERTY Interior Design course running in Byron Bay ZZZDXVWUDOLDQSOXQJHSRROVFRPDX SERVICES When: Starts March 14th – Every Monday & Wednes- 0U3URSHUW\6HUYLFHVLV day for 4 weeks A FLUSH FIND SURXGWRRIIHUDSURIHVVLRQDO Time: 1pm-4pm Mon & Wed – aft ernoon class 0DEHOZLVKHVVKHKDGIRXQGWKHELGHWWRLOHWVHDW\HDUV DQGGHGLFDWHGVHUYLFHDW 5.30pm-8.30pm Mon & Wed – evening class DJR¶,W·VPDUYHOORXV·VKHVD\V¶,DOZD\VZDQWHGDELGHW UHDVRQDEOHUDWHVWRWKH Where: Byron Bay Community Centre – upstairs LQP\EDWKURRP,KHDUGWKDWDELGHWZRXOGDVVLVWPHDV EX\HUVDQGVHOOHUVRI Tutor: Meriel Shaw (TAA qualifi ed) professional designer P\DUWKULWLVDQGEDGEDFNKDGPDGHJRLQJWRWKHORRDQ PDQXIDFWXUHGDQGUHORFDWDEOH Cost: $550 p/p RQHURXVWDVN· KRPHVORFDWHGLQOLIHVW\OH Bookings: Call Meriel on 0418 453 057 or email Meriel at YLOODJHVDQGUHVLGHQWLDO [email protected] 0DEHOVD\VKHUOXFNFKDQJHGZKHQVKHVDZDQDGLQWKH SDUNVLQWKH7ZHHG9DOOH\ ORFDOSDSHUDIHZPRQWKV DQGWKHVRXWKHUQWLSRI WKH DJRSODFHGE\7KH%LGHW 4XHHQVODQG*ROG&RDVW 6KRSIRUWKHELGHWHOHFWURQLF WRLOHWVHDW,WUHDG¶7KLV 0U3URSHUW\6HUYLFHV·SULPDU\JRDOLVWRSURYLGH¶DKRPH ELGHWVLPSO\UHSODFHV\RXU IRUHYHU\EXGJHW·DQGZLWKRYHUKRPHVUDQJLQJIURP H[LVWLQJWRLOHWVHDWDQGZLOO WRORFDWHGDWOLIHVW\OHYLOODJHVDQG DXWRPDWLFDOO\FOHDQ\RX UHVLGHQWLDOSDUNVWKH\DUHFRQILGHQWWKDWWKH\ZLOOKDYHD ZLWKRXWWRLOHWSDSHU· KRPHIRU\RX 0DEHOVDLGVKHZDVVRH[FLWHG 3OHDVHFRQWDFW.HOYLQ3ULFHDW 0LQMXQJEDO'ULYH VKHFDOOHG7KH%LGHW6KRSIRU 7ZHHG+HDGV6RXWK3KRQH RUPRELOH PRUHLQIRUPDWLRQ6KHVSRNH WR6WHSKHQZKRH[SODLQHG (PDLO NSULFH#PUSURSHUW\VHUYLFHVFRPDXRUYLVLWRXU DSDUWIURPWKHFRPIRUW ZHEVLWHGHGLFDWHGWRPDQXIDFWXUHGDQGUHORFDWDEOHKRPHV IDFWRUVRI DKHDWHGVHDWDQG ZZZPUSURSHUW\VHUYLFHVFRPDX r get... fi t and fi summe tted ou This t!
12 February 24, 2011 Th e Byron Shire Echo
1. The usually suave Pierce Brosnan plays a sociopath in the Canadian thriller Butterfl y On A Wheel (Prime, Friday, 8.30pm). The title is a literary allusion to Alexander Pope’s work, so no wonder the Americans called it Shattered instead. 2. Josh Peck plays the troubled teenager who falls in love with his psychiatrist’s daughter in The Wackness (SBS1, Saturday, 10.05pm). 3. The peerless master of the nature doco, David Rabbitburrow, is back with David Attenborough’s First Life (ABC1, Sunday, 7.30pm). That’s a sponge 1 2 3 he’s examining, not a turd.
MacGyver 3.00 Cheers 3.30 Roseanne Seven News 5.30 Deal Or No Deal ABC 1 ABC NEWS 24 SBS 2 4.00 Sabrina The Teenage Witch 4.30 6.00 Prime News 7MATE GO! 4.00 Can We Help? 4.30 The Cook And 4.00 ABC News 4.05 The Quarters 5.00 Weatherwatch 6.00 World News Mork & Mindy 5.00 Happy Days 5.30 6.30 Seven News 6.00 Wagon Train 7.30 The Virginian 6.00 Kids’ Programs 10.30 ET 11.00 The Chef 5.00 Something In The Air 5.30 4.15 The Drum 5.00 ABC News 6.00 Global Village The Brady Bunch 7.00 Home And Away 8.30 McHale’s Navy 9.00 NBC Today TMZ 11.30 Get Smart 12.00 Here’s The New Inventors 6.00 Kids’ Programs 5.15 The Quarters 5.30 Newsline 6.30 Alchemists Turn To 6.00 Family Ties 7.30 Better Homes And 11.00 Quincy ME 12.00 Magnum Lucy 12.30 Green Acres 1.00 Seinfeld 11.00 Around The World In 80 Gardens 6.00 ABC News Breakfast 9.00 ABC Cooking Pierre Gagnaire 6.30 Neighbours Gardens PI 1.00 Airwolf 2.00 Baywatch 3.00 1.30 The Hills 2.00 Privileged 3.00 12.00 Midday Report 12.30 Movie: News 9.30 Business Today 10.00 7.30 More Than A Fiesta 7.00 Everybody Loves 8.30 Movie: Butterfl y On A Xena Warrior Princess 4.00 Hercules Just Shoot Me 3.30 Kids’ Programs Funny Face (G 1957) US comedy. Stars ABC News 12.00 Midday Report 8.00 China 21 Raymond Wheel (M 2007) UK drama. 5.00 The Drew Carey Show 5.30 6.00 Movie: Scooby-Doo (G Audrey Hepburn 2.25 Ladies Of Letters 12.30 Newsline 1.00 ABC News 8.30 Transsexual In Iran 7.30 So You Think You Can Stars Pierce Brosnan According To Jim 2006) Animation 3.00 Kids’ Programs 2.00 Midday Report 2.30 One Plus 9.30 Movie: Eye In The Sky (M Dance US 10.30 Movie: Flightplan (M 6.30 Scrubs 7.30 Movie: Are We There Yet? 6.00 My Family One 3.00 Afternoon Live 5.45 The 2007) Cantonese thriller 9.20 Sex And The City (M/MA) 2005) US drama. Stars Jodie 7.00 That ’70s Show (PG 2005) US comedy. Stars 6.30 Best Of Collectors Quarters 6.00 ABC News 6.05 The 11.10 Movie: Bangkok Dangerous 10.30 The Late Late Show Foster 7.30 Australia’s Greatest Ice Cube 7.00 ABC News Drum 6.45 The Quarters 7.00 ABC (MA 2000) Thai action 1.00 11.30 Cheers 12.00 Roseanne 12.30 12.30 NAB Cup AFL – Collingwood v Athlete 9.30 Movie: Mad Max (AV 1979) 7.30 Stateline News 7.30 Contact Sport 8.00 ABC Weatherwatch Sabrina The Teenage Witch 1.00 Mork Sydney 3.00 Home Shopping 8.30 I Shouldn’t Be Alive (M) Australian action. Stars Mel 8.00 Chopper Rescue News 8.30 One Plus One 9.00 The & Mindy 1.30 Happy Days 2.00 The 9.30 Movie: The Hitcher (AV Gibson 8.30 New Tricks World 10.00 ABC News 10.05 The TEN Love Boat 3.00 Diagnosis Murder 7TWO 2007) US thriller. Stars Sean 11.25 South Park (MA) 11.55 Movie: 9.25 Kidnap And Ransom (M) Drum 10.45 The Quarters 11.00 ABC 4.00 Touched By An Angel 5.00 7th Bean Pumpkin (M 2002) US comedy. Stars 6.00 Early News 6.30 Kids’ Programs 6.00 Kids Time 8.30 Sons & Daughters News 11.30 Contact Sport 12.00 Heaven 11.30 Club Reps (MA) 12.30 Christina Ricci 2.30 Starsky & Hutch 10.15 Lateline 9.00 Ten News 10.00 The Circle 12.00 9.00 Home & Away 9.30 Shortland ABC News 12.20 Lateline 1.00 BBC Strikeforce (M) 1.00 Airwolf 2.00 (M) 4.00 Just Shoot Me 4.30 TMZ 11.00 The IT Crowd (M) 11.25 rage (M) NSW Election Debate – LIVE 1.00 Street 10.00 Coronation Street 10.30 News 1.30 Australian Network News ONE HD Magnum PI 3.00 Hercules 4.00 5.00 Get Smart 5.30 The Flintstones 2.00 BBC World News 2.30 Foreign Oprah Winfrey Show 2.00 Ready Emmerdale 11.00 Hollyoaks 11.30 ABC 2 6.00 Match Play Championship Golf Baywatch 5.00 McHale’s Navy 5.30 Correspondent 3.00 Lateline 3.40 Steady Cook 3.00 Judge Judy 3.30 Passport To The Sun 12.00 Murphy LIVE – Arizona 10.00 Playing Lessons Deal Or No Deal GEM 5.30 Can We Help? 6.00 ABC News The Quarters Infomercial 4.00 Good Chef, Bad Chef Brown 12.30 Desperate Housewives Breakfast 9.00 Kids’ Programs 4.30 The Bold And The Beautiful 5.00 10.30 Manly Surf 11.00 Overtime (M) 1.30 Grey’s Anatomy (M) 2.30 6.00 Today 9.00 Alive & Cooking 7.00 Spicks And Specks Ten News 12.00 NBA Basketball – LIVE 5.15 Movie: The Swordsman (PG 1948) NBN 9.30 The Zoo 10.00 The Nanny SBS 1 Omnisport 5.30 F1 Powerboating US adventure. Stars Larry Parks 4.30 FRIDAY 25 FRIDAY 7.30 Pilot Guides South Atlantic 6.00 6pm With George Negus 5.30 Today 9.00 Kerri-Anne 11.00 10.30 Friends 11.00 Murder, She 5.00 World News 8.30 Monday Monday 6.30 Ten News 6.00 Escape With ET 7.00 Sports Welcome Back Kotter 5.00 Head Of Infomercials 12.00 The Ellen Wrote 12.00 Movie: Till Death Us 6.45 UEFA Europa League LIVE Tonight 7.30 I Fish 8.00 World Rally 9.30 The Tudors (M) 7.00 The 7pm Project The Class 5.30 Growing Pains Degeneres Show 1.00 The View Do Part (PG 1968) UK comedy. Stars 9.10 World News 1.30 Insight Championship – Sweden 10.25 The Wire (MA) 7.30 Biggest Loser 6.00 Bargain Hunt 2.00 Days Of Our Lives 3.00 Alive And Warren Mitchell 2.00 Canal Road (M) 2.30 World News 3.30 Letters And 8.30 NBL Basketball LIVE – 12.25 I Rock: Beggar’s Banquet (M) 8.30 Undercover Boss 7.00 Australian International Cooking 3.30 Hi-5 4.00 Kitchen Whiz 3.00 McLeod’s Daughters 4.00 As Numbers 4.00 The Journal 4.30 9.30 Law & Order (M) Sydney v Cairns Airshow 4.30 Afternoon News 5.30 Hot Seat Time Goes By 4.30 The Golden Girls 12.50 How Not To Live Your Life (M) Newshour 5.30 Global Village 10.30 Outrageous Fortune (M) 10.30 Pro Series Drag Racing 12.00 7.30 That’s My Boy 6.00 Evening News 5.00 The Ellen Degeneres Show 1.20 Coach Trip 1.45 Close 6.00 Letters And Numbers 11.30 6pm With George Negus 12.00 NBA Basketball 2.00 Sports Tonight 8.10 Are You Being Served? 7.00 A Current Aff air 6.00 The Nanny ABC 3 6.30 World News Australia Late News 12.30 Sports Tonight 1.00 Late 2.30 NBA Basketball 4.30 8.45 Escape To The Country 7.30 Two And A Half Men 6.30 Friends 7.30 Coast The Late Show 2.00 Infomercials 5.00 Omnisport 5.00 Drift 5.30 Playing 9.45 60 Minute Makeover 8.00 Mike & Molly 7.00 The Zoo 6.05am to 5.35pm Kids’ Programs 8.30 As It Happened War For Religion Lessons 10.45 Living In The Sun 12.00 Movie: 8.30 Movie: Bride Wars (PG 7.30 Antiques Roadshow 6.00 Trapped! 6.30 Prank Patrol The Atlantic Hope Springs (M 2003) UK comedy. 2009) US comedy. Stars 8.30 The Mentalist (M) International 7.05 What Do You 9.30 World News Australia ELEVEN PRIME Stars Colin Firth 2.00 Movie: The Kate Hudson 10.30 Law & Order (M) Know? 7.35 My Life As A Popat 8.05 10.05 Erotic Tales (MA) Swordsman 4.00 Coronation Street 11.30 Conan (M) 12.25 Murder, She 6.00 Jag 7.00 MacGyver 8.00 The 6.00 Sunrise 9.00 The Morning Show 10.30 Embarrassing Bodies (M) Dani’s House 8.35 Degrassi: The Next 10.35 Movie: I Only Want To Walk 4.30 Emmerdale 5.00 Passport To The Wrote 1.20 McLeod’s Daughters 2.15 Brady Bunch 8.30 Neighbours 9.00 11.30 Seven News 12.00 Movie: A 11.30 ICC World Cup Cricket Generation 9.00 Close (MAV 2008) Spanish drama 12.50 Sun 5.30 Harry’s Practice The Mentalist (M) 3.10 Law & Order Touched By An Angel 10.00 7th Kiss Before Dying (M 1991) UK mys- LIVE from India – Australia Entourage (M) 1.20 Shameless (MA) (M) 4.10 Movie: Lease Of Life (G Heaven 11.00 The Love Boat 12.00 tery. Stars Matt Dillon 2.00 Dr Oz 2.30 v New Zealand 2.15 Weatherwatch 1954) UK drama. Stars Robert Donat Diagnosis Murder 1.00 Jag 2.00 The Zoo 3.30 Kids’ Programs 4.30
7.30 Contact Sport 8.00 ABC News 8.45 Adventures 8.00 Everybody Loves Barbie – A Fairy Secret (G 2011) 6.30 Engineering Disasters 8.30 Movie: Tango & Cash ABC 1 The Quarters 9.00 ABC News 9.45 The 7.00 UEFA Europa League Raymond Animation 3.00 Movie: Herbie – 7.30 Air Crash Investigations (M 1989) US drama. Stars 5.00 rage (PG) 11.00 Cooking The World: Quarters 10.00 One Plus One 10.30 8.30 The Adventure Of English 8.30 Frasier Fully Loaded (G 2005) US comedy. 8.30 Zero Hour (M) Sylvester Stallone Brazil 12.00 Francesco’s Mediterranean 7.30 11.00 ABC News 11.30 The World 9.30 Movie: The Candidate (M 9.00 Everybody Loves Stars Lindsay Lohan 5.00 Eukanuba 9.30 The Universe 10.35 Movie: Buying The Cow Voyage 12.30 Australian Story 1.00 This Week 12.00 ABC News 12.30 7.30 2008) Danish thriller Raymond Extraordinary Dogs 5.30 Sydney 10.30 Mega Disasters (M 2002) US comedy. Stars Jerry WNBL Basketball 5.00 Australian Select 1.00 Big Ideas 2.00 ABC News 11.15 Movie: Torremolinos 73 9.30 Movie: The Naked Gun Weekender 12.30 Stag (M) 1.00 Airwolf 2.00 O’Connell 12.30 Movie: The Open Bowls 2.30 Stateline Summer 3.00 ABC News (MA 2003) Spanish comedy 12.50 33 1/3 – The Final Insult 6.00 Seven News Magnum PI 3.00 Hercules 4.00 Animal (M 2001) US comedy. Stars 6.00 Can We Help? 3.30 Foreign Correspondent 4.00 ABC Weatherwatch (PG 1994) US comedy. Stars 6.30 Surviving Sharks Baywatch 5.00 McHale’s Navy 5.30 Rob Schneider 2.10 The Dukes Of 6.30 Gardening Australia News 4.30 Behind The News 5.00 ABC Leslie Nielsen 7.30 Movie: Over The Hedge (G Deal Or No Deal Hazzard 4.00 Cribs 4.30 Green Acres News 5.30 One Plus One 6.00 ABC News 7.00 ABC News TEN 11.10 Family Ties 11.30 Cheers 2006) Animation 5.00 Unnatural History 6.30 Foreign Correspondent 7.00 ABC 12.00 Roseanne 12.30 Sabrina The 9.15 Movie: Role Models (MA NBN 7.30 Bed Of Roses News 7.30 7.30 Select 8.00 Four Corners 6.00 Kids’ Programs 10.00 Hit List TV Teenage Witch 1.00 Mork & Mindy 2008) US comedy. Stars GEM 8.30 Midsomers Murders (M) 8.45 The Quarters 9.00 ABC News 9.30 12.00 Landed Music 12.30 Going 6.00 Danoz 7.00 Weekend Today 1.30 2.00 Seann William Scott 10.10 Graham Norton Show Landline Extra 10.00 ABC News 10.30 Bush 1.00 Infomercials 2.00 Movie: Happy Days The Love Boat 9.00 Saturday Kerri-Anne 10.00 6.00 Movie: Till Death Us Do 11.15 Movie: Get Shorty (MA 1995) 11.00 Desperate Romantics (M) 11.55 Contact Sport 11.00 ABC News 11.30 The Phantom Of The Opera (PG 3.00 Diagnosis Murder 4.00 Touched Kids’ Programs Part (PG 1968) UK comedy. Stars US comedy. Stars John Travolta 1.35 rage (M) Foreign Correspondent 12.00 Big Ideas 2004) UK drama. Stars Gerard Butler By An Angel 5.00 7th Heaven 1.00 Horse Racing LIVE – Blue Warren Mitchell 8.00 Movie: Chase 1.00 BBC World News 1.30 Stateline 4.30 Making Tracks Home Shopping Diamond Stakes Day A Crooked Shadow (PG 1958) UK ABC 2 2.00 7.30 2.30 Australian Story Classic 5.00 Oprah In Australia ONE HD 5.00 NBN News 5.30 Antiques mystery. Stars Michael Anderson 9.45 6.00 Kids’ Program 3.00 BBC World News 3.30 Foreign 6.00 Ten News 6.00 Match Play Championship Golf 7TWO Roadshow Movie: Bachelor In Paradise (PG 7.00 Dog Whisperer Correspondent 6.30 Bondi Vet LIVE – Arizona 6.00 Kids’ Programs 9.00 Better 6.00 NBN News 1961) US comedy. Stars Bob Hope 7.30 Adam Hills In Gordon St 7.30 Movie: Home Alone 2 (PG 10.00 Quiksilver And Roxy Pro Homes And Gardens 10.00 The 6.30 Australia’s Funniest Home 12.05 The Nanny 12.35 Movie: Merrill’s Marauders (PG 1962) Tonight SBS 1 1992) US comedy. Stars Surfi ng LIVE – Gold Coast Great Outdoors 11.00 The Travel Videos WWII drama. Stars Jeff Chandler 5.00 5.05 Macaulay Culkin 4.00 Omnisport Bug 12.00 A House In France 12.30 7.30 Movie: Hairspray (PG 8.30 Movie: Platoon (MA 1986) Weatherwatch World News 2.35 Movie: Captain Horatio 1.00 Opera: Maria Suarda 3.30 Art In The 9.50 Movie: Happy Gilmore 4.30 Championship Netball No Opportunity Wasted: Canada 2007) US comedy. Stars US action. Stars Charlie Hornblower (G 1951) UK action. Stars 21st Century 4.30 Newshour 5.30 Who (M 1996) US comedy. Stars LIVE – Queensland Firebirds 1.00 How To Blow A Billion 1.30 John Travolta Sheen Gregory Peck 5.00 Getaway Do You Think You Are? Nicky Campbell Adam Sandler v Adelaide Thunderbirds Weekend Kitchen 5.00 Destination 8.40 Lotto 10.30 Movie: Two-Lane 6.00 The Nanny 6.30 World News Australia 11.45 AFL NAB Cup Qualifying Final 6.30 M7 Multisport 7.00 Sports New Zealand 5.30 Man About The 9.55 Movie: Oceans Thirteen SATURDAY 26 SATURDAY Blacktop (M 1971) US House 6.30 Movie: My Big Fat Greek drama. Stars James Taylor 7.30 Monster Moves 1.45 Infomercials 4.00 Religion Tonight (PG 2007) US drama. Stars 6.00 Love Thy Neighbour George Clooney Wedding (PG 2002) US and Dennis Wilson 8.30 Iron Chef 7.30 NAB Cup AFL LIVE – 9.20 RocKwiz Rewind ELEVEN Qualifying Final 6.30 Born And Bred 12.20 Movie: Eulogy (M 2004) US comedy. Stars Nia Vardalos 12.10 From The Tropics To The Snow 7.30 Heartbeat comedy. Stars Hank Azaria 2.20 The 8.30 CSI (M) 10.05 Movie: The Wackness (MA 6.00 7.00 8.00 10.00 UFC Countdown 11.00 NASCAR 12.35 Sun, Sea & Bargain Spotting Jag MacGyver The 8.40 Inspector Morse (M) Avengers 3.20 The Script 3.30 Skippy 9.30 CSI: Miami (M) 2008) US drama. Stars Ben Brady Bunch 8.30 Everybody Loves Sprint Cup 12.00 Championship 1.35 Close 11.00 Kingdom 12.00 The Knock (M) 4.00 Infomercials 10.30 CSI: New York (M) Kingsley Raymond 9.00 Touched By An Angel Netball – Central Pulse v Southern 1.00 The Travel Bug 2.00 Weekend 11.30 Conan (M) 12.30 Movie: 11.50 SOS (G-M) 12.50 Great Australian 10.00 7th Heaven 11.00 The Love Steel 1.25 Bundesliga Football ABC 3 Kitchen 5.30 Harry’s Practice Captain Horatio Hornblower 2.40 Albums: Nick Cave & The Bad Seeds – Boat 12.00 Diagnosis Murder 1.00 LIVE – Schalka v Nuremberg 3.30 GO! 6.05am to 5.45pm Kids’ Programs 6.05 Movie: Merrill’s Marauders 4.30 Murder Ballads 1.50 Drawn Together Jag 2.00 MacGyver 3.00 Cheers 3.30 Playing Lessons 4.00 Match Play 6.00 Kids’ Programs 1.00 Get Smart Stoked 6.35 Prank Patrol 7.00 Serious Movie: The Green Man (G 1957) (MA) 2.20 Weatherwatch Roseanne 4.00 Sabrina The Teenage Championship Golf LIVE – Arizona 7MATE 2.00 Here’s Lucy 3.00 Green Acres Andes 7.30 Good Game SP 7.50 The UK comedy. Stars Alastair Sim Witch 4.30 Mork & Mindy 5.00 Happy 6.00 Wagon Train 7.00 The Virginian 3.30 The Dukes Of Hazzard 4.30 Tribe 9.10 Close SBS 2 Days 5.30 The Brady Bunch PRIME 8.30 McHale’s Navy 9.00 NBC Today Privileged 5.30 The Unnatural History 11.00 Quincy ME 12.00 Magnum 6.30 Movie: National I didn’t fi ght my way to the top of the ABC NEWS 24 5.00 Weatherwatch 6.00 World News 6.00 Family Ties 6.00 Kids’ Programs 7.00 Weekend food chain to be a vegetarian 6.00 Here Comes The 6.30 Everybody Loves Sunrise 9.00 Kids’ Programs 12.00 PI 1.00 Airwolf 2.00 Baywatch 3.00 Lampoon’s Vacation (PG 4.00 ABC News 4.05 The Quarters 4.15 Neighbourhood Raymond V8 Xtra 12.30 Australia Smashes Xena Warrior Princess 4.00 Hercules 1983) US comedy. Stars The Drum 5.00 Q&A 6.00 Landline Extra 6.30 Sarah Wiener’s Culinary 7.30 Frasier Guinness World Records 1.10 Movie: 5.00 The Drew Carey Show 5.30 Chevy Chase 6.30 Behind The News 7.00 ABC News According To Jim
ARIES: With your boss planet Mars beneath that eternally perky front. Stop– genius are just waiting to strike. unhappy people. This isn’t selfi sh: if and enjoy this week’s many tender in the sign of sensitivity and healing, gap quick fi xes which worked for the VIRGO: A nurturing, fertile week for there’s any way to help them, do it. If moments of the up-close and intimate emotions could bubble up when you short term now need serious, in-depth Virgos, though not without the odd not, get on with handling this week’s kind. stars least expect it. Don’t fi ght them – use this reconsidering. existential dilemmas, which require unavoidable disappointment. If the AQUARIUS: If hidden insecurities chance to fi nally understand how those CANCER: Cancer cusp philosopher Jean realisation dawns that most people pressing forward cautiously while not surfacing cause discomfort in this week’s feelings of being ignored, overlooked or Paul Sartre famously observed that aren’t into living up to your ideals and forcing decisions or showdowns. partnerships, you can morph these unsupported are working against you. hell is other people, which could be expectations, that lets them off the SAGITTARIUS: If you’re feeling the time’s mysteries into mastery by not engaging TAURUS: This week makes discipline looking pretty appropriate this week. Do hook. And makes your job as enforcer right for a giant shift, you’re not wrong, in power struggles with anyone but WITH LILITH diffi cult as hearts, minds, plans, whatever you can to clarify confusion, redundant, wouldn’t you say? and there’s plenty going on that’s yet yourself. Don’t gloss over problems With the Sun, Mercury and arrangements and agreements all illusions, projections and assumptions for LIBRA: If this week turns colleagues or to become apparent. Impromptu get- though, and you could end up enjoying become subject to change. Muting the the sake of smoother group dynamics, loved ones critical and bitchy don’t take togethers, especially around end-of-week liberating breakthroughs, even a late week Mars joining volume on your judgment channel – not and your own sanity. it too hard, because their minds and Sagittarian moon, will attract precisely relationship rejuvenation. Uranus and Chiron in fl uid always easy for Taurans – could allow you LEO: This week’s sensitive issues need moods are doing three-sixty-degree the kind of people you need around you PISCES: With this week’s Sun, Mercury, Pisces, liquid principles to hear a brilliant solution to a situation discussion, concessions and a delicate wheelies much like your own. Rather right now. Mars, Uranus and Chiron, planets apply: as in taking the path that seemed insoluble. touch, so resist your natural tendency than snapping back, keep the peace with CAPRICORN: You’re quite sensitive of energy, communication, drive, GEMINI: As this week dives from the to play the drama card. On the upside what Libran Clive James calls diplomatic right now, so it takes extra eff ort to stay enlightenment and healing all in Pisces it of least resistance around inexactitude. obstacles rather than empire of ideas into the sea of feelings, though Your Majesty’s artistic creativity is positive in the face of emotional waffl ing, would be easy to get carried away in your agendas turn inwards and personal – in peaking, imagination’s rampant, romantic SCORPIO: Do yourself a favour by not viral mind changing and poor–me stories. own world and lose touch with others. So meeting them head on… your case to the deeper feelings churning juices are on the rise and fl ashes of hanging out with angry, dissatisfi ed, Get plenty of light–hearted stress relief, here’s the deal: keep it real. 14 February 24, 2011 Th e Tweed Shire Echo www.tweedecho.com.au Boat 12.00 Diagnosis Murder 1.00 US comedy. Stars James Belushi 4.30 6.30 The Amazing Race 8.30 The Big Bang Theory ABC 1 ABC NEWS 24 SBS 2 Jag 2.00 MacGyver 3.00 Cheers 3.30 Australia’s Greatest Athlete 5.30 Drive 7.30 Gene Simmons Family 9.00 The Middle 5.00 rage (PG) 6.30 Kids’ Programs 9.00 4.00 Landline Extra 4.30 One Plus 5.00 Weatherwatch 5.05 World News Roseanne 4.00 Sabrina The Teenage Thru Australia Jewels 9.30 Movie: Anger Manage- Insiders 10.00 Inside Business 10.30 One 5.00 Big Ideas 6.00 7.30 Select 6.00 Designer People Witch 4.30 Mork & Mindy 5.00 Happy 6.00 Seven News 8.30 Movie: Quantum Of ment (M 2003) US comedy. Offsiders 11.05 Asia Pacific Focus 6.30 Behind The News 7.00 ABC News 6.30 The Hairy Bikers’ Food Days 5.30 The Brady Bunch 6.30 Sunday Night Solace (M 2008) 007 action. Stars Adam Sandler 11.30 Songs Of Praise 12.00 Landline 7.30 Talking Heads: Lambis Englezos Tour Of Britain 6.00 Family Ties 7.30 Border Security Stars Daniel Craig 11.40 South Park (M) 12.10 Reno 1.00 Planet Earth 2.00 Adventures In 8.00 ABC News 9.00 Insiders 10.00 7.30 Ninja Warrior 6.30 Everybody Loves 8.00 The Force 10.50 Boston Legal (M) 12.00 Lost (M) 911 (M) 1.10 Dukes Of Hazzard 2.00 Architecture 3.00 WNBL Basketball 5.00 ABC News 10.30 Stateline Summer 8.00 Unbeatable Banzuke Raymond 8.30 Bones (M) 2.00 American Hot Rod 3.00 Magnum Home Shopping 4.00 Privileged 5.00 Art Nation 5.30 Mr Bean 5.40 Doctor 11.00 ABC News 11.30 Stateline 8.30 Tropic Of Cancer 7.30 NZ’s Next Top Model 9.30 Castle (M) PI 4.00 Wagon Train 5.00 McHale’s Green Acres Who 6.30 Wallace And Gromit 12.30 Off siders 1.00 Big Ideas 2.00 9.35 Movie: The Price To Pay (M 8.30 Smallville (M) 10.30 Serial Killers (MA) 11.30 The Navy 5.30 Deal Or No Deal 7.00 ABC News ABC News 2.30 The World This Week 2007) French comedy 10.30 Angel (M) First 48 (M) 12.30 Home Shopping GEM 3.00 ABC News 3.30 Australian Story 5.30 Seven News 11.15 Movie: Wintersleepers 12.30 Sabrina The Teenage Witch NBN 6.00 Religion 6.30 Movie: Carry On 7.30 David Attenborough’s Classic 4.00 ABC News 4.30 Behind (M 1997) German drama 1.20 1.00 Mork & Mindy 1.30 Happy Days 6.00 Infomercials 7.00 Weekend Regardless (G 1961) UK comedy. First Life Arrival The News 5.00 ABC News 5.30 Inside Weatherwatch 2.00 The Love Boat 3.00 Diagnosis 7TWO Today 10.00 Surfi ng: TransparentSea Stars Sid James 8.25 Movie: Crooks 8.30 Agatha Christie’s Miss Business 6.00 ABC News 6.30 Australian Murder 4.00 Touched By An Angel 6.00 Home And Away 8.20 Ugly Betty – David Rastovich 11.00 Kids’ Anonymous (G 1962) UK comedy. Marple (M) Story 7.00 ABC News 7.30 One Plus One 5.00 7th Heaven 9.15 Alf 9.45 Full House 10.15 Movie: Programs 12.30 Wildfi re 1.40 Movie: 10.20 Movie: 10.00 Compass Julian Morrow 8.00 Insiders 9.00 ABC News 9.30 Asia TEN Stars Leslie Phillips The Pathfi nder (PG 1953) Western. Alaska (PG 1996) US adventure. Stars Pacifi c Focus 10.00 ABC News 10.30 6.00 Religion 7.00 Kids’ Programs Bonnie Prince Charlie (G 1948) UK 10.30 Moses Jones (M) ONE HD Stars George Montgomery 12.00 Thora Birch 4.00 The Farmer Wants A The World This Week 11.00 ABC News 8.00 Meet The Press 8.30 The Hit drama. Stars David Niven 12.35 The 11.25 Gang Ways (M) 12.10 Order In Movie: Pinocchio (G 2002) Italian Wife 5.00 NBN News 5.30 Antiques 11.30 Australian Story Classic 12.00 Rater.Com 9.00 Oz Made 10.00 Hit 6.00 Match Play Championship Golf Nanny 1.05 Movie: Four For Texas The House 1.10 The Other Love 2.40 comedy. Stars Roberto Benigni 4.00 Roadshow 1.00 1.30 List TV 12.00 It’s Me Or The Dog 1.00 LIVE – Arizona (PG 1963) Western. Stars Frank Sinatra Unknown World Big Ideas BBC World News Movie: Geronimo – An American 6.00 NBN News Stateline 2.00 Big Ideas 3.00 BBC World Ironman Series Review 10.00 Quiksilver And Roxy Pro 3.30 Movie: The Cincinnati Kid (PG Legend (PG 1993) Western. Stars 6.30 Customs News 3.30 Stateline 2.00 Championship Netball Surfi ng LIVE – Gold Coast 1965) US drama. Stars Steve McQueen ABC 2 Gene Hackman 6.30 All Creatures LIVE – Melbourne Vixens v 4.00 Championship Netball 7.00 Send In The Dogs 5.30 Birds Of A Feather 6.00 Kids’ Programs LIVE – Canterbury Tactix v Great And Small Australia 6.00 The Nanny SBS 1 NSW Swifts 7.30 Bargain Hunt 7.00 At The Movies 4.00 Everybody Hates Chris 4.30 Northern Mystics 7.30 60 Minutes 6.30 Antiques Roadshow SUNDAY 27 SUNDAY 5.00 Weatherwatch 6.35 World News 8.30 Escape To The Country 7.30 Forger’s Masterclass Great Aussie Drive 5.00 H2O Just Add 6.00 NBL Basketball LIVE 8.30 The Mentalist (M) 7.30 As Time Goes By 10.30 UEFA Europa League 11.00 9.30 Live The Dream 8.00 Metropolis Bali Water 5.30 Jamie’s 30 Minute Meals – Wollongong v New 10.30 CSI: Miami (M) 8.00 Allo Allo 8.30 The Romantics Football Feature 12.00 UEFA Champions 10.30 Restaurant In Our Living Room 11.30 The Guardian (M) 12.30 Super 8.30 Underbelly Files (M) League 12.30 Speedweek 2.00 Nerds 6.00 Ten News Zealand 9.30 Art Nation 8.00 Sports Tonight 8.30 Doco: 11.30 Extreme Wife (MA) 12.30 League: St Helens v Warrington 10.30 Crime Investigation FC 2.30 Two Of Us 3.00 Who Do You 6.30 The Biggest Loser 10.00 Extras (M) Waveriders 10.00 Movie: The Minder 1.30 Movie: Pinocchio 5.00 Wolves 2.30 Danoz 3.30 Religion Australia (M) Think You Are? 5.00 Cycling Central 7.30 Modern Family 10.30 Gavin And Stacey (M) Smashing Machine (MA 2002) UFC Home Shopping 4.00 Good Morning America 5.00 11.40 Birds Of A Feather 12.10 6.00 Thalassa 8.00 Bondi Rescue 11.00 Hamish Macbeth 11.50 Bed Of action. Stars Mark Kerr 11.50 Rally Early Morning News Movie: The Cincinnati Kid 2.00 6.30 World News Australia 8.30 Hawaii Five-O (M) Roses 12.45 Deff Leppard And Taylor 11.00 NCIS: Los Angeles (M) 11.30 World 1.00 Match Play Championship 7MATE Home Shopping 4.30 Religion 5.00 Swift 1.30 Close 7.30 The Story Of The US Golf LIVE – Arizona 5.00 Grand Slam GO! Adventures In Rainbow Country 8.30 Dateline Movie: The Tailor Of Panama (M 6.00 Wagon Train 7.00 The Virginian Champions Golf Clinic 6.00 12.00 5.30 Today 9.30 WikiRebels 2001) US drama. Stars Pierce Brosnan 8.30 McHale’s Navy 9.00 Million Kids’ Programs The Hills 12.30 Cribs 1.00 Pro Surfi ng: Brazil ABC 3 10.35 John Adams (M) 11.45 Movie: 1.30 Infomercials 4.00 Religion Dollar Catch 9.30 V8 Xtra 10.00 2.00 Here’s Lucy 2.30 Green Acres Confi dence is food for the wise man 6.05am to 5.30pm Kids’ Programs A Fond Kiss (MA 2003) UK drama 1.35 PRIME Movie: Spy Hard (PG 1996) US 3.30 The Dukes Of Hazzard 4.30 and liquor for the fool 6.00 Dani’s House 6.30 My Life As Weatherwatch ELEVEN 6.00 Religion 7.00 Weekend Sunrise comedy. Stars Leslie Nielsen 12.00 Magnum PI 1.00 Australia’s Greatest Privileged 5.30 Wipeout USA A Popat 6.55 Jinx 7.25 The Latest 6.00 Jag 7.00 MacGyver 8.00 The 10.00 World’s Strictest Parents 11.00 Buzz 7.50 The Wannabes 8.15 Minute To Win It 12.00 It’s Academic Athlete 2.00 Car Sharks 2.30 Fifth 6.30 Top Gear Brady Bunch 8.30 Everybody Loves Gear 3.00 American Hot Rod 4.00 7.30 The Big Bang Theory Majority Rules 8.40 Degrassi: The Raymond 9.00 Touched By An Angel 12.30 Movie: Good Boy! (G 2003) Next Generation 9.00 Close Animation 2.20 Movie: K-9 (PG 1989) Monster Garage 5.00 The Drew Carey 8.00 The Middle 10.00 7th Heaven 11.00 The Love Show 5.30 According To Jim
The Brady Bunch drama. Stars Lea Thompson 2.00 Dr Airwolf 2.00 Baywatch 3.00 Xena 1.30 The Hills 2.00 Privileged 3.00 ABC 1 ABC NEWS 24 SBS 2 6.00 Family Ties Oz 3.00 Kids’ Programs 4.30 Seven Warrior Princess 4.00 Hercules 5.00 Just Shoot Me 3.30 Kids’ Programs 4.00 Hymns Of Glory 4.30 The Cook 4.00 ABC News 4.05 Big Ideas 5.00 5.00 Weatherwatch 6.00 World News 6.30 Neighbours News 5.30 Deal Or No Deal The Drew Carey Show 5.30 According 6.00 Seinfeld And The Chef 5.00 Something In The ABC News 5.15 The Quarters 5.30 6.00 Global Village 7.00 Everybody Loves 6.00 Prime News To Jim 6.30 The Middle Air 5.30 The New Inventors 6.00 Kids’ 7.30 Select 6.00 ABC News Breakfast 6.30 Come Dine With Me Raymond 6.30 Seven News 6.30 Scrubs 7.00 Australia’s Funniest Home Programs 12.00 Midday Report 12.30 9.00 ABC News 9.30 Business Today 7.30 Why Do Viruses Kill? 7.30 Futurama 7.00 Home And Away 7.00 That ’70s Show Videos Pride And Prejudice 1.30 An Island 10.00 ABC News 12.00 Midday 8.30 Death Of The Oceans? 8.30 Supernatural (M) 7.30 My Kitchen Rules 7.30 How I Met Your Mother 7.30 Movie: Bring It On (PG Parish 2.00 Parliament Question Time Report 12.30 Inside Business 1.00 9.30 The World Game 9.30 Dexter (AV) 8.30 Bones (M) 8.30 Family Guy (M) 2000) US comedy. Stars 3.00 Kids’ Programs ABC News 2.00 Question Time 3.30 10.30 Movie: Grave Of The 10.40 The Late Late Show 11.30 9.30 Brothers & Sisters (M) 9.00 American Dad (M) Kristen Dunst Afternoon Live 5.30 7.30 Select 6.00 6.00 My Family Firefl ies (M 1988) Cheers 12.00 Roseanne 12.30 10.30 Fat Family Diet 9.30 Family Guy (M) 9.30 The Vampire Diaries (AV) ABC News 6.05 The Drum 6.45 The Sabrina The Teenage Witch 1.00 11.30 My Shocking Story 12.30 10.00 American Dad 6.30 Best Of Collectors Japanese animation 10.30 Two And A Half Men (M) Quarters 7.00 ABC News 7.30 The Mork & Mindy 1.30 Happy Days Parks And Recreation (M) 1.00 Home 10.30 Scrubs 11.30 12.00 7.00 ABC News 12.10 Weatherwatch South Park (M) Pushing 7.30 The 7.30 Report 7.30 Report 8.00 ABC News 8.30 2.00 The Love Boat 3.00 Diagnosis Shopping 5.30 Seven News 11.30 CNNNN (M) 12.00 Quincy Daisies 1.00 The Vampire Diaries (AV) 8.00 Australian Story Lateline Business 9.00 The World TEN Murder 4.00 Touched By An Angel ME 1.00 Airwolf 2.00 Magnum PI 2.00 Home Shopping 4.00 Just Shoot 8.30 Four Corners 9.30 Q&A 10.30 ABC News 11.00 5.00 7th Heaven 7TWO 3.00 Hercules 4.00 Baywatch 5.00 Me 4.30 TMZ 5.00 Get Smart 5.30 The Drum 11.45 The Quarters 12.00 6.00 Ten Early News 7.00 Kids’ 9.15 Media Watch 6.00 Kids Time 9.30 Shortland Street McHale’s Navy 5.30 Deal Or No Deal The Flintstones ABC News 12.30 Lateline 1.00 BBC Programs 9.00 Ten News 10.00 9.35 Q&A ONE HD 10.00 Coronation Street 10.30 News 1.30 Australia Network News The Circle 12.00 Dr Phil 1.00 10.30 Lateline 6.00 Match Play Championship Golf Emmerdale 11.00 Hollyoaks 11.30 NBN GEM 2.00 BBC World News 2.30 The 7.30 Oprah Winfrey Show 2.00 Ready 11.05 Lateline Business 11.35 Wire LIVE – Arizona Passport To The Sun 12.00 Murphy Report 3.00 Lateline 3.35 Lateline Steady Cook 3.00 Judge Judy 3.30 5.30 Today 9.00 Kerri-Anne 11.00 6.00 Today 9.00 Alive & Cooking In The Blood (M) 1.05 The Clinic (M) Brown 12.30 Desperate Housewives Business Infomercial 4.00 Good Chef Bad Chef 10.00 Quiksilver And Roxy Pro Infomercials 11.30 Hi-5 9.30 The Zoo 10.00 The Nanny 2.00 Parliament Question Time 3.00 1.30 2.30 4.30 The Bold And The Beautiful 5.00 Surfi ng LIVE – Gold Coast (M) Grey’s Anatomy (M) 12.00 Academy Awards LIVE 10.30 Friends 11.00 Murder, She Australian Open Bowls SBS 1 Ten News 4.00 Sports Unlimited 5.00 Cliff Movie: Down To Earth (G 1947) US from Hollywood Wrote 12.00 Movie: Returning Lily 6.00 6pm With George Negus Diving comedy. Stars Rita Hayworth 4.30 4.00 Kitchen Whiz 4.30 Afternoon (PG 2003) US drama. Stars Virginia 5.00 Weatherwatch 5.05 World Welcome Back Kotter 5.00 Head Of ABC 2 6.30 Ten News 5.30 Championship Netball News 5.30 Hot Seat Madsen 2.00 Canal Road (M) 3.00 News 1.00 Food Lovers’ Guide To LIVE – Central Pulse v The Class 5.30 Growing Pains 6.00 NBN News McLeod’s Daughters 4.00 As Time 5.30 Can We Help? 6.00 ABC News Australia 1.30 Dateline 2.30 Insight 7.00 The 7pm Project MONDAY 28 MONDAY Breakfast 9.00 Kids’ Programs 7.30 Glee Waikato-Bay Of Plenty 6.00 Bargain Hunt 7.00 A Current Aff air Goes By 4.30 Allo Allo 5.00 The Ellen 3.30 Letters And Numbers 4.00 The Magic 7.00 The Benny Hill Show 7.30 Two And A Half Men Degeneres Show 6.00 The Nanny 7.00 Spicks And Specks Journal 4.30 Futbol Mundial 5.00 The 8.30 House (M) 7.30 Goodwood Festival Of Speed 7.30 Heartbeat 8.00 My Dad Says 6.30 Friends 7.30 Full Metal Challenge Crew 5.30 Global Village 9.30 Good News Week (M) 8.30 The Pro Shop 9.30 Sports 8.30 Jonathan Creek (M) 7.00 The Zoo 8.00 Absolutely Fabulous 6.00 Letters And Numbers 10.30 6pm With George Negus 11.00 8.25 Lotto Tonight 9.40 Maisie Raine (M) 8.00 Animal Emergency 8.30 Rake (M) 6.30 World News Australia Late News With Sports Tonight 11.30 8.30 This Is Your Life Debora- 10.00 Championship Netball 10.50 The Sweeney (M) 11.50 Last 8.30 The Closer (M) 9.30 Generation Kill (M) 7.30 Mythbusters Late Show 12.30 Ally McBeal (M) 1.30 Lee Furness LIVE – West Coast Fever v Man Standing (M) 12.50 Movie: 9.30 Movie: Silence Of The 10.35 Teachers (MA) 11.25 Being 8.30 Man v Wild Infomercials 4.00 Religion 9.40 Academy Awards Replay Queensland Firebirds Down To Earth 2.45 Dr Oz 3.40 Lambs (AV 1991) US thrill- Erica 12.10 Love Soup 12.40 Home 9.30 World News Australia 12.30 Super Rugby Extra Time 12.00 Sports Tonight Late 12.15 Passport To The Sun 4.05 Coronation 1.30 er. Stars Jodie Foster Time (M) 1.10 Coach Trip 1.35 Close 10.00 Ugly Americans (M) ELEVEN Super League: Crusaders RL v NASCAR Sprint Cup 3.15 Omnisport Street 4.30 Emmerdale 5.00 Home Bradford Bulls 2.30 Infomercials 3.30 12.00 Friends 12.30 The Zoo 1.00 10.30 Dead Set (MAV) 6.00 Jag 7.00 MacGyver 8.00 The 3.45 Ironman Series Review 4.45 Shopping Good Morning America 5.00 Early Murder, She Wrote 2.00 Home ABC 3 11.00 The Mighty Boosh (M) 11.30 Brady Bunch 8.30 Neighbours 9.00 Serie A Football Morning News Shopping 4.30 Religion 5.00 6.05am to 5.30pm Kids’ Programs The World Game 12.30 Movie: Touched By An Angel 10.00 7th 7MATE Adventures In Rainbow Country 6.00 Trapped! 6.30 Prank Patrol Curandero (MAV 2005) US horror Heaven 11.00 The Love Boat 12.00 PRIME 5.30 Today International 7.05 What Do You 2.15 Weatherwatch Diagnosis Murder 1.00 Jag 2.00 6.00 Wagon Train 7.00 The Virginian GO! Know? 7.35 My Life As A Popat 8.05 MacGyver 3.00 Cheers 3.30 Roseanne 6.00 Sunrise 9.00 The Morning Show 8.30 McHale’s Navy 9.00 NBC Today 6.00 Kids’ Programs 10.30 ET 11.00 Dani’s House 8.35 Degrassi: The Next 4.00 Sabrina The Teenage Witch 4.30 11.30 Morning News 12.00 Movie: 10.00 NBC Meet The Press 11.00 TMZ 11.30 Get Smart 12.00 Here’s Generation 9.00 Close Mork & Mindy 5.00 Happy Days 5.30 Til Death Do Us Part (M 2005) US Quincy ME 12.00 Magnum PI 1.00 Lucy 12.30 Green Acres 1.00 Seinfeld
International 7.05 What Do You 3.00 Weatherwatch 4.00 Sabrina The Teenage Witch 4.30 6.30 Seven News Xena Warrior Princess 4.00 Hercules 6.30 The Middle ABC 1 Know? 7.35 My Life As A Popat 8.05 Mork & Mindy 5.00 Happy Days 5.30 7.00 Home And Away 5.00 The Drew Carey Show 5.30 7.00 Australia’s Funniest Home 4.00 Sleuth 101 4.30 The Cook And Dani’s House 8.35 Degrassi: The Next SBS 2 The Brady Bunch 6.00 Family Ties 7.30 My Kitchen Rules According To Jim Videos Generation 9.00 Close 6.30 Scrubs The Chef 5.00 Something In The Air 5.00 Weatherwatch 6.00 World News 6.30 Neighbours 8.30 Packed To The Rafters 7.30 Hellcats 7.00 That ’70s Show 5.30 The New Inventors 6.00 Kids’ 6.00 Global Village 7.00 Everybody Loves 9.30 Conviction Kitchen 8.30 Pretty Little Liars (M) 7.30 How I Met Your Mother Programs 11.00 Big Ideas 12.00 ABC NEWS 24 6.30 Come Dine With Me Raymond 10.30 Cougar Town (M) 9.30 Movie: Blades Of Glory (M 8.30 Family Guy (M) Midday Report 12.30 Time Team 4.00 ABC News 4.05 The Quarters 7.30 Lost Worlds The Siege of 7.30 The Simpsons 11.00 Keeping Up With The 2007) US comedy. Stars Will 1.30 Meerkat Manor 2.00 Parliament 4.20 The Drum 5.00 ABC News 5.15 8.00 Futurama Kardashians (M) 11.30 10 Years 9.00 American Dad (M) Ferrell Vienna 9.30 Family Guy (M) Question Time 3.00 Kids’ Programs The Quarters 5.30 Newsline 6.00 8.30 As It Happened: Nazi 8.30 The Offi ce Younger 12.00 Mercy (M) 1.00 Home 11.30 South Park (M) 12.00 Reno 911 6.00 My Family ABC News Breakfast 9.00 ABC News 9.30 Nurse Jackie (M) Shopping 5.30 News 10.00 My Name Is Earl (M) 1.00 Pretty Little Liars (M) 2.00 Number One (M) 11.00 Scrubs 12.00 Quincy ME 6.30 Best Of Collectors 9.30 Business Today 10.00 ABC News 9.30 Movie: After The Wedding 10.05 Californication (MA) 10.40 Home Shopping 4.00 Just Shoot Me 11.30 1.00 Airwolf 2.00 Magnum PI 7.00 ABC News 12.00 Midday Report 12.30 Newsline (M 2006) Danish drama The Late Late Show Cheers 7TWO 4.30 TMZ 5.00 Get Smart 5.30 The 12.00 Roseanne 12.30 Sabrina The 3.00 Hercules 4.00 Baywatch 5.00 7.30 The 7.30 Report 1.00 ABC News 2.00 Question Time 11.35 Movie: Go In Peace, Jamil 6.00 Kids Time 9.30 Shortland Street Flintstones Teenage Witch 1.00 Mork & Mindy McHale’s Navy 5.30 Deal Or No Deal 8.00 Foreign Correspondent 3.30 Afternoon Live 5.30 Stateline (MAV 2008) Danish drama 1.10 10.00 Coronation Street 10.30 1.30 Happy Days 2.00 The Love Boat 8.30 Queensland Floods Select 6.00 ABC News 6.05 The Drum Weatherwatch Emmerdale 11.00 Hollyoaks 11.30 GEM 3.00 Diagnosis Murder 4.00 Touched NBN Special 6.45 The Quarters 7.00 ABC News Passport To The Sun 12.00 Murphy 6.00 Today 9.00 Alive & Cooking By An Angel 5.00 7th Heaven 9.30 QI 7.30 The 7.30 Report 8.00 ABC News TEN Brown 12.30 Desperate Housewives 5.30 Today 9.00 Kerri-Anne 11.00 9.30 The Zoo 10.00 The Nanny 10.30 10.05 First Tuesday Book Club 8.30 Lateline Business 9.00 The World (M) 1.30 Grey’s Anatomy (M) 2.30 Danoz 12.00 The Ellen Degeneres 11.00 6.00 Kids’ Programs 9.00 Ten News Friends Murder, She Wrote 10.35 Lateline 11.10 Lateline 10.00 ABC News 10.05 The Drum ONE HD Movie: The Pirates Of Blood River Show 1.00 The View 2.00 Days Of 12.00 Movie: Best Pair Of Legs In 10.00 The Circle 12.00 Dr Phil 1.00 Business 11.40 Four Corners 12.25 10.45 The Quarters 11.00 ABC News 6.45 Serie A Football LIVE – AC Milan (PG 1962) UK action. Stars Kerwin Our Lives 3.00 Alive And Cooking The Business Oprah Winfrey Show 2.00 Ready (M 1973) UK comedy. Media Watch 12.40 TBA 1.30 11.30 Newsline 12.00 ABC News v Napoli Mathews 4.30 Welcome Back Kotter 3.30 Hi-5 4.00 Kitchen Whiz 4.30 Stars Reg Varney 2.00 Canal Road (M) 12.30 1.00 1.30 Steady Cook 3.00 Judge Judy 3.30 Parliament Question Time 2.30 Lateline BBC News 8.35 Quiksilver And Roxy Pro 5.00 Head Of The Class 5.30 Growing Afternoon News 5.30 Hot Seat 3.00 McLeod’s Daughters 4.00 The Australia Network News 2.00 BBC Infomercial 4.00 Good Chef Bad Chef Catalyst 3.00 Big Ideas Surfi ng LIVE – Gold Coast Pains 6.00 NBN News Zoo 4.30 Animal Emergency 5.00 World News 2.30 The 7.30 Report 4.30 The Bold And The Beautiful 5.00 4.00 Sports Unlimited 5.00 Pro 6.00 Bargain Hunt 7.00 A Current Aff air The Ellen Degeneres Show 3.00 Lateline 3.35 Lateline Business Ten News ABC 2 Bull Riding 6.00 Escape With ET 7.00 The Benny Hill Show 7.30 The Big Bang Theory 6.00 The Nanny TUESDAY 1 TUESDAY 6.00 6pm With George Negus 8.00 Top Gear 5.30 Can We Help? 6.00 ABC News 6.30 Ten News 7.00 Sports Tonight 7.30 Ice Road 7.30 Some Mothers Do ’ave ’em 6.30 Friends SBS 1 Truckers 8.30 Ax Men 9.30 Black 9.30 Ben Elton Live From Breakfast 9.00 Kids’ Programs 7.00 The 7pm Project 8.10 Are You Being Served? 7.00 The Zoo 5.00 Weatherwatch 5.05 World News Gold 10.30 World Football News Planet Earth (M) 7.00 Spicks And Specks 7.30 Talking’ ’Bout Your 8.50 To The Manor Born 7.30 Neighbours At War 1.00 Movie: Blue Gate Crossing (PG 11.00 Sports Tonight Late 11.15 9.30 Porridge 10.30 Kitchen Nightmares (MA) 11.30 8.00 How Clean Is Your House 7.30 In Search Of Perfection Generation Til Death 12.00 World Club Challenge 2002) Taiwanese drama 3.00 Taxi Arsenal Football 2.15 Omnisport 10.10 Hale And Pace 10.45 Movie: 8.30 Hoarders 8.00 Black Books 8.40 NCIS (M) Rugby League: Wigan Warriors v St School 3.30 Letters And Numbers 2.45 Championship Netball – NSW Carry On Up The Jungle (PG 1970) 8.30 Good Game 10.40 6pm With George Negus 11.10 George Illawarra Dragons 2.00 9.30 The Closer (M) 4.00 The Journal 4.30 Newshour 5.30 Swifts v Melbourne Vixens 4.45 World 12.40 9.00 The Librarians Late News With Sports Tonight 11.40 UK comedy. Stars Sid James The Infomercials 3.30 Good Morning 11.30 Friends 12.00 Hoarders 1.00 Global Village Tour Beach Volleyball 5.15 ATP World 1.40 Movie: The Pirates 9.30 Whitest Kids U Know (M) The Late Show 12.35 Ally McBeal (M) Palace (M) America 5.00 Early Morning News The Closer (M) 2.00 Home Shopping 6.00 Letters And Numbers Tour Tennis 5.45 Omnisport Of Blood River 3.30 10.00 Generation Kill (M) 1.30 Infomercials 4.00 Religion Passport To The 4.30 Religion 5.00 Adventures In 6.30 World News Australia Sun 4.00 Coronation Street 4.30 Rainbow Country 5.30 Today 11.05 Little Miss Jocelyn (M) 11.30 7.30 Insight GO! Black Books 12.00 30 Seconds (M) PRIME Emmerdale 5.00 Home Shopping 8.30 Wonders Of The Solar ELEVEN 6.00 Kids’ Programs 10.30 12.20 Later… With Jools Holland 1.20 6.00 Sunrise 9.00 The Morning Show Today, like all days, you will breath System Entertainment Tonight 11.00 TMZ Coach Trip 1.45 Close 6.00 Jag 7.00 MacGyver 8.00 The 11.30 Morning News 12.00 Lewis (M) 7MATE just under 20,000 breaths a day. They 9.30 World News Australia Brady Bunch 8.30 Neighbours 9.00 11.30 Get Smart 12.00 Here’s Lucy 2.00 Dr Oz 3.00 The Zoo 3.30 Kids’ 6.00 Wagon Train 7.00 The Virginian don’t tell you that on TV. 10.05 Hot Docs Marilyn: The Last Touched By An Angel 10.00 7th 12.30 Green Acres 1.00 Seinfeld 1.30 Programs 4.30 Seven News 5.30 Deal 8.30 McHale’s Navy 9.00 NBC Today ABC 3 Sessions (M) 11.00 12.00 The Hills 2.00 Pushing Daisies 3.00 Heaven The Love Boat Or No Deal 11.00 Quincy ME 12.00 Magnum 6.05am to 5.30pm Kids’ Programs 11.50 Movie: Captive (MA 2008) Just Shoot Me 3.30 Kids’ Programs Diagnosis Murder 1.00 Jag 2.00 6.00 Prime News PI 1.00 Airwolf 2.00 Baywatch 3.00 6.00 Trapped! 6.30 Prank Patrol Russian drama 1.20 Manda Bala (M) MacGyver 3.00 Cheers 3.30 Roseanne 6.00 Seinfeld www.tweedecho.com.au Th e Tweed Shire Echo February 24, 2011 15 Dani’s House 8.35 Degrassi: The Next 6.00 Family Ties 6.30 Seven News 9.00 American Dad 8.30 V (M) ABC 1 Generation 9.00 Close SBS 2 6.30 Neighbours 7.00 Home And Away 9.30 Movie: Starship Troopers 9.30 Fringe (M) 4.00 Talking Heads: Mark Holden 5.00 Weatherwatch 6.00 World News 7.00 Everybody Loves 7.30 My Kitchen Rules (AV 1997) US action. Stars 11.30 South Park (MA) 12.00 Seinfeld 4.30 The Cook And The Chef 5.00 ABC NEWS 24 6.00 Global Village Raymond 9.00 Criminal Minds (M) Casper Van Dien 1.00 V (M) 2.00 Home Shopping 4.00 Something In The Air 5.30 The New 4.00 ABC News 4.05 The Quarters 6.30 Come Dine With Me 7.30 The Simpsons 10.00 City Homicide (M) 12.30 Strikeforce (M) 1.00 Airwolf Just Shoot Me 4.30 TMZ 5.00 Get Inventors 6.00 Kids’ Programs 11.00 4.20 The Drum 5.00 ABC News 5.15 7.30 Dateline 8.00 Futurama 11.00 I Shouldn’t Be Alive (M) 12.00 2.00 Baywatch 3.00 Home Shopping Smart 5.30 The Flintstones Big Ideas 12.00 Midday Report 12.30 The Quarters 5.30 Newsline 6.00 8.30 Immigration Nation 8.30 The Simpsons Parks And Recreation (M) 12.30 Home 4.00 NBC Today 5.00 McHale’s Navy National Press Club Address 1.30 ABC News Breakfast 9.00 ABC News 9.30 Movie: Johnny Mad Dog 9.00 The Cleveland Show Shopping 5.30 Seven News 5.30 Deal Or No Deal GEM Ben’s Zoo 2.00 Parliament Question 9.30 Business Today 10.00 ABC News (MAV 2008) French drama 9.30 Bob’s Burgers 6.00 Today 9.00 Alive & Cooking Time 3.00 Kids’ Programs 12.00 Midday Report 12.30 Newsline 11.15 Movie: Whisky Romeo Zulu 10.00 King Of The Hill 7TWO NBN 9.30 The Zoo 10.00 The Nanny 6.00 My Family 1.00 ABC News 2.00 Question Time (PG 2004) Argentinian drama 1.10 10.30 The Late Late Show 11.30 6.00 Kids Time 9.30 Shortland Street 5.30 Today 9.00 Kerri-Anne 11.00 10.30 Friends 11.00 Murder, She 6.30 Best Of Collectors 3.30 Afternoon Live 5.30 Landline Weatherwatch Cheers 12.00 Roseanne 12.30 10.00 Coronation Street 10.30 Danoz 12.00 The Ellen Degeneres Wrote 12.00 Movie: Alex & Emma (M 7.00 ABC News Extra 6.00 ABC News 6.05 The Drum Sabrina The Teenage Witch 1.00 Emmerdale 11.00 Hollyoaks 11.30 Show 1.00 The View 2.00 Days Of 2003) US romance. Stars Kate Hudson 7.30 The 7.30 Report 6.45 The Quarters 7.00 ABC News TEN Mork & Mindy 1.30 Happy Days Passport To The Sun 12.00 Murphy Our Lives 3.00 Alive And Cooking 2.00 Canal Road (M) 3.00 McLeod’s 2.00 The Love Boat 3.00 Diagnosis 8.00 The New Inventors 7.30 The 7.30 Report 8.00 ABC News 6.00 Kids’ Programs 9.00 Ten News Brown 12.30 Desperate Housewives 3.30 Hi-5 4.00 Kitchen Whiz 4.30 Daughters 4.00 Neighbours At War Murder 4.00 Touched By An Angel 8.30 Adam Hills In Gordon St 8.30 Lateline Business 9.00 The World 10.00 The Circle 12.00 Dr Phil 1.00 (M) 1.30 Grey’s Anatomy (M) 2.30 Afternoon News 5.30 Hot Seat 4.30 How Clean Is Your House 5.00 5.00 7th Heaven Tonight 10.00 ABC News 10.05 The Drum Oprah Winfrey Show 2.00 Ready Movie: Tulsa (PG 1949) US drama. 6.00 NBN News The Ellen Degeneres Show 9.30 Laid (M) 10.45 The Quarters 11.00 ABC News Steady Cook 3.00 Judge Judy 3.30 Stars Susan Hayward 4.30 Welcome 7.00 A Current Affair 6.00 The Nanny 10.00 At The Movies 11.30 Newsline 12.00 ABC News Infomercials 4.00 Good Chef Bad Chef ONE HD Back Kotter 5.00 Head Of The Class 7.30 The Big Bang Theory 6.30 Friends 10.30 Lateline 12.30 Lateline 1.00 BBC News 1.30 4.30 The Bold And The Beautiful 5.00 6.00 NASCAR Sprint Cup – Phoenix 5.30 Growing Pains 8.00 Mike & Molly 7.00 The Zoo 11.05 Lateline Business 11.30 Brat Australia Network News 2.00 BBC Ten News 7.00 World Football News 7.30 The 6.00 Bargain Hunt 8.25 Lotto 7.30 As Time Goes By Camp (M) 12.30 Parliament Question World News 2.30 The 7.30 Report 6.00 6pm With George Negus Pro Shop 7.00 The Benny Hill Show 8.30 The Farmer Wants A Wife 8.00 The Golden Girls Time 1.30 Behind The Headlines 2.30 3.00 Lateline 3.35 Lateline Business 6.30 Ten News 8.30 Quiksilver And Roxy Pro 7.30 Heartbeat 9.30 RPA Where Are They Now? 8.30 Movie: Ali (M 2001) US The Cook And The Chef 3.00 Big Ideas 7.00 The 7pm Project SurfingLIVE – Gold Coast 8.40 Pie In The Sky 10.30 Embarrassing Bodies (M) biography. Stars Will Smith SBS 1 7.30 The Biggest Loser 4.00 ASP World Tour Surfing 5.00 9.45 Murphy’s Law (M) 11.30 Til Death 12.00 The Strip (M) 11.35 Conan (M) 12.30 Murder, She ABC 2 5.00 Weatherwatch 5.05 World News 8.30 Blue Bloods (M) Cold Water Classic Surfing 5.30 12.00 Minder (M) 1.00 Passport To 1.00 Entertainment Tonight 1.30 Wrote 1.25 As Time Goes By 2.00
WEDNESDAY 2 WEDNESDAY Infomercials 3.30 Good Morning Home Shopping 4.30 Religion 5.00 5.30 Can We Help? 6.00 ABC News 1.00 Movie: Doo Wop (M 2004) 9.30 Lie To Me (M) Xtreme Paintball 6.00 Escape With The Sun 1.30 Coronation Street 2.00 America 5.00 Early Morning News Adventures In Rainbow Country Breakfast 9.00 Kids’ Programs French drama 2.35 Water Boy 2.45 10.30 6pm With George Negus ET 7.00 Sports Tonight 7.30 Extreme Emmerdale 2.30 Medical Rookies 8.30 Movie: The Marine 3.00 4.00 5.30 Today 7.00 Spicks And Specks Animal Farm 3.00 Help 3.30 Letters 11.00 Late News With Sports Tonight Fishing Home Shopping NBC Today And Numbers 4.00 The Journal 4.30 11.30 Overtime 12.30 The Late Show (M 2006) US action 10.20 Sports 5.00 Home Shopping GO! 7.30 River Monsters Reality is a crutch for people who Newshour 5.30 Global Village 1.30 Infomercials 4.00 Religion Tonight Late 10.35 Overtime 11.35 6.00 Kids’ Programs 10.30 8.30 Blood, Sweat And T-Shirts NBA Basketball 1.35 NBL Basketball can’t handle drugs. 10.30 Brat Camp (M) 6.00 Letters And Numbers 7MATE Entertainment Tonight 11.00 TMZ 6.30 World News Australia ELEVEN 3.30 Omnisport 4.00 NAB Cup AFL 6.00 Wagon Train 7.00 The Virginian 11.30 Get Smart 12.00 Here’s Lucy 11.20 Just To Get A Rep (M) 12.15 – Qualifying Final What Would Happen If… 12.40 7.30 Rex In Rome 6.00 Jag 7.00 MacGyver 8.00 The 8.30 McHale’s Navy 9.00 NBC Today 12.30 Green Acres 1.00 Seinfeld Whatever! The Science Of Teens 1.10 8.30 Big Love (M) Brady Bunch 8.30 Neighbours 9.00 PRIME 11.00 Quincy ME 12.00 Magnum 1.30 The Hills 2.00 Starsky & Hutch Coach Trip 1.30 Close 9.30 World News Australia Touched By An Angel 10.00 7th PI 1.00 Airwolf 2.00 Baywatch 3.00 (M) 3.00 Just Shoot Me 3.30 Kids’ 10.05 Movie: A Mighty Heart (M Heaven 11.00 The Love Boat 12.00 6.00 Sunrise 9.00 The Morning Show Xena Warrior Princess 4.00 Hercules Programs ABC 3 2007) US biography Diagnosis Murder 1.00 Jag 2.00 11.30 Morning News 12.00 Colombo 5.00 The Drew Carey Show 5.30 6.00 Seinfeld 12.00 Movie: The Flower Of Evil 2.00 Dr Oz 3.00 The Zoo 3.30 Kids’ According To Jim 6.30 Scrubs 6.30 The Middle 6.05am to 5.30pm Kids’ Programs MacGyver 3.00 Cheers 3.30 Roseanne (M 2003) French black comedy 1.50 4.00 4.30 Programs 4.30 Seven News 5.30 Deal 7.00 That ’70s Show 7.00 Australia’s Funniest Home 6.00 Trapped! 6.30 Prank Patrol Sabrina The Teenage Witch Weatherwatch 5.00 5.30 Or No Deal 7.30 How I Met Your Mother Videos International 7.05 What Do You Mork & Mindy Happy Days The Brady Bunch 6.00 Prime News 8.30 Family Guy (M) 7.30 Top Gear Know? 7.35 My Life As A Popat 8.05
PLEASE NOTE: The Echo takes great care producing this guide, but unfortunately TV stations like to tinker with things at the last minute and sometimes make changes after we have gone to print.
Know? 7.35 My Life As A Popat 8.05 (M 2005) French drama 2.10 MacGyver 3.00 Cheers 3.30 Roseanne The Zoo 3.30 Kids’ Programs 4.30 PI 1.00 Airwolf 2.00 Baywatch 3.00 6.00 Seinfeld ABC 1 Dani’s House 8.35 Degrassi 9.00 Close Weatherwatch 4.00 Sabrina The Teenage Witch 4.30 Seven News 5.30 Deal Or No Deal Xena Warrior Princess 4.00 Hercules 6.30 The Middle 4.00 National Press Club Address 5.00 Mork & Mindy 5.00 Happy Days 5.30 6.00 Prime News 5.00 The Drew Carey Show 5.30 7.00 Funniest Home Videos Something In The Air 5.30 The New ABC NEWS 24 SBS 2 The Brady Bunch 6.30 Seven News According To Jim 7.30 The Big Bang Theory Inventors 6.00 Kids’ Programs 12.00 4.00 ABC News 4.05 The Quarters 5.00 Weatherwatch 6.00 World News 6.00 Family Ties 7.00 Home And Away 6.30 Scrubs 8.00 The Middle Midday Report 12.30 Lost In Austen 4.20 The Drum 5.00 ABC News 5.15 6.00 Global Village 6.30 Neighbours 7.30 How I Met Your Mother 7.00 That ’70s Show 8.30 The Big Bang Theory 1.30 Echo Beach 2.00 Parliament The Quarters 5.30 Newsline 6.00 6.30 Come Dine With Me 7.00 Everybody Loves 8.30 Grey’s Anatomy (M) 7.30 Mighty Ships 9.00 The Inbetweeners (MA) Question Time 3.00 Kids’ Programs ABC News Breakfast 9.00 ABC News 7.30 Insight Raymond 9.30 Desperate Housewives (M) 8.30 Megastructures 9.30 Movie: Scary Movie (MA 6.00 My Family 9.30 Business Today 10.00 ABC News 8.30 I.M. Pei Building China 7.30 The Simpsons 10.30 Private Practice (M) 9.30 Gangs Of Oz (M) 2000) US thriller. Stars 6.30 Best Of Collectors 12.00 Midday Report 12.30 Newsline Modern 8.30 Stargate Universe 11.30 30 Rock (M) 12.00 The Whistle- 11.30 The Sopranos (MA) 12.30 Shawn Wayans 7.00 ABC News 1.30 ABC News 2.00 Question Time 9.30 Movie: The Motorcycle 9.30 Star Trek – Next blowers (M) 1.00 Home Shopping Strikeforce (M) 1.00 Airwolf 2.00 11.20 South Park (MA) 11.50 The Magnum PI (M) 3.00 Hercules 4.00 7.30 The 7.30 Report 3.30 Afternoon Live 5.30 The World Diaries (M 2004) Generation 5.30 Seven News Inbetweeners (MA) 12.20 The Middle 8.00 Catalyst This Week 6.00 ABC News 6.05 The 10.30 The Late Late Show Baywatch 5.00 McHale’s Navy 5.30 12.50 Mad 1.00 Fringe (M) 2.00 Argentinian drama Deal Or No Deal 8.30 Ashes To Ashes (M) Drum 6.45 The Quarters 7.00 ABC 11.40 Movie: A Loving Father (MA 11.30 Cheers 12.00 Roseanne 12.30 7TWO Home Shopping 4.00 Just Shoot Me 9.30 Grand Designs News 7.30 The 7.30 Report 8.00 ABC 2003) French drama. Stars Gerard Sabrina 1.00 Mork & Mindy 1.30 6.00 Kids Time 9.30 Shortland Street 4.30 TMZ 5.00 Get Smart 5.30 The 10.20 Lateline News 8.30 Lateline Business 9.00 The Depardieu 1.30 Weatherwatch Happy Days 2.00 The Love Boat 3.00 10.00 Coronation Street 10.30 NBN Flintstones 10.55 Lateline Business 11.20 World 10.00 ABC News 10.05 The Diagnosis Murder 4.00 Touched By Emmerdale 11.00 Hollyoaks 11.30 5.30 Today 9.00 Kerri-Anne 11.00 Spectacle 12.10 They Can’t Hang Drum 10.45 The Quarters 11.00 TEN An Angel 5.00 7th Heaven Passport To The Sun 12.00 Murphy Danoz 12.00 The Ellen Degeneres GEM Me 1.25 Parliament Question Time ABC News 11.30 Newsline 12.00 Brown 12.30 Desperate Housewives Show 1.00 The View 2.00 Days Of 6.00 Kids’ Programs 9.00 Ten News 6.00 Today 9.00 Alive & Cooking 2.25 Movie: Women Of Twilight (PG ABC News 12.30 Lateline 1.00 BBC ONE HD (M) (M) 1.30 Grey’s Anatomy (M) 2.30 Our Lives 3.00 Alive And Cooking 10.00 The Circle 12.00 Dr Phil 1.00 9.30 The Zoo 10.00 The Nanny 10.30 1952) UK drama. Stars Freda Jackson News 1.30 Australia Network News Movie: Edge Of Eternity (PG 1959) 3.30 Hi-5 4.00 Kitchen Whiz 4.30 Oprah Winfrey Show 2.00 Ready 6.00 Rally World 7.00 Serie A Football Friends 11.00 Murder, She Wrote 2.00 BBC World News 2.30 The 7.30 US drama. Stars Cornel Wilde 4.30 Afternoon News 5.30 Hot Seat Steady Cook 3.00 Judge Judy 3.30 7.30 Bundesliga Football 12.00 Movie: Everyday People Report 3.00 Lateline 3.35 Lateline Welcome Back Kotter 5.00 Head Of 6.00 NBN News ABC 2 Infomercials 4.00 Good Chef Bad Chef 8.30 Quiksilver And Roxy Pro (M 2004) US drama. Stars Nathan Business The Class 5.30 Growing Pains 7.00 A Current Affair 5.30 Can We Help? 6.00 ABC News 4.30 The Bold And The Beautiful 5.00 SurfingLIVE – Gold Coast De’Shon Myers 2.00 Canal Road (M) Breakfast 9.00 Kids’ Programs Ten News 4.00 Cape To Cape Mountain Bike 6.00 Bargain Hunt 7.30 RBT 3.00 McLeod’s Daughters 4.00 As SBS 1 8.00 Getaway Time Goes By 4.30 The Golden Girls THURSDAY 3 THURSDAY 7.00 Spicks And Specks 6.00 6pm With George Negus Challenge 5.00 Tread BMX 7.00 The Benny Hill Show 7.30 The Trophy Room 5.00 Weatherwatch 5.05 World News 6.30 Ten News 5.30 NBL Basketball LIVE – New 7.30 Movie: Mr Bean’s Holiday 8.30 CSI (M) 5.00 Ellen Degeneres Show 8.00 The Young Ones 1.00 Food Lovers’ Guide To Australia 7.00 The 7pm Project Zealand v Townsville (PG 2007) UK comedy. Stars 9.30 CSI: Miami (M) 6.00 The Nanny 8.30 Party Down (M) 1.30 Comic Books Go To War 2.30 7.30 The Biggest Loser 7.30 The WWE Experience 8.30 Pulp Rowan Atkinson 10.30 Cold Case (M) 6.30 Friends 11.30 12.00 9.00 Lowdown (M) Dateline 3.30 Letters And Numbers 8.30 The Good Wife (M) Sport 9.30 UFC Unleashed 10.30 9.20 Movie: Force 10 From Til Death Burying Brian 7.00 The Zoo 4.00 4.30 5.30 11.00 (M) 1.00 Entertainment Tonight 1.30 9.30 Graham Norton Show The Journal Newshour 9.30 Law & Order: SVU (M) Sports Tonight NASCAR Sprint Navarone (M 1978) WWII 7.30 As Time Goes By Global Village Cup 12.00 NASCAR Nationwide Series Skippy 2.00 Infomercials 3.30 Good 10.15 Father Ted (M) 10.30 6pm With George Negus drama. Stars Harrison Ford 8.00 The Golden Girls 6.00 Letters And Numbers 1.00 NBL Basketball – NZ v Townsville Morning America 5.00 Early Morning 10.45 The League Of Gentlemen (M) 11.00 Late News With Sports Tonight 12.00 Minder (M) 1.00 Movie: Edge 8.30 Hoarders 3.00 Omnisport 3.30 Serie A Football News 11.15 Inside The Actors Studio: Ricky 6.30 World News Australia 11.30 The Late Show 12.30 Burn Notice Of Eternity 3.00 Harry’s Practice 3.30 9.30 Embarrassing Bodies (M) – Palermo v Udinese 5.30 Liverpool Gervais 12.05 Planet Rock Profiles: 7.30 Adriano Zumbo (M) 1.30 Infomercials 4.00 Religion Passport To The Sun 4.00 Coronation 10.30 Amazing Medical Stories (M) Sheryl Crow 12.30 Parkway Drive (M) 8.00 Oz And James Drink To Football Street 4.30 Emmerdale 5.00 Home GO! 11.30 Conan (M) 12.30 Friends 1.00 1.00 Coach Trip 1.20 Close Britain ELEVEN Shopping 6.00 Kids’ Programs 10.30 As Time Goes By 2.00 Home Shopping 8.30 Anthony Bourdain PRIME Entertainment Tonight 11.00 TMZ 4.30 Religion 5.00 30 Minute Menu 6.00 Jag 7.00 MacGyver 8.00 The 9.30 World News Australia 6.00 Sunrise 9.00 The Morning Show 7MATE 11.30 Get Smart 12.00 Here’s Lucy 5.30 Today ABC 3 Brady Bunch 8.30 Neighbours 9.00 10.05 Movie: Reykjavik- 11.30 Morning News 12.00 Movie: 12.30 Green Acres 1.00 Seinfeld 1.30 6.05am to 5.30pm Kids’ Programs Touched By An Angel 10.00 7th 6.00 Wagon Train 7.00 The Virginian Rotterdam (MA 2008) Wedding Wars (PG 2006) US comedy. 8.30 McHale’s Navy 9.00 NBC Today The Hills 2.00 Cribs 3.00 Just Shoot I didn’t say it was your fault, I said I 6.00 Trapped! 6.30 Prank Patrol Heaven 11.00 The Love Boat 12.00 was blaming you. International 7.05 What Do You Icelandic thriller Stars John Stamos 2.00 Dr Oz 3.00 11.00 Quincy ME 12.00 Magnum Me 3.30 Kids’ Programs 11.40 Movie: Live And Become Diagnosis Murder 1.00 Jag 2.00
22. Wan abstainer takes about a bad draw (11) DOWN obviously did well in his fortnight Mungo’s Crossword From The Week direction for full colour 16. Evaluates Jennies? (8) 1. Storms, disturbances (8) CHESS by Ian Rogers of coaching – witness the fol- range (7) 18. Group of whales 2. Title of knight (3) Play at Seagulls Club, Thurs 6-10pm lowing superb positional crush 23. Like hot remains (3) follow desire for a broad 3. Destroy sense of purpose, break of Grandmaster Mikhail Kobalia. 24. Soft citations can bean (3-4) down self-control (7) When 18-year-old Le Quang make all the difference in 19. Thrifty types hang on 5. Conductor-manager of famous Liem won a second consecu- Moscow Aeroflot Open 2011 Australian elections! (11 to fifty trays (7) tive Aeroflot title this week in White: M Kobalia Lonely Hearts Club Band (8,6) Black: Le Quang Liem 26. Ceremonial walk 20. One hundred Moscow he confirmed that he is 6. Stage, stand for a speaker (7) Opening: English around the island – it’s discordant harps produce 7. Greatest of King Arthur’s knights much more than just a one-hit just perfect (8) 1.c4 e5 2.Nc3 Nc6 3.g3 Nf6 4.Bg2 Bb4 a single note (1,5) (3,8) wonder. A 1970s system which is enjoying a revival. 27. Very large vehicles 25. 101, a spooky mob In its ten-year history, the given as awards(6) 8. Desert herb known as mountain 5.Nf3 0-0 6.0-0 d6 7.d3 Bxc3 8.bxc3 h6 (1,1,1) spinach (6) Aeroflot Open has established 9.Ne1 9. Instructors employed at official itself as the toughest open tour- 9.e4 has a better reputation, intending to meet DOWN Quick Clues places of learning (6,8) nament in the world, with a large 9...Ne7 10.Nh4 g5 11.Nf3 Ng6 with 12.Nxg5!. 1. Storms back, ran into ACROSS 13. Twitcher, observer of prize fund and entry restricted 9...e4! 10.Nc2 plagues (8) 1. Paper handkerchief (6) ornithological activity (11) to players rated above 2550. (To 10.dxe4 Re8 11.f3 Be6 looks ugly for White but 2. French providing royal 4. Type of coffee (8) 16. Estimates, evaluates (8) after 12.c5 the struggle would lie ahead. title (3) put this in perspective, currently 10. Division of American 18. Variety of broad bean (4-3) 10...Re8 11.Rb1 3. Peacekeepers never Australian Champion Zhao Zong defence force (6,5) 19. Trays, serving platters (7) White’s plan of working around the Black e disturb breakdown (7) Yuan would be the only player pawn does not work out well but 11.f3 exd3 11. Genetic component 20. Musical note of 440 Hertz (1,5) 5. Get pens, prepare from Oceania allowed to enter.) 12.exd3 d5 is already very comfortable for Black. (1,1,1) 25. Amßerican spy agency (1,1,1) Until now, no player had ever material for famous cover 12. Blockade; trade ban 11...b6 12.Bf4 Bb7 13.Nd4 Qd7 14.Nxc6 band leader of the 60s (7) won the Aeroflot Open twice, or Bxc6 15.Qd2 Re7 16.d4? Strategically disastrous. 16.f3 was necessary, (8,6) 14. Harangue; talk even gone close to winning the 6. Stand up alternative Last week’s solution event twice. intending to meet 16...e3!? 17.Bxe3 Rae8 interminably (7) 18.Bxh6! with counterplay. way with drink (7) 15. Nursery rhyme rodent However, Le led the 2011 7. Drunk about one? 16...Bb7 17.c5 Ba6! 18.Rfd1 Nd5 19.Be3 trio (5,5,4) event from start to finish, and Bc4 Cryptic Clues 12. Measure the limit, then leave Right, cut to Ban’s heroic 17. Core followers of even a penultimate round loss to Now Black’s pieces dominate the key squares – it’s a total ban (7) offspring! (3,8) ACROSS Jesus (6,8) Ivan Cheparinov – better known and White can never break free. 14. Harangue each royal party (7) 8. Sibyl trades length 1. I heard you sneeze – use this 15. Famous trio of sightless 21. Devilish, demonic (7) as the main second of Veselin 20.Qc2 Qg4 21.cxd6 cxd6 22.Re1 Nxe3 for height to obtain (6) runners – we find them 22. Board on which Topalov – could not stop the 23.fxe3 d5 24.Rb2 Rc8 25.Rf1 Rc6 26.Qa4 mountain spinach! (6) painter mixes colours (7) 4. I’m English, so grab the incredible! (5,5,4) Vietnamese teenager. Rec7 27.Rc2 g5 newspapers and a coffee (8) 17. Two elves plates broken 9. Pedagogues 23. Residue of a fire (3) Beginning the final assault. unfortunately coach the 24. Choices; indications of Last year after Aeroflot Le 28.Kf2 h5 0-1! 10. Minor scrape is out of control – they were attending a stayed behind in Moscow for – call in the armed forces! (6,5) memorable final meal! (6,8) losers (14) favour (11) An early resignation, but faced with the threat 11. River sodium – its in your 21. Demonic wild cats devour an 13. Twitcher takes 26. Ideal state, heaven (8) a fortnight and studied with of 29...h4 plus later ...Rf6+, White can do noth- genes (1,1,1) individual (7) complaint to the queen 27. Movie awards (6) Alexander Khalifman. Khalifman ing with his queen and c2 rook so badly offside. 16 February 24, 2011 The Tweed Shire Echo www.tweedecho.com.au LIVE Volume 3#24 © 2011 Echo Publications Pty Ltd P: 02 6684 1777 F: 02 6684 1719 For advertising enquiries [email protected] TWEED ECHO SEVEN Editor: Eve Jeffery [email protected] www.tweedecho.com.au FEB 24 – MARCH 2, 2011 ALL YOUR LOCAL ENTERTAINMENT 7 DAYS A WEEK AFTER a Hank Williams in TOURING your collection.) Hank Inside Williams has always been THROUGH cool! I guess everything soapbox p18 THE UK AND is such a mish-mash EUROPE LAST these days we all have to music p18 YEAR, pay our respects to the inventors. It’s like we are a swag of festival able to borrow so much appearances and from such a wealthy art p19 some gobsmacking history of pop music; reviews, TIN PAN theatre p19 ORANGE hits when you hear Hendrix Coolangatta at the or Billie or Leadbelly, it Soundlounge. Seven satisfi es a craving for the good taste spoke with the roots of things. p20 remarkable Ms Emily What are the Lubitz. embarrassing records gig guide Are you still living that you secretly love in in Melbourne? Do your music collection? p21 you think living in Peeling thE I was singing Mariah Melbourne is an Carey’s Music Box the advantage to your other day before a gig, ORANGE but I think I’ve lost that musical career given the number CD now. Man that girl of venues and could sing! W gigs as compared with, say, Sydney or Brisbane? Why? Yes, we are all Tell me a little about the new album you are working on at the Melbourne people. I’m not sure about the advantages and disadvantages moment? Well, we’re writing for it now. The record will have a fuller sound of living in Melbourne because I’ve never lived anywhere else for very long. I think … perhaps a bit more sonically experimental but with same old- Coming I guess it’s a thriving nest of people doing what we do … that’s a good fashioned, honest songwriting we’ve always done. Soon thing and bad thing … in the past it has felt like being a small fi sh in a big What production choices are you making? We’ll be using more pool. We went to places like Darwin and felt like bigger fi sh. It was like we COOLANAGATTA HOTEL instruments this time … like a rhythm section and some lush brass MARCH 4 were feeding hungry puppies. Melbourne is harder to crack in a way but it sections. We’ll be working with a wonderful producer Steve Schram (Little ASH GRUNWALD also off ers more opportunity, and certainly a lot of inspiration from other Red, Little Birdy, The Cat Empire), who will bring much to the record I’m artists. BYRON BAY FILM FESTIVAL sure. MARCH 4-13 You toured with The Cat Empire in Europe last year – they have a How has your music changed over the last few releases? Do you high-velocity high-energy set, audiences are waiting for that; is it TWIN TOWNS feel that you’ve arrived at a sound that feels completely yours? Our MARCH 17 diffi cult going on before them? Do those audiences – their audiences songwriting has become better, I think – more mature you could say. But I KAMAL MUSALLAM'S I suppose – get Tin Pan Orange as well? The Euro crowds were most think we are still searching for ‘sound’ … I guess you never stop searching EASTMANIA WITH obliging. Really wonderful, actually. The Cats seem to have a following all BILLY COBHAM … or maybe growing is the word. around the world of people who are not just wanting to dance mindlessly MURWILLUMBAH THEATRE (which they do as well), but are actually real music lovers. We felt very Your voice attracts a lot of attention. Even from divas like Renee COMPANY understood in most cities we went to. I think it’s also a European thing, Geyer. What is it about your voice that seems to touch people so APRIL 1 deeply? I’m not sure about that one. I’ll just say thanks. WRONG WINDOW maybe, that when someone is on the stage doing their art, they listen. Very respectful – and crazy at the same time. It was an amazing tour! Tell me the most surprising thing that’s happened for you musically SOUNDLOUNGE GOLD COAST over the past 12 months? Alex did the Hammer dance in Amsterdam and MAY 13 Do you think the general public have broadened their acceptance ERIC BIBB of music in the last decade? (Meaning it used to be embarrassing to took us all by surprise. He says he doesn’t remember. admit you liked country music, but now it’s kind of groovy to have See them at the Soundlounge, Coolangatta on Friday 25.
YOUR WORLD OF FILM IN THE HEART OF BYRON BAY 10 DAYS 36+ SESSIONS | Shorts | Features | Documentaries | Animations | Experimental Films | Surf Films | Environmental Films | Music Videos | OVER 175 FILMS BBFFth 20 1 1 The 5 GALA RED CARPET EVENTS BYRON BAY FREE WORKSHOPS FOR FILMMAKERS INTERNATIONALBYRON BA Y & EXPERIMENTAL FILM EVENTS FILMINTERNATIONAL FESTIVAL BBFF 20 1 1 FILM FESTIVAL BYRON BAY FRIDAY MARCH 4 - SUNDAY MARCH 13 INTERNATIONAL FILM FESTIVAL
www.tweedecho.com.au Th e Tweed Shire Echo February 24, 2011 17 Live Music Soap Box PLANTA E RAIZ COOLANGATTA HOTEL MONDAY Mandy Nolan A VERY SORRY POLLY
on pensions, who are unemployed, sick or When you’re in public offi ce, it’s a good infi rm are bad. idea not to insult your constitutents. A few weeks ago former Tweed Mayor Warren People with a ‘get a job’ mentality are Polglase disgraced himself by telling an frightened of people who live outside of the 80-year-old woman to ‘Get a job’. This was 40-hour week. They despise those citizens in response to the Tweed Shire woman who sleep until 11. Who spend months in the expressing her disapproval of Polglase’s forest chained to trees or three hours day in a support in the council vote for a new dam in the Tweed. As he passed her she uttered yoga class. To Get a Jobbers, people without ‘shame’ to which old Polly inferred she needed jobs are irritating. They have time to do an urgent trip to Centrelink. things like, well, like research environmental problems associated with dams. They have ‘Get a job’ is not a very original comeback. time to read environmental impact studies. He might as well have yelled ‘show us ya tits’ or ‘I just had sex with your mum’. They’re They have time to attend council meetings just tired old heckles, a way of minimising and sit in the public gallery. They have time to protest decisions they believe are short and dismissing the other person as a fool. perfect blend of 70s through to the more recent If you are going to have a retort, make it sighted and unfair. Coolangatta has the best Apps music, covering music from Bob Dylan, Neil appropriate. Why yell ’get a job’ to an 80-year- In what’s been a stellar year for local singer- These stupid people need to get a job. Young, Cold Chisel, Bernard Fanning, Credence, old woman who’s well past working age? songwriter Kristy Apps, her album Pour Me Out Because when you have a job you’re Eagles, Beatles, Jason Maraz, Rolling Stones was voted top ten blues and roots Album of the Doesn’t Polly realise the retirement age is compliant. You’re just too tired from spending and many more. Dave’s own music style is a 65? Is he really expecting Mrs Jack to apply Year by Rhythms magazine, Album of the Week the best part of your week doing something contemporary folk/rock, with his own personal for Newstart? ‘And where have you applied by Rave magazine, and most played meaningless to earn money to pay for a life experiences entwined; he is a storyteller. for work this week Mrs Jack?’ ‘Hmm, the that you don’t have time to participate in. I’m album of the week at 4ZZZ radio in Brisbane. bowls club?’ Does Mr Polglase have any idea Dave has supported many famous acts and a taxpayer. I’m happy that part of the money To celebrate these incredible victories Kristy is how diffi cult it is for an 80-year-old woman bands in his career, eg Bob Geldorf, Tommy Em- I earn goes to providing modest income doing local shows with her new band to thank to re-enter the workforce? I’ve scanned manuel, Cold Chisel, Billy Thorpe, Blues Legends supports for single mothers, the unemployed, to those who have supported her most. ‘The the employment section of the relevant USA just to name a few. Dave has written and Tweed papers and not one job requested an the lazy and the drug addicted. I’d rather coast has always been a favourite place to play. recorded his own original music and has three octogenerian. As hard as Mrs Jack tries I just it went there than into new cars for Wilson Just last month we trialled the new line-up at don’t think she’s going to get a job. Tuckey, speech lessons for Julia Gillard or a The Rails in Byron and the response was amaz- albums which include Blue Yonder, DC and the compassion implant for Tony Abbott. ing,’ says Kristy. Among her new all-lady line-up Rich Men, Fist Full Of Dollars. The title track of Chances are, that at the age of 80, Mrs Jack Blue Yonder is Journey Home which is featured on has fulfi lled her civic duty in the workforce. are legends of the Brisbane music scene Sallie So how did the Polster apologise to an the Lightning Strikes DVD, when Mick Fanning She has earned her dues. She can sleep 80-year-old? He sent an email. ‘Sorry old Campbell on violin, Shiv Zimmerman on bass sixteen hours a day in her slippers if she won his fi rst World Surfi ng Title. Dave also has bat...send. There it’s done.’ When Kevin Rudd and Ruthie Gardner on guitar. ‘I’ve been blessed wishes. She’s a community elder. But no, Mr to work with some incredible musicians, each an instrumental track on Dean Morrison’s movie Polglase wants Mrs Jack back on the payroll. said Sorry to Indigenous Australia he didn’t A Dingo’s Tale released in March. His music has send an email. Email apologies are copouts. bringing a new sound and depth to the music. He wants her cleaning toilets, or holding the I’m really looking forward to playing the Coolan- also featured on many surf movies produced by Stop-and-Go sign; maybe she could even get Apologies should be public. They should be gatta. There’s just such great energy between us Matty Gye and Shagga, legends of their craft. a job at the McDonald’s Drive-Thru. So when sincere. And they should attempt to restore Dave’s song Been to Bourke and Back which was Warren nips in for a midnight McFeast she’d dignity back to the off ended party. all, and this new instrumentation has brought performed by the band Bourke’n’Back Boys fi ll his order, take his cash and then utter a real organic feel to my music.’ see Kristy at the ‘shame!’ and he’d say ‘Go on the pension!’ I suggest that if Warren Polglase wants to Patch Lounge Coolangatta on Friday. was nominated for Song of the Year, Tamworth make a proper apology he needs to make a Country Music Festival. ‘Get a job’ is an insult born of our protestant personal trip to Elizabeth Jack’s home, off er See Dave at the Twin Towns Juniors Club on work ethic. It echoes an underlying belief her a foot rub, clean her gutters and a make Dave Cavanagh Friday system that people with jobs are better . her a cup of tea. As the song says, Warren people than people without jobs. People with Dave Cavanagh is an accomplished musician jobs should have more rights than people Polglase: ‘Polly put the kettle on.’ Maybe who is respected for his great ability to play and without jobs. People who work in jobs and Polglase should stop worrying about people sing music to all ages and across most genres. Widen your stance pay taxes are good. People with disabilities, getting a job, and get on with doing his job. Having had many years in the music industry he Broadfoot take to the Tweed River this week- is an extreme- end, fi rstly alighting at the Ivory Tavern on ly enjoyable Saturday 26 from 8pm before travelling up river entertainer to the Riverview Tavern in Murwillumbah on Love Vintage Fair to listen to. Sunday 27 starting from 2pm. Broadfoot are a This will be band that love to have audiences up dancing, @ Byron Bay an evening of playing a mixture of their own songs combined great free en- with many that infl uenced and continue to Sat. 26th February 2011 tertainment. inspire the band. Last August Broadfoot won Dave has a a North Coast Entertaiment Industry Award 9.30am - 3.30pm cross-section for their song The Timeless Groove in the funk Byron Bay High School Hall of music category, as well as being nominated as a fi nalist Broken Head Road ranging from for best emerging talent. Although Broadfoot's Byron Bay 2481 covers to his music has funky elements it has more to it, with own original two-and three-part vocal harmonies, scintillating music. It is a improvisation and a spirit of fun that leaves an
Mullum
Mullum KRISTY APPS THE PATCH www.lovevintage.com.au/byron.htm LOUNGE COOLANGATTA FRIDAY 18 February 24, 2011 Th e Tweed Shire Echo www.tweedecho.com.au that ultimately fl oated her dinghy, and she set sail for the Queensland Conservatorium BEC LAUGHTON of Music to study jazz vocals. Now perform- SHEOAK SHACK ing her original soul/pop music throughout Queensland with her 2–10 piece suite, Bec re- SATURDAY ally attracted the spotlight when she won the Gospel/Spiritual category of the 2009 QSong Awards. The track, Holy Love, is included on her debut EP to be released this year. Bec has featured at the Dreaming Festival, the Wood- ford Folk Festival and supported international R&B act Zhane at Psycho Remedy among her SHAI SHRIKI at many countless performances across south- KAIVALYA MERU SATURDAY east Australia. With her powerhouse voice and intoxicating performance, beware this fi erey songstress. Sheaok Shack Saturday.
Midnight Groove Plant your Roots audi- Midnight Groove is one of Australia's premier Planta E Raiz arrives in February as part of their fi rst ever Austral- ence member feeling like they're at a party. Ivory Tavern corporate music acts and has been entertain- ian tour. After touring in Europe and playing in festivals around on Saturday and the Riverview Tavern on Sunday. ing audiences worldwide for over ten years. With their combined the world Planta E Raiz will arrive in Australia. As one of Brazil’s musical talents, multi-instrumentalist Scott and lead singer most popular acts, Planta E Raiz promises to be one of the best Sarah form the heart of Midnight Groove. Both graduates of the Brazilian performances Down Under. Planta E Raiz will bring their Shai Shriki and Tiff Norchick Queensland Conservatorium of Music, this duo has been a leader best hits and will celebrate 12 years of a successful career in Brazil Local community Kaivalya Meru is hosting its second evening of in the national and international corporate arenas. They have and around the globe. It will be a great night of good music, featuring beautiful local musicians Shai Shriki and Tiff Norchick. performed at Currumbin RSL many times with rave reviews from great vibes and beautiful people. Special guest: Ziggy and The From soft heart space and prayers of pure devotion, to Gypsy, patrons and members. Currumbin RSL Saturday. Wild Drums. Plant yourself Monday Coolangatta Hotel. Bedouin and Latin melodies, Shai Shriki takes you on a journey around the globe. Born in Israel to a Moroccan family, Shai plays Music with style and Grace unique instruments from the Middle East and India. His truly au- thentic sound and voice invoke desert landscapes and cultures. Wendy Grace and Trysette are two women who are serious He performs tradi- about song and music. Trysette’s following extends beyond Aus- tional prayers from tralia. As a singer/songwriter/pianist her albums and Art exhibitions the ancient Hebrew credits abound. Trysette has been the support act for script as well as origi- the likes of Toni Childs and Deborah Conway. When she nal songs, in a fusion is on that stage her talent shines. Wendy Grace, a local Decorative Arts guitarist/songwriter has an established reputation here of contemporary and Art exhibition by students of Kenita’s Decorative Arts. View on North Coast. Her career spans from her early days traditional sounds. delightful artworks by our very talented local artists Saturday on Countdown to her present-day workshops teaching You will be touched and Sunday, February 26 and 27, open 9am–5pm. Kenita's by this intimate world people the joy of sound and the power of music. See this duo at Sphinx Rock Café Sunday. Decorative Arts 15 Coolman Street, Tyalgum. Enquiries Ken or journey through Anita 02 6679 3339. sound. Accompanying All we hear is herself on harp and acoustic guitar, Tiff Radio Ga Ga Norchick plays music The musical fusion of exquisite fragility. of Lauren Napier and Her deep contralto WENDY GRACE WITH Stu Durston creates 2011 voice sometimes this dynamic duo. breaks into a whisper, TRYSETTE SPHINX ROCK Both have been soothing and draw- CAFé SUNDAY professional per- ing the listener into formers for over ten her original songs years in the industry, about mountains, forests, butterfl ies and phone bills. with experience performing Kaivalya Meru is a drug, alcohol and smoke free space located nationally and internationally. at Lillian Rock – 10 minutes from Sphinx Cafe. Kaivalya Meru, An all-encompassing energy of Sun 27 March F lights &Bikes of Fanta sy Saturday. live vocal harmonies, acoustic guitar and percussion to spice up all occasions. Radio Ga Ga Bec Laughton play all your favorite tunes and It was only natural for Bec Laughton, raised as a theatre orphan, then some! This diverse and fun to set foot on stage. At 16 years the young performer played Dor- duo will have you compelled othy in the motown musical The Wiz with Harvest Rain Theatre to enjoy the music. This will be Company, and received rave reviews. Although a well-equipped their fi rst time at Currumbin dancer and actor, Bec decided it was singing and songwriting RSL on Sunday.
Be part of the all beach fly-in at 2pm on the day.
A magical day of eco-friendly f amily f un
www.tweedecho.com.au Th e Tweed Shire Echo February 24, 2011 19 The Here you will fi nd some of the best local dining on off er. Restaurant owners take Echo’s note: Good Taste provides you with the chance to tell your customers more about guide to your business with ample room for that extra information that may not fi t in a small GOODTASTE advertisement. Great introductory rates are on off er. Call 02 6672 2280 to fi nd out more. Santos Trading Small enough for personal care, large enough to off er Sheoak Shack If you are looking for delicious food, coff ee or competitive prices. Santos has been supplying high romantic sunset cocktail on the riverbank, the Sheoak Warehouse 64 Fingal Rd, Fingal Head quality biodynamic, organic, natural foods, and healthy Shack is the beach shack for you with a funky laid Mon-Thurs 9 to 5 Ph 07 5523 1130 Trading products since 1975. We continue our commitment to back daytime vibe or a party atmosphere with live Fridays 9 to 4 Wed & Thurs 11am-5pm, sourcing as locally as possible. Santos is the home of music on Saturday nights. This gallery/cafe showcases OPEN TO THE PUBLIC Fri & Sat 11am-10pm & Rainfed Rice–zero irrigation, certifi ed biodynamic, as the work of high quality local artists and is available 3/7 Brigantine Street, Sun 9.30am-5pm local as you can get, and the most delicious rice you’re for private functions… more Byron than Byron, in BYRON BAY BYRON Byron Arts & Industry Park likely to fi nd. Visit rainfedrice.com.au for more info, or www.sheoakshack.com
sleepy Fingal Head. HEAD FINGAL (02) 6685 5685 visit our online store at santostrading.com.au. Eat well. O-Sushi Winner of the ‘Favourite Japanese Fins The wine superstars of Spain are Restaurant all over Qld’ in the I Love Food Coolangatta Salt Village, Kingscliff coming to Fins Showcase on the Beach competition 2010 6674 4833 Thursday March 10 07 5536 5455 Eat in or takeaway. Licensed. dining@fi ns.com.au Ricardo Perez Palacious and Telmo Open 7 days 11am till late. Byron Bay Dinner 7 days Rodriguez are hosting an exclusive O-Sushi is a modern Japanese restaurant guided by Woolies Plaza, Jonson St Lunch Fri, Sat & Sun wine dinner at Fins. $139 (including six a philosophy that incorporates traditional values of 02 6685 7103 GOOD FOOD GUIDE courses and 10 wines)
COOLANGATTA providing the best possible service combined with CHEFS HAT EVERY KINGSCLIFF www.osushi.com.au Bookings essential fresh wholesome food. YEAR SINCE 1998 WEEKDAY SPECIALS Cecada One of the region’s great old country pubs. Delicious Kids eat FREE between 5.30 & 6.30pm for limited time. Mount Mt Warning Hotel Modern Dining Lunch Special Open 7 days 10am till late food, bistro open for lunch everyday from 12-2pm, Shop 5 , Refl ection Tower 2 Warning dinner Thursday to Sunday from 6-8pm. Children’s Experience the New Taste of modern era FREE Lunch Meal Deal buy 3 get one FREE Bistro open daily 110 Marine Parade, Breakfast Special Hotel 1497 Kyogle Rd, Uki playground, relaxing beer garden. Curry night on Coolangatta BIG BREAKFAST with free drinks $14.90 only 02 6679 5111 Thursday, raffl es and member’s draw on Friday, UKI Fully licensed Book for Valentines Day and receive free champagne punter’s draw on Saturday and on Sunday there is a 07 5599 2270 for one on arrival. delicious roast. MURWILLUMBAH
‘Experience the new taste of modern cuisine by the sea’
Alleys Back by popular demand 3 course weekday lunches Currumbin RSL Club Currumbin Creek Road, $14.95 members or Currumbin $24.95 non-members Open 7 days lunch and Visit our website to view the dinner menu 07 5534 7999 Winner – Best Club
CURRUMBIN Restaurant 2007, 2008 and echoGOODTASTEguide www.currumbin.com.au 2009 (Clubs QLD Awards) HEATHER MATTHEW TWEED Nunderi artist completes RIVER ART GALLERY monumental project Heather Matthew creates ‘A stitch in time’ each day during 2010. A stitch in time is a project of epic proportions by Nunderi artist Heather Matthew. The work represents a full year of work after Heather created one small collage on each day of 2010, displaying great commitment to her project. The 365 individual works are a daily record of the artist’s thoughts and everyday musings, constructed from every- day materials such as train tickets, text, postage stamps and her own discarded prints and paintings. A stitch in time creates a stunning presence as visitors enter the gallery foyer, and was a major drawcard when a workshop was staged at the gallery last Sunday. Seventy people attended the workshop to receive Heather's guidance to create their own col- lages. DAVE CAVANAGH TWIN Gallery Director Susi Muddiman said Heather’s stunning work in- TOWNS JUNIORS FRIDAY cited a lot of speculation and reminiscing among gallery visitors. ‘Visitors are so taken with the work. There are so many intricate details in each collage and we’ve heard visitors speculating about Coming Soon what might have been happening in Heather’s life that day,’ said Fifteen Minutes of Fame at Stokers Miss Muddiman. ‘It’s a great test for people’s memories too – like 24-6-10 ‘You Go Girl and How!’ refl ecting the day Julia Gillard Evolves became Australia’s fi rst female Prime Minister. Approaching it’s third year of showcasing local Win the new ‘A stitch in time is an amazing display of Heather’s commitment performers Fifteen Minutes of Fame at Stokers, the in terms of time, energy and perseverance. It is fascinating to see monthly variety show on at Stokers Siding Hall every how a small eff ort each day can culminate in such a monumental fi rst Friday of each month, is now presenting a iPod Touch! achievement.’ featured professional act as well as the usual ‘black- Heather said when she embarked on the project, she did not board’ acts. realise what a momentous year it would be. ‘The ritual of mak- This month features well known North Coast Folk ing a daily collage became a personal meditation on each day’s musician Karl Farren events,’ she said. ‘Some were important personal occasions, like my son’s wedding, 20-3-10 ‘A Song of Love Divine,’ others were a This Dolphin Award winning singer/guitarist will commentary on climatic extremes 19-4-10 ‘Volcanic Disruptions bring his wit and feeling to the stage featuring and Politics’. songs from his acclaimed album Repentance Creek. ‘Looking back over the year, I see repeated motifs in the humble Also appearing on March 4 will be Loki DeJagger cup of tea – 15-4-10 ‘Boiling the Billy’ – as well as comparisons well known Stokers Siding Stand-up Commedienne, between my life in the Victorian high country and my new abode local guitarist and singer Tony Hogan along with in northern NSW.’ one of his guitar students, Sue Gallagher and The collage is on display on Tweed River Art Gallery until Company bringing excellent song and performance, Subscribe to Bay FM during February and you could win the revolutionary March 27. Rod Sims all the way from Woodburn with guitar new Apple iPod Touch, thanks to Mullum Mac. and song and The The 64 Gig iPod Touch features crystal clear high resolution Retina Display, Chillingham Voices Face Time video calling, HD video recording and Game Centre, all in the palm of your hand. Choir with beauti- ful acapella singing. This fantastic prize could be yours! Just become a subscriber before the end of the month to go into the draw. 7pm Stokers Siding Hall, $12. To subscribe visit us at the station, in the Byron Community Centre, or ring us during offi ce hours on 6680 7999 or visit our website at www.bayfm.org Support your community BROADFOOT IVORY TAVERN SATURDAY radio station! AMC Tweed 6 Cinemas Murwillumbah BCC, Coolangatta Cinemax Cinema Tweed City Regent Cinema Coolangatta 60 Marine Parade Cinema Shopping Centre, 5 Brisbane St, Shopping Resort Kingscliff 54 Minjungbal Drive, Murwillumbah Griffi th St 02 6674 4422 www.bayfm.org South Tweed Heads 02 6672 8265 (Cnr Warner St) 07 5523 3321 PHONE: 6680 7999 Guide www.cinemaregent.com Coolangatta www.amcmovies.com.au 07 5536 9300 20 February 24, 2011 Th e Tweed Shire Echo www.tweedecho.com.au The Tweed Echo has the most comprehensive entertainment gig guide in the area. For your free listing, email [email protected]. au or phone us on (02) 6672 2280. Deadline is noon Tuesday prior to ART GALLERIES GIG GUIDE Thursday’s publication. 19KAREN CONTEMPORARY äÇÊxxÓ{ÊÓ£äÊ"«i\Ê>{«Ê iÛiÀÞÊ`>ÞÊiÝVi«ÌÊÜiii`à THURSDAY 24 QPOTTSVILLE BEACH SPORTS QKINGSCLIFF BEACH BOWLS HILL 12.30 GLENN BRACE ARTSPACE CLUB 7PM TREVOR RIX CLUB 7.30PM HAPPY DAZE QIMPERIAL HOTEL 19 Karen Avenue, Mermaid TWEED SHEOAK SHACK GALLERY QSALT BAR KINGSCLIFF THE KARAOKE MURWILLUMBAH 2PM GAB Beach 4218. (07) 5554- QCLUB BANORA 6PM MAT ZONE QLATTITUDE 28 DEG QMARTY’S AT CABA 1.30PM 5019. [email protected] CAFÉ Q MARK FERRIS STOKES TERRANORA TAVERN 7.30PM RESTAURANT 6PM PHIL www.19karen.com.a 64 Fingal Rd, Fingal Head QTWEED HEADS BOWLS CLUB BILL JACOBI EIZENBERG QPOTTSVILLE BEACH SPORTS 07 5523 1130 6PM VEENIE’S SWIZZLE QTWEED HEADS BOWLS CLUB QLUFFLEY CAFE 7PM FLOOD CLUB 5PM PAUL ANTHONY CAFÉ D’BAR GALLERY "«iÊ7i`/ ÕÀÃ\Ê££>x«]Ê NOON BOB MILDREN, 7.30PM FUNDRAISER ‘BARNABY & QRIVERVIEW TAVERN 2PM GOLD COAST THE CHEVROLETS DURAND’ BROADFOOT 275 Boundary St, Coolangatta À->Ì\Ê££>£ä\Îä«]ÊÊ-ÕÊ QBILAMBIL SPORTS CLUB OPEN Q CONDONG BOWLING CLUB QMURWILLUMBAH SERVICES QSPIHNX ROCK CAFE 2PM äÇÊxxÎÈÊÓxääÊUÊ"«iÊiÛiÀÞÊ`>Þ \Îä>x« MIC AND JAM NIGHT 6.30PM KEL’S JAZZ CLUB 6.30PM VANYA WENDY GRACE AND QBURLEIGH BEARS LEAGUES KANARIES, 8PM CAXTON QPOTTSVILLE BEACH SPORTS TYSETTE COMMUNITY PRINTMAKERS STOKERS SIDING POTTERY CLUB 6PM TRACY VAUGHAN STREET JAZZ BAND CLUB 6PM WAYNE RANSON QTWEED HEADS BOWLS CLUB MURWILLUMBAH (CPM INC) 224 Stokers Road, Stokers Siding, QKIRRA SPORTS CLUB PHIL GOLD COAST QSALTBAR, KINGSCLIFF 8.30PM 5PM DAVE CLAYTON 33-35 Kyogle Road Bray Park, Tweed Valley EIZENBERG’S OPEN MIKE LEIGH JAMES BAND ÈÈÇÇÊÓänÊ"«iÊÇÊ >ÞÃÊ QBURLEIGH BEARS LEAGUES GOLD COAST ÕÀÜÕL> ÊUÊÈÈÇÓÊnÓÇÈÊ NITE QSHEOAK SHACK 7PM BEC vÀÊ\Îä>x« QCUDGEN LEAGUES 6PM CLUB 6PM DAVO LAUGHTON TRIO QBURLEIGH BEARS LEAGUES CAROLYN JOHN STUDIO QCUDGEN HEADLAND SLSC Q CLUB 2.30PM GREG & LAURA MARTIN WAY SOUTH TWEED SPORTS CLUB 241 Cudgen Rd, Duranbah SHELENA RUSSELL QTHE PATCH LOUNGE 7PM PAUL ATKINS 3PM SATURDAY JAZZ, 7.30PM DOOLAN COOLANGATTA 7.30PM JASON QCURRUMBIN RSL PALM BEACH THE FABULOUS BOOGIE QCOOLANGATTA SURF CLUB 0431 533 676 GALLERIES DELPHIN PARKLANDS 6.30PM MOVIES BOYS 2PM TREVOR RIX "«iÊ7i`-ÕÊ£äÊ> 36 Griffi th St, Coolangatta QKIRRA SPORTS CLUB 8PM PHIL BY THE SEA QTWEED HEADS BOWLS CLUB QCUDGEN HEADLAND SLSC 07 5536 6559 QCURRUMBIN SOUNDLOUNGE 3PM BRETT GANNON CURIOUS ART GALLERY EIZENBERG’S OPEN MIKE 7.30PM BROTHERS GIBB "«i\Ê ÀÊ£äx«]Ê->ÌÊ£ä> NITE 7.30PM TIN PAN ORANGE QCURRUMBIN RSL 1.30PM 94a Chinderah Bay Drive, GOLD COAST Ó«]Ê-ÕÊ£ä£Ó°Îä« AND ROSS JAMES IRWIN RADIO GA GA `iÀ> ÊUÊÈÈÇ{ÊxÎ{ä FRIDAY 25 Q NEVERLAND COOLANGATTA QBURLEIGH BEARS LEAGUES QNEVERLAND COOLANGATTA "«iÊ£ä>x«Ê7i`->Ì]Ê TWEED HOUSE PARTY EASY SUNDAYS SEAN SCOTT PHOTOGRAPHY CLUB 7.30PM NIGHTSHIFT -ÕÊ£Ó«x« QAUSSIE TAVERN BAGMAN 9PM QTHE PATCH LOUNGE QCOOLANGATTA TWEED HEADS QSURFERS BEER GARDEN - «ÊÎ]Ê££äÊ >ÀiÊ*>À>`i]Ê QBILAMBIL SPORTS CLUB 8PM COOLANGATTA 8PM KRISTY GOLF CLUB QUADRANT SUNDAY SESSIONS GALLERY VISION Refl ections Tower Two, Coolangatta APPS QCURRUMBIN RSL 7PM MAGGIES FARM MONDAY 28 U4b/18 Stuart St, Tweed heads 07 5599 1150 QCABARITA BEACH SPORTS QSURFERS BEER GARDEN VIPER MIDNIGHT GROOVE 07 5536 1699 "«iÊ -ÕÊÈ°Îä>x« CLUB 8PM THE VEGAS ROOM QNEVERLAND COOLANGATTA TWEED LEGENDS SHOW QTWIN TOWNS JUNIORS CLUB SURECUT KIDS QKINGSCLIFF BEACH BOWLS TUMBULGUM GALLERY 5PM DAVE CAVANAGH Q GOLD COAST ART GALLERY QCLUB BANORA 7PM JUST THE THE PATCH LOUNGE CLUB 12 NOON MARTY 110 Riverside Dr, Tumbulgum TICKET SATURDAY 26 COOLANGATTA 8PM HURST 135 Bundall Road RESIDENT RETRO GROOVE Q Surfers Paradise,Gold Coast 02 6676 6234 QCUDGEN LEAGUES 7PM PAUL TWEED SALT BAR KINGSCLIFF 7PM ANTHONY DJ ALFIE ROMEO FRETFEST THE SINGER [email protected] "«iÊ££>{«Ê7i`-Õ QSURFERS BEER GARDEN QIMPERIAL HOTEL QAUSTRALIAN TAVERN 7.30PM SONGWRITER SHOWCASE 07 5581 6567 THE WAY OF DESIGN MURWILLUMBAH 8.30PM MUSICIANS AND FRIENDS VENUS ENVY QTWEED HEADS BOWLS CLUB JAMES T & THE TOMAHAWKS QCABARITA BEACH SPORTS N SUNDAY 27 6.30PM MARTY HURST KENITA’S DECORATIVE ARTS GALLERY QLUFFLEY CAFE 7PM HARRY CLUB 8PM EDDS GROOVE 15 Coolman St Tyalgum TWEED GOLD COAST 2/792 Pacifi c Parade, Currumbin LYNN & BETH QCHINDERA TAVERN PAUL ÈÈÇÊÎÎÎÊUÊ«iÊ£ä>{« i>V ÊUÊäÇÊxxÎ{Ê£xÎä QLATTITUDE 28 DEG ATKINS QAUSSIE TAVERN EUREKA QCOOLANGATTA HOTEL 8M 6 days (closed Wed) "«iÊ/ÕiÃ->ÌÊ°Îä>Ó°Îä« RESTAURANT 6PM PHIL QCLUB BANORA 7PM CRAIG ALLSTARS 1.30PMPM PLANTA & RAIZ AND ZIGGY AND THE WILD DRUMS EIZENBERG TAYLOR QBABALOU, KINGSCLIFF HOTEL, MINJUNGBAL ABORIGINAL TWEED RIVER ART GALLERY QKINGSCLIFF BEACH BOWLS QIVORY TAVERN TWEED HEADS 3PM SOUTH PACIFIC SOUND WEDNESDAY 2 CLUB 7.30PM SEGUE – 8PM BROADFOOT SYSTEM CULTURAL CENTRE 2 Mistral Rd , Murwillumbah VANESSA AND RADHA QKAIVALYA MERU, LILLIAN ROCK QCHINDERA TAVERN CRAB TWEED Cnr Kirkwood Road & Duffy Street, ÈÈÇäÊÓÇäÊ"«iÊ7i`-ÕÊ£ä> QMURWILLUMBAH SERVICES FROM 6PM SHAI SHRIKI AND RACES & MR TROY QCLUB BANORA 6PM South Tweed Heads x« CLUB 6.30PM GREG WATTS TIFF NORCHICK QCLUB BANORA 11.30AM STEVE SHANDELL
Fundraiser Lovely Fundraiser at Luffl ey's As a support to those aff ected by the devastating fl oods in Queensland, Luffl ey Cafe in Murwil- lumbah are holding a Fundraiser Dinner on Saturday. The event promises to be a great even- ing of live music including Barnaby And Durand, raffl es, auctions and activities. A $10 cover charge will be donated directly to the QLD Premier's Flood Relief Appeal, along with all other monies raised from our fundraising activities. Many local businesses have generously donated prizes for MIDNIGHT GROOVE the raffl es, as well as some great auction prizes. PLAY CURRUMBIN RSL For bookings call 02 6672 8590 or email: info@ SATURDAY luffl eycafe.com.
BARNABY AND DURAND LUFFLEY CAFE FUNDY SATURDAY www.tweedecho.com.au Th e Tweed Shire Echo February 24, 2011 21 Brunswick Heads
3 DAYS ONLY!
FRIDAY FEB 25 – SUNDAY FEB 27
THE NATURE OF THINGSHYjcKl NETWORK VIDEO>af_YdKl RICE INDONESIANEmddmeZaeZaKl 'BTIJPO"DDFTTPSJFT Closing down sale - up to 50% off world gifts Near new ex-rental DVDs $9.95 Free spring rolls with every takeaway meal PELIGUCCIL`]L]jjY[] THE LUCKY DUCK GIFT SHOPHYjcKl BRUNSWICK NEWSAGENCYL`]L]jjY[] Refurbishment clearance sale BRUNSWICK HOT BREADHYjcKl Quirky witty irreverent gifts for all ages & budgets 20% off stationery, books and gifts! $2 slices MIMI & FLOL`]L]jjY[] BRUNSWICK VISITOR CENTREHYjcKl TEEYA BLATT @ I REALLY DO..0-),(, 40% off all clothing RIVERSIDE ESPRESSO BAR Up to 50% off selected souvenirs & gift items plus Book now* for 15% off marriage ceremonies L`]L]jjY[] BRUNSWICK SURF & SKATE Free cold filtered water with every meal L`]L]jjY[] free calendar & bag with every $30 purchase LIFE COACHING(,**1-(1,( 30-50% off men’s & ladies clothing 50% off 1 hour sessions DOMINIC’S RESTAURANT>af_YdKl BRUNS KIDS HYjcKl )FBMUI #FBVUZ'VO BYRON SHIRE NEWSBg..0-.+-0 Check out our new tapas bar 20% off all new & secondhand stock in the shop BRUNS BOOTCAMP(,(*-/-(0( Buy 2 ads & get the 3rd absolutely free SILVER DRAGON JEWELLERYEmddmeZaeZaKl 13 ‘Bring a Friend’ sessions $149 NORTH COAST TROPHIES>af_YdKl )PMJEBZ#PPLJOHT 20-50% off selected jewellery & clothes STEP INTO LIFE(,((1*(*.1 20% off pet tags BRUNSWICK SEASIDE HOLIDAYS..0-)*(.$..0-)0+1 ARTISTIC BENT JEWELLERYEmddmeZaeZaKl 6 free sessions for 1st 16 callers. Others 1 free Book now* for 20% off March holiday accom We have bargains in precious metals & stones BRUNSWICK HEADS PHARMACYEmddmeZaeZaKl 'PPE&BUJOH0VU OH MY GODDESSHYjcKl 20% off Blackmores vitamins BY-THE-SEA..0-()*( CINO BAMBINOEmddmeZaeZaKl Great deals every day BAYSIDE ACUPUNCTURE HYjcKl Book now* for 15% off March holiday accom All day breakfast burrito & regular coffee $10 20% off acupuncture & massage treatments BRUNSWICK SAILS MOTOR INN..0-)+-+ HAPPY DOLPHIN CAFÉL`]L]jjY[] (JGUT )PNFXBSFT MICHAELA’S HAIR & BEAUTY..0-)++( Book now* for 10% off your March holiday $6 coffee & cake deal 20% off all services over $50 4FDPOEIBOE5SFBTVSFT SANDBAR PROFESSIONALS REAL ESTATE..0-)0+1 SECONDHAND ROSE EMPORIUM HYjcKl OZSUP STAND UP PADDLE(,+)+-),.+ ;fjL]jjY[]'EmddmeZaeZaKl Book now* for 10-20% off March holiday accom 20% off everything 25% off SUP lessons & purchases All day $10 brekkie deal SIWICKI REAL ESTATE RIVERVIEW GALLERYEmddmeZaeZaKl BRUNS FISHING CO-OPGd\HY[aÚ[@oq ..0-)*(. 30% off children’s clothes, dolls & cushions 0UIFS#BSHBJOT 3kg box frozen green prawns for $55 Book now for 10% off March bookings BRUNSWICK SUPERMARKET SEMI D’ORO..0-))-+ ECO-FRIENDLY CARPET CLEANING(,*10(*1.. Lo]]\Kl FERRY RESERVE ..0-)0/*, MASSEY GREENE..0-)+*1 20-50% off selected items Book now* for 20% off carpet cleaning in March Local Brookfarm muesli big bag $19.99 & TERRACE RESERVE HOLIDAY PARKS..0-)*++ MINA MINA GALLERYEmddmeZaeZaKl BRUNSWICK TACKLE & SURFHYjcKl BERNARDI’S GELATO>af_YdKl Book now* for March cabins & sites. 25% off everything on display Discounts across all lines Buy 1litre pack & get 50% off 2nd pack Stay 3 nights mid-week & get 4th free. Kids FREE! WHATEVERHYjcKl BP BRUNSWICK BAIT & TACKLELo]]\Kl BRUNSWICK HEALTH FOODS>af_YdKl 10% off shop wide 10% off all tackle 10% off all cash sales 5IJOLHMPCBMCVUBUY LOCAL * Offer only for bookings made between 25 & 27 February 22 February 24, 2011 Th e Tweed Shire Echo www.tweedecho.com.au [email protected] Sport [email protected] Gold Coast goes Pro Fishing with the tides The women of the water will The top 17 women will spring Surfing Queensland, Quick- David Solano With the low out-going tide I ended up fishing a flathead have their eyes on Gold Coast back into action this weekend silver, and local business Con- on the weekend, I knew any run up river from Drydock this week in preparation for for the opening event of the necting Southern Gold Coast I love to go fishing early in the venture out was always going Road, always hard fishing on the Roxy Pro due to start on 2011 ASP Women’s World Title have decided to assist with im- morning. to be a struggle. the extreme run out. Saturday. season and the world’s best fe- proving this world-class event I did manage to catch a cou- It still has not been con- male surfers as they start their by funding a free ‘Park ’n’ Ride’ ple of flatties but really I should firmed if ASP World Champi- respective campaigns. shuttle bus service on each of have slept in and waited for the on and local surfing sweetheart Running in conjunction the two Saturdays and Sundays tide to rise a bit. I think there is Stephanie Gilmore will hit the with the women’s event will be of the event. Look out for drop- a little truth to the saying ‘No waves for the her fifth bite of the running of the Quicksilver off and pick-up areas around Run, No Fun’. the title apple after her recov- Pro. the Gold Coast. I headed home early before ery from an attack that saw her With the likes of Kelly Slater, Look for the camps at Snap- the crowd arrived, though I did left arm broken last December. Jordy Smith, Taj Burrow and per Rocks, Duranbah and Kir- run into another lizard hunter The entire pro cohort are Mick Fanning just the creme ra breaks or for more informa- – Frank is his name, a local pumped for both the Roxy Pro on the cake, this event will defi- tion on locations or the lead up fisho, and he knew his game. and the Quicksilver Pro which nitely set the stage for the rest to the events visit the websites: Rods rigged with various will both run between Febru- of the season and the guys are www.quiksilverpro.com.au plastics including the famous ary 26 and March 9. really fired up. and www.roxypro.com.au. ‘Nuclear Chicken’ coloured minno. The lucky guy had the whole morning off so was Students drenched at swim carnival going to hang around for the push in tide. Murwillumbah East Primary I checked out the weigh-in School students braved tor- at the local Seagulls Fishing rential downpours last Tuesday Competition on Sunday morn- to participate in their annual ing and it seems that Taylor swimming carnival at Tweed and nice size Darts are show- River Aquatic Centre in Mur- ing up in numbers off the local willumbah. beaches. It was an action-packed day where students of all ages had Q If you have any fishing news the opportunity to compete in and hints and tips you would a wide range of races as well like to share with David, email: as enjoying some fun water Tough going, but always fun – David with one of his flathead [email protected]. games and activities organised by the school staff. pion), and Lucas O’Connor The occasional heavy show- (senior boy champion). er did nothing to dampen the Proficiency and safety in the enthusiasm of the children as water is a high priority for our they made the most of their students as the majority of our day at the pool. families spend a great deal of More than twenty students time at our fantastic beaches have progressed to the district and waterways. For this reason swimming carnival where they developing good water safety will represent their school skills and strong swimming against other public schools in techniques has always been a the area. focus of the fitness program at This group of students in- Murwillumbah East. This also cludes the following age cham- leads to a very high number of pions of Murwillumbah East’s students taking part in swim- ming races at our swimming swimming carnival: Darcie No- New moon March 5 07:46 20:03 carnival. ble (junior girl champion), Cal- First quarter March 13 10:45 MARCH 2011 lum Wise (junior boy cham- Full moon March 20 05:10 Astronomical data pion), Erica Mellor (11 year girl MONTHLY MARKETS Third quarter March 26 23:08 and tides champion), Liam Parker (11 1st Sat Brunswick Heads (02) 6628 4495 Day of Sun Sun Moon Moon High tide, Low tide, month rise set rise set height (m) height (m) year boy champion), Jordan 1st Sun Banora Point Farmers’ Market 0417 759 777 1 T 0637 1919 0308 1658 0700,1.59; 1940,1.29 0028,0.60; 1343,0.44 Dickinson (senior girl cham- 2 W 0638 1918 0404 1734 0745,1.62; 2017,1.36 0118,0.54; 1419,0.40 1st Sun Byron Bay (02) 6680 9703 3 T 0638 1917 0459 1807 0824,1.64; 2051,1.41 0201,0.50; 1451,0.37 1st Sun Pottsville (02) 6676 4555 4 F 0639 1916 0552 1838 0859,1.64; 2124,1.46 0240,0.46; 1521,0.36 1st Sun Tweed Heads (07) 5599 1714 Malfunction: what’s SUP? 5 S 0640 1915 0644 1907 0931,1.62; 2155,1.50 0316,0.44; 1549,0.36 2nd Sat Kingscliff (02) 6674 0827 6 S 0640 1914 0736 1937 1004,1.58; 2226,1.54 0352,0.43; 1616,0.38 2nd Sun The Channon (02) 6688 6433 7 M 0641 1912 0827 2007 1037,1.53; 2258,1.56 0429,0.43; 1644,0.40 2nd Sun Chillingham 0437 041 023 8 T 0641 1911 0920 2040 1111,1.46; 2330,1.56 0506,0.45; 1713,0.45 2nd Sun Lennox Head (02) 6672 2874 9 W 0642 1910 1013 2115 1146,1.38 0545,0.49; 1743,0.50 2nd Sun Coolangatta (07) 5533 8202 10 T 0643 1909 1108 2155 0007,1.54; 1226,1.30 0629,0.54; 1816,0.56 2nd Sun Tweed Heads (07) 5599 1714 11 F 0643 1908 1203 2239 0048,1.52; 1311,1.21 0717,0.59; 1857,0.62 12 S 0644 1907 1259 2329 0136,1.48; 1406,1.15 0816,0.62; 1948,0.67 3rd Sat Mullumbimby (02) 6684 3370 13 S 0644 1906 1353 0235,1.46; 1518,1.11 0929,0.63; 2058,0.70 3rd Sat Murwillumbah Cottage Markets 14 M 0645 1905 1444 0024 0345,1.48; 1642,1.14 1044,0.58; 2217,0.68 0417 759 777 15 T 0646 1903 1532 0125 0456,1.56; 1752,1.22 1148,0.49; 2330,0.59 3rd Sun Ballina (02) 6687 4328 16 W 0646 1902 1617 0228 0600,1.65; 1847,1.35 1243,0.38 3rd Sun Banora Point Farmers’ Market 17 T 0647 1901 1700 0334 0655,1.75; 1936,1.48 0030,0.48; 1330,0.27 0417 759 777 18 F 0647 1900 1740 0442 0746,1.83; 2022,1.62 0127,0.36; 1415,0.19 3rd Sun Nimbin (02) 6689 0000 19 S 0648 1859 1820 0550 0836,1.86; 2108,1.74 0220,0.25; 1458,0.15 3rd Sun Pottsville (02) 6676 4555 20 S 0649 1858 1900 0658 0927,1.83; 2154,1.82 0314,0.19; 1541,0.16 3rd Sun Tweed Heads (07) 5599 1714 21 M 0649 1857 1943 0808 1017,1.75; 2241,1.87 0407,0.16; 1623,0.21 3rd Sun Uki (02) 6679 9026 22 T 0650 1855 2028 0917 1109,1.63; 2330,1.86 0502,0.18; 1707,0.29 23 W 0650 1854 2117 1026 0045,1.70 0559,0.25; 1752,0.40 4th Sat Kingscliff (02) 6674 0827 24 T 0651 1853 2211 1132 0019,1.81; 1258,1.35 0659,0.33; 1840,0.52 4th Sun Bangalow (02) 6687 1911 25 F 0651 1852 2307 1233 0114,1.72; 1358,1.23 0703,0.43; 1933,0.62 Stand Up Paddleboards: you the SUPs have grown into a sig- With so much on offer the 4th Sun (in 5 Sun month) Coolangatta 26 S 0652 1851 1327 0213,1.62; 1508,1.16 0913,0.50; 2038,0.70 see them everywhere, out the nificant part of the event with Malfunction Surf Festival (07) 5533 8202 27 S 0652 1850 0005 1416 0320,1.54; 1625,1.16 1023,0.55; 2153,0.73 back picking up swells long both surfing and racing divi- held from March 23 to 27 at 4th Sun Murwillumbah 0422 565 168 28 M 0653 1848 0103 1458 0432,1.50; 1734,1.20 1126,0.55; 2306,0.71 before they become waves, sions for pros and amateurs. Kingscliff, is an event not to 4th Sun Tweed Heads (07) 5599 1714 29 T 0654 1847 0200 1535 0537,1.50; 1827,1.27 1219,0.53 30 W 0654 1846 0255 1609 0630,1.51; 1909,1.36 0009,0.66; 1301,0.50 gliding along rivers and estu- For those that may be new to be missed. 5th Sun Nimbin (02) 6689 0000 31 T 0655 1845 0348 1640 0714,1.52; 1946,1.43 0100,0.60; 1338,0.47 aries, advertising in all the surf SUPs there will be displays of For further information on 5th Sun Tweed Heads (07) 5599 1714 All times Eastern Daylight Saving. Time lags: Ballina magazines and at all the major various boards and equipment, entry forms or how to become Boat Dock: 15 min; Byron Bay: nil; Brunswick River FARMERS MARKETS Highway Bridge: high 30 min, low 1 hr; Mullumbimby: 1 longboard events in Australia. as well as demonstrations for involved as a sponsor please hr 10 min; Billinudgel: 3 hr 55 min; Chinderah: high 1 hr Each Sat 8-11am Bangalow (02) 6687 1137 30 min, low 2 hr; Terranora Inlet: high 2 hr 10 min, low 2 hr Since the Malfunction first those wishing to try out a SUP, visit www.malfunction.com.au Each Thu 8-11am Byron Bay (02) 6687 1137 25 min; Murwillumbah: high 2 hr 30 min, low 2 hr 50 min. made room available in the during the Malfunction Surf or phone 0414 569 208. Tides in bold indicate high tide of 1.7m or more and low Each Tue New Brighton (02)6684 5390 tide of 0.3m or less. program for a couple of heats, Festival. Photo: Keahi de Aboitiz – ASP Australasia Each Sat 8am-1pm Uki (02) 6679 5438 Data courtesy of the National Tidal Centre. www.tweedecho.com.au 011001110011101011001100010110011100110111001100111001110101100110001011001110 BEAUTY 011011100110011100111010110011000101100111001101110011001110011101011001100010 110011100110111001100111001110101100110001011001110011011100110011100111010110 TWEED ECHO 011000101100111001101110011000101100111001101110011000101100111001101110011000%PDUPS%BUB3FTDVF MOBILE HAIRSTYLIST Over 20 years experience. Colour specialist. Kingscliff area ....0431 607 968 Have you lost +DVGDWDEHHQ &DOO'RFWRU'DWD5HVFXHWRGD\ LPDJHVYLGHRV IRUPDWWHG /RZUDWHV SERVICE DIRECTORY GRFXPHQWV ? GHOHWHG ? )DVWORFDOVHUYLFH BLINDS & AWNINGS PXVLF GDPDJHG Full colour display ad only $35 per week – 85mm x 28mm. 0419 146618 :HFDQUHFRYHUIURP KDUGGLVNV86%IODVKGULYHVLSRGVPSSOD\HUV Line listing only $80 for 12 weeks. Full year prepaid $280. $//&857$,16 %/,1'6 6+877(56 &'V'9'VGLJLWDOFDPHUDVWRUDJH 6'HWF Deadline for additions and changes is 12pm Monday. Enquiries: 02 6672 2280 or [email protected] Byron & Tweed’s Authorised Service Provider THE TWEED SHIRE ´1(:6+2:5220µ8QLW&(17(11,$/&7%<521%$< Lightforce Computers 02 6685 8796 2SHQ0RQ)UL SP)UHH0 4 1/10 Brigantine St • Arts & Industry Estate • Byron Bay BUILDING TRADES info: lightforce.com.au • hrs: m-th 9-6 • fri 9-5 • sat 9-1 ACCOUNTANTS GARY HEWITT BRICKLAYING Lic 164155c No job too small ...... 02 6684 9102 or 0437 185 483 TWEED MOBILE COMPUTER SERVICES ACCOUNTANT Jeannie Anderson ...... 02 6672 4044 s (ARDWARE SOFTWARE REPAIRS s )NTERNET CONNECTIONS s (OME SERVICE BOOKKEEPING Annette Stanton. MYOB. BAS agent ...... 0419 627 506 ARCHITECTURAL TIMBERS s .O JOB TOO SMALL s PROMPT SERVICE STAIRS small business JACK MANTLE Ben Cullen Dip I.T. INTERNAL / EXTERNAL 0412 593 511 Easybooks$ specialist OPEN / CLOSED RISERS Bookkeeping and Business Services your books 0408 740 480 / 02 6684 3378 CONCRETING s 3AY 'OODBYE TO BOOKWORK STRESS s ) COME TO YOU made easy! s #OVERING ALL YOUR BUSINESS NEEDS s 1UALIl ED s )NSURED s !4/ $ COMPLIANT 3TEVE -ILLER 0427 272 853 / www.easybooks.net.au MSG Mako Concrete Constructions AIR CONDITIONING !LL ASPECTS OF CONCRETE .O JOB TOO SMALL #ALL NOW FOR A FREE QUOTE 0H 0403 053 073 EMAIL AARON ALEXIUCCOM making ,IC # cool Energy effi cient. Quiet. waves Comfort all year round. AIR CONDITIONING & REFRIGERATION Avoid the extremes DECKS, PATIOS & EXTENSIONS s 3!,%3 s 3%26)#% s ).34!,,!4)/. with Daikin. 2ESIDENTIAL COMMERCIAL AIR CONDITIONING WITH OVER YEARS EXPERIENCE s &AX s WWWCOOLITACCOMAU “ To build a home that OUR $%3)'.3 0H will last long into the PATIOS & EXTENSIONS BSC Lic 1180797 NSW Lic 178680C ARC AU05854 future, fi rst we must YOUR (/-% Lic 207223C build a long future” We have the Vision EVERYONES &5452% Experience Solution. BUILDING SUSTAINABLY WWWE CONSTRUCTCOMAU We design and build Lic ARC L035475 TO YOUR BUDGET patios, decks and NSW 144581C Licensed Builder – 218298C extensions to suit The outdoor lifestyle specialists FUSION AIR BSA 1180098 your lifestyle needs: AIR CONDITIONING ELECTRICAL MECHANICAL VENTILATION 02 6687 2881 Servicing Call today for FREE [email protected] the Tweed and s 0ROPERTY MAINTENANCE design consultation. www.trueline.net.au I Ducted and split system air conditioner s )NSURANCE WORKS s 4RADE SERVICES installations – including electrical Northern Rivers s #LEANING s ,ANDSCAPING I Installation packages to suit all budgets Matt Curtis 15 YEARS I Sales, Service and Repairs 0419 791 193 2YAN 0EDERSON n -ARTIN (ORDPENKO n 0404 379 269 CASTLE EXPERIENCE HPSERVICES YMAILCOM Deal direct ANTENNA INSTALLATION PATIOS & CARPORTS with the owner AIRCON CLEAN – $80 Affordable Outdoor Living with Style 0418 953 545 Lic 174952C TV ANTENNA SERVICES BUILDER s 3ATELLITE SYSTEMS s !-&- RADIO Renovations, additions, decks, new homes, pole homes, s (OME AUDIO s 3ALES s 3ERVICE kitchen renovations & insurance work. DESIGN & DRAFTING Graeme Archer &REE QUOTES FREE INFORMATION YEARS LOCAL No job too small! Call Scott Anytime. ATELIER Deirdre J Gorrie Residential Design ...... [email protected] 6677 1523 EXPERIENCE MONTH WARRANTY ON ALL INSTALLATIONS 0415 767 952 AH 07 5590 7438 0OINCIANA !VE "OGANGAR s NSW Lic 592C Qld Lic 22821 GARDEN DESIGN, FENG SHUI www.simplybeautifulspaces.com.au .Lyn 0428 884 329 or 6685 7756 GERARD BISSHOP Design, extensions & carports ...... 0407 151 740 or 02 6676 3405 WWW.BUILTPRACTICE.COM Design & Drafting. Chris Knapp ...... 0405 914 569 ELECTRIC MOTOR REPAIRS All aspects of carpentry. Qualifi ed, friendly & professional. Free COMPETITIVE quotes for all work – call Simon: TWEED ELECTRIC MOTORS 0427 633 703 / 02 6674 4709 Lic 227281C Sales & Service Pool pumps, electric motors, power tools, electrical equipment & repairs CLEANING Unit 2/42 Machinery Drive, Tweed Heads South 07 5524 7055 ANTENNAS GENERAL CLEANER Honest, reliable, experienced, reasonable rates...... 0428 376 059 Fix your DIGITAL TV IS YOUR SHOWER MOULDY? I can clean it for you ...... Rob 0439 575 536 ELECTRICIANS reception NOW NO FIX NO CHARGE* ALL ELECTRICAL WORK No job too small. Lic 230464C ...Michael 02 6677 0122 or 0411 518 675 *conditions apply CURTIS ELECTRICAL 24 hour service. Lic 79065C ...... 0427 402 399 s $6$ VIDEO SETUP s .EW 46 SOCKETS RIC VESSIERE ELECTRICIAN Lic 223948C ...... 02 6677 1195 or 0407 588 181 s 3URROUND SOUND SETUP s .EW PHONE SOCKETS s &LAT 46 WALL MOUNTING s 0ENSIONER DISCOUNTS David Levine s &- RADIO ANTENNAS s ,IC ELECTRICAL CONTRACTOR 2 Pauls Electricians All electrical work, including home 0402 022 111 WWWIWIRENETAU $)')4!, 46 !.4%..!3 "92/. "!9 maintenance and air conditioning systems Email: [email protected] NSW: 218495C, Qld: 70561 ARCHITECTS Blind & Curtain Cleaning & Repairs Paul Taylor 0412 506 536 Verticals Curtains 4IMBER (OLLANDS Romans JOSE DO Sustainable Architecture. Reg. 7647 www.josedoarchitect.com...... 0424 062 096 07 5523 3622 SPACE STUDIO We design buildings & their interiors. www.spacestudio.com.au ...... 02 6680 9921 %NTERPRISE !VE 4WEED (EADS 3OUTH Ernst Max Mann ASBESTOS REMOVAL COMPUTER SERVICES Electrical Contractor 02 6677 1943 / 0410 314 897 ALL RESIDENTIAL ASBESTOS REMOVAL ...... 0407 261 213 MOBILE COMPUTER REPAIRS $70 per hour. Established 15 years ...... Ben 0423 355 318 Lic EC 26523 D&L LONG DEMOLITION All areas ...... 0416 163 699 WiseGal Computer Service Internet, software & hardware, networks, tuition ...... 0405 929 371 24 February 24, 2011 Th e Tweed Shire Echo www.tweedecho.com.au FENCING LIGHTING REMOVALISTS BEDNARZ, H & W, FENCING Specialise in pool, colourbond & timber fencing ...... 07 5590 4540 TOP OF THE STATE FREIGHT Delivering Tweed, Lismore, Ballina daily ...... 0418 664 236 BENS FENCING – RELIABLE, PROMPT, QUALITY 7 days ...... 0409 983 565 EDL Prompt & reliable service ...... 0432 107 262 /RFDO FENCING & RETAINING WALLS BSA Licensed. Free quotes. Any area ...... 0411 594 314 &RXQWU\ FRONTLINE FENCING & LATTICE Pool, Colourbond & Lattice. Lic 212208c ...... 07 5524 1842 NORTHERN RIVERS FENCING All fences, will beat any quote ...... 0421 75 5978 ,QWHUVWDWH FLOOR SANDING & POLISHING /2&$/6<'1(<*2/'&2$67%5,6%$1(0(/%2851( 02 6684 2198 [email protected] t4BOEJOHQPMJTIJOH NATUROPATH Supply & instalation of: t1SFmOJTIFEnPPST SHIRE TRANSPORT t5PVOHFHSPPWF t$PODSFUFHSJOEJOH 9OUR 0ROFESSIONAL (EALTH #OACH FREIGHT & REMOVALS QPMJTIJOH 4RACEY ,EE -ORLEY .$ $"- UÊÀi} ÌÊÃiÀÛViÃÊÌÊ ÀÃL>iÊ ÊEÊ7i`Ê Martin Hordpenko UÊ >ÀÀiÀÃÊvÊwÊiÊ>ÀÌÊUÊ ÊÛiÃÊ tnPPSTPGEJTUJODUJPO!ZNBJMDPN YEARS %XPERIENCED 0RACTITIONER UÊ L>ÞÊ«VÊÕ«ÊEÊ`iÛiÀÞ 6687 6445 / 0409 917646 GARDEN & PROPERTY MAINTENANCE #OOLAMON 3CENIC $RIVE -ULLUMBIMBY WWWALTERNATIVE NATURAL REMEDIESCOMAU AUSSIE MOWERMAN TWEED HEADS...... Kris 02 6674 3695 or 0439 612 061 CLEAN CUT lawns & maintenance. Rubbish removal. Free quotes ...... Tim 0434 712 161 DAN YATES GARDEN SERVICES Qualifi ed horticulturist ...... 0407 540 700 or 02 6679 1427 PAINTING WOLLUMBIN TREE SERVICES Qualifi ed arborist. Pruning, removals, economical ....0427 015 923 MAINTENANCE Professional Painting Prestige & REPAIRS & Decorating s 'ENERAL HOME MAINTENANCE s ,AWN MOWING s 0RESSURE CLEANING s 'ARDENING LANDSCAPING Specialising in: Customer Service, s 2UBBISH REMOVAL s (EDGING TREE TRIMMING Residential Homes, Interiors & Exteriors 0HONE 3TEVE Joel Watson 0404 202 415 CRANE TRUCK FOR HIRE FOR A FREE QUOTE 07 5524 3202 Fully insured Lic No. 211420C -ULLUMBIMBY BASED Local Lawn Mowing & s $OMESTIC s #OMMERCIAL s $RIVEWAYS CLEANED SEALED $OUG Garden Maintenance ROOFS! 7AYNE Reliable, professional service including: !* )TONG 0AINTING 7E ALSO whipper snipping, hedge trimming, weeding, RESTORE ROOFS rubbish removal & spring cleanups ROOFING From $30 – ring Woz for a free quote 0412 613 916 0458 795 659(bh) 6679 5659(ah) Lic NSW 129316C Lic Qld 1014447 ALL ROOF REPAIRS, CLEANING & PAINTING ...... 0407 261 213 HIRE QUALITY JOB 18 years experience. NSW Lic 129316C, Qld Lic 1014447 .Adrian Itong 0412 613 916 PEST CONTROL ROOF PAINTING & REPAIRS Free quotes. Lic 1134084 ...... Joe 0414 587 884 BYRON WEDDING & PARTY HIRE ... www.byronbayweddingandpartyhire.com.au 02 6685 5483 MULLUM HIRE Wedding and party hire ...... www.mullumhire.com.au 02 6684 3003 ARACHNID PEST MANAGEMENT Environmentally friendly ...... 0409 497 706 LANDSCAPING & EXCAVATION ROOFING BASALT BUSHROCK Highgrade. Rock walls. Cheap prices ...... Rolly 0408 860 543 CRAFTSMEN 6 GENERATIONS IN ROOFING BRENDON POWELL Bobcat, excavator, tipper & auger. All jobs...... 0404 988 222 522)5(6725$7,2165(522),1*5(3$,56)5((4827(6 FENCING & RETAINING WALLS BSA Licensed. Free quotes. Any area ...... 0411 594 314 Honest, reliable, all work guaranteed. ZZZURR¿QJFUDIWVPHQFRPDX Specialising in ACME tBMMTUZMFTPGQBWJOHCSJDLXPSL tJSSJHBUJPOtSFUBJOJOHXBMMT PEST CONTROL local tUVSGBSFBTtXBUFSGFBUVSFT 25 years BOEBMMBTQFDUTPG QBWJOHBOEMBOETDBQJOH Cockroaches a specialty $/-%34)# #/--%2#)!, ).$5342)!, Over 20 yrs experience - friendly reliable service -%4!, 2//&).' Ring Dean on 0417 856 212 GUARANTEED RESULTS Preferred insurance repairer #RAIG -ONTGOMERY ,IC # PHONE 13 579 0418 751 972 TINY EARTHWOR RUBBISH REMOVAL Philip Toovey 0409 799 909 PLUMBING ph/fax 02 6684 3208 OCEAN SHORES SKIPS Mini skip specialist ...... 0412 161 564 various implements available for limited access projects PLUMBING & GAS SOLUTIONS #ALL 'ARY NOW EXCAVATOR "LOCKED DRAINS .EW WATER HEATER FOR A FREE QUOTE BOBCAT & 7HATEVER YOUR PLUMBING NEEDS WE HAVE THE ANSWER !VAILABLE &2%% QUOTES 0421 999 018 WATER TRUCK Personalised, professional .ATHAN 0432 511 579 s 4)0 425#+3 s &,/!4 s 425#+ $/'3 s $2)6%7!93 approach to OR 02 6676 0098 s 2/!$3 s (/53% 0!$3 s #,%!2).' s $2!).!'% s #!20!2+3 your plumbing 4RISTAN 0458 025 747 s "53( 2/#+3 s 2/#+ 7/2+ s -!#().% 4)#+%43 requirements. PLUMBJET GMAILCOM WWWTWEEDSKIPSCOMAU ALL MATERIAL DELIVERIES 0, 1UENTIN 0404 193 933 t4BNFEBZSFTQPOTF LICENSED BROTHELS tQFOTJPOFSEJTDPVOU COWBOYS CAR REMOVALS t"MMQMVNCJOHNBJOUFOBODF FREE PICK UP t1MVNCJOHHBTmUUJOH !LL SCRAP METAL WHITE GOODS FARM MACHINERY t(VUUFSJOHEPXOQJQFSFQMBDFNFOU /48-JD$2ME-JD 7$ ACCESS s ,OCAL TOWING SERVICE Venus Lounge ,IC .37 Gentlemen’s Retreat $BMM ZPVSMPDBMQMVNCFS0409 848 800 0H&X 02 6677 9443 -OB 0421 251 477 OUTCALLS AVAILABLE – OPEN 24/7 PRINTER TONERS & CARTRIDGES SCREENPRINTING 0RUWRQ6WUHHW&KLQGHUDK Black Orchid OPEN 7 DAYS A WEEK /P(SFH$IBQQFMM%SJWF #VSMFJHI)FBETr www.tweedecho.com.au Th e Tweed Shire Echo February 24, 2011 25 OSTEOPATH SELF STORAGE A biodynamic approach to Osteopathy PAINTING in the cranial fi eld 18 yrs exp. Lic NSW 129316C & ECHO CLASSIFIEDS QLD 1014447. Domestic, commercial. ANDREW HALL We can also do roof restoration & clean Monday to Friday every 2nd week & seal your driveway. 0412613916 6672 2280 New Brighton. 66802027 Not your usual Osteopathy FOR SALE MULLUMBIMBY 2ND HAND PHONE ADS Sexual Counselling Huge range of French doors, 4 panel Alison Rahn qualifi ed sex therapist Ads may be taken by phone on 02 6672 2280 doors, bi-fold doors, windows, hardwood www.alisonrahn.com.au 0432599812 9am-12pm Wednesday, 9am-5pm Monday to Friday. timber, VJ lining, all building materials, Ph 66841246 or 66843063 Ads can’t be taken on the weekend. KINESIOLOGY BY POST Clear subconscious sabotages. THE TWEED Reprogram patterns and beliefs. BAMBOO PLY PO Box 545 De-stress. Restore vibrancy and from $10.50sqm & Bamboo Flooring . For ceilings, walls, doors, etc. Murwillumbah 2484 physical health. Clear allergies. REMOVAL SANDRA DAVEY , Reg. Pract. 66846914 Ph 66884188 - sample & brochure RATES & PAYMENT www.bambooply.com.au CHILD CARE $15.00 for the fi rst two lines (minimum charge) TIMBER , pine, treated pine, hardwood, mouldings, sleepers, fencing, Koppers $5.00 for each extra line (these prices include GST) CHILD CARE/NANNY 15 yrs exp. Great logs, ply, MDF, lattice, made to order. references. Linda Flower 0421892812 Cash, cheque or credit card – Mastercard or Visa. Brims Builders Hardware , Billinudgel 02 66801718, Sth Tweed 07 55236002 Prepayment required for all ads. FOR HIRE DEADLINE EVENT & PARTY HIRE FIREWOOD 12pm Wednesday for display ads and line ads. Audio & lighting. 0418676534 or 7 Day Access s EVENTHIREDAFNIS GMAILCOM DELIVERIES - HONEST & RELIABLE - ACCOUNT ENQUIRIES phone 02 6684 1777 Best rates & service in the Shire. PIN Code Entry TREE SERVICES Phone Matt 0427172684 REMEDIAL MASSAGE THERAPIST MAG WHEELS 17” ultra light racing, tyres PUBLIC NOTICES Dip & REGISTERED NURSE Range of Sizes with 70% tread, new $1700, sell $550. Ph Clinic Thurs, Banora Pt, $55ph, Jay 0421485217 relaxation, lymphatic drainage. Private PURE ANIMAL nursing - rehab/respite by arrangement. THE RUG SHOP BANGALOW COMPUTER 2nd hand, complete package, Ph 55247183, 0414511275 66872424 FOR ALL YOUR monitor, keyboard, speakers, software incl, PROFESSIONAL TREE CARE NEEDS! 3 years old, very good cond, $675 ono. TRADITIONAL THAI MASSAGE 6672 3211 s 2%-/6!,3 s 0!,-3 s 42%% 352'%29 07 55904280 ECHO ECHO Thai masseur, 1hr $40 & 2hrs $65 s 02/&%33)/.!, #,)-"%23 s” v v 57 Quarry Road, MURWILLUMBAH Ph Nui 66771670, 0410519341 #()00%2 s &2%% 15/4%3 s &5,,9 ).352%$ @#%24 (/24!2" s 345-0 '2).$).' s WANTED DOUBLE DEAL 42%% 2%0/243 $! !00,)#!4)/.3 Double your exposure. Your ad will Carmine 6685 4015 - 0401 208 797 appear in over 40,000 newspapers Midlife 2ND HAND aluminium bronze glass SOLAR INSTALLATIONS sliding doors 2400 x 2100. 0402779376 weekly. Ask us about our great deals Weight Gain? when you advertise in both Our natural formulations aid in TRADEWORK U -/ /" - THE TWEED SHIRE ECHO & addressing body imbalances GARAGE SALES U, *,-ÊEÊ-1** - THE BYRON SHIRE ECHO (eg hormones) which may have SOLAR Phone 02 66722280 or 02 66841777 BRUNSWICK VALLEY contributed to your weight problem. Clutter Overload? Ph Heidi at The Natural Way Servicing this area for 11 years. SYSTEMS SUBSCRIBE TO THE ECHO DIGGER MAN Time to clear it out with a garage sale. Lic. Electrical Contractors If you want to be sure of your copy each 0412638398 for a free consultation Excavator & tipper hire. 0427172684 Ph us on 66722280 to advertise here. week, or if you have a friend who’d like Your local installer dealing in Sharp Solar Modules, Australian made Latronic Inverters and to have a subscription, why not send Century/Yuasa batteries. Specialists in Standalone and Grid Interact Solar Power Systems. MOTOR VEHICLES them one? $35 per quarter or $125 per SPIRITUAL ASPIRANTS AND HEALERS P: 02 6679 7228 E: [email protected] www.sunbeamsolar.com.au year, post incl. Write to ‘The Echo’ TOYOTA COROLLA SECA 93 man, exc 6 Village Way, Stuart St, Mullumbimby Create a QUANTUM SHIFT IN YOUR LIFE 1st car, rego 10/11 $2400 ono. 66845269 2482 including payment in advance. AND WORK via a short, powerful ADVANCED VW GOLF 2000 4th Gen GL, man, only Solar Power Systems & Electrical ENERGYBODY TRAINING 132,000km, CD, rare fi nd, black with black ENROL NOW After 14 years research in Energy Science, International teacher leather & sunroof. $9,600. 0413618832 1.5kw system $12,000 (fully installed) Cert. IV + Diploma in Kinesiology begin 12 Mar. Free intro Burleigh 3 Mar. Sri’ama Qala Phoenix offers the Master Teachings, Practices VW TRANSPORTER 2000 2.5L, LWB, A rewarding career in natural health. for development of Your Quantum Light Frequency Field. auto, 5 seat, a-c, t/bar, racks, 9 mths reg, Call Darren 0412 693 189 Ph 66857991 www.wellness.net.au Create your complete clarity, raise your vibration powerfully and vgc, $8800. Ph 66771730, 0419662981 Email: [email protected] THAI MASSAGE COURSE manifest your life projects/healings more quickly, with love. Learn acupressure, refl exology, www.qalasriama.com CAR BODIES relaxing, deep tissue techniques & a TILING 1hr massage. 12/13 March with Carla The Lotus Temple, 5 Wollongbar St, Byron Bay Arts Industry Estate REMOVED FREE Ireton,16 yrs exp, $220. 0401802737 A 3 part series of one day classes, March 13, 27 & April 10 $$$s for most. Bookings/info Raphia 02 6685 8658 [email protected] Phone 0418189324, 0438189323 CERAMIC TILER Lic 161050C. Robbie ...... 0409 368 046 EVENTS RON: WALL/FLOOR TILER Waterproofi ng. Lic 1089627 ...... 0407 374 013 HUGE SAVINGSThis Months Endermologie BEGINNERS CRYSTAL Specials Responsible Beauty TREE SERVICES WORKSHOP For over 25 years, LPG Systems Come and have a fun day holistic gym & medispa Personal Training (France) medical devices have POWER CLEAR TREE SERVICES Murwillumbah & Tweed ...... 02 6672 8954 1 hr $30 been treating dermal disorders learning about crystals. 35 Burringbar Street of face & body. $80, bring lunch. Mullumbimby 6 Month Membership $390 WATER FILTERS plus complimentary Sauna 6684 2719 100% natural cellulite removal, At 51 Lorien Way, Kingscliff . 5 Pack scar & wrinkle reduction. BOOKINGS ESSENTIAL Membership includes personal training, For more information & bookings, Phone Maree, 02 6679 7291 gym classes & vibration machines contact Mullum Sari Medi-spa clinic ph 6684 1644 Iyengar Yoga School @V\Y6UL:[VW *VTWHYL[OL]HS\L +HDG7HDFKHU6LPRQ00DUURFFR :DWHU,RQL]HUV :DWHU'LVWLOOHUV :DWHU)LOWHUV Mullum Sari - see timetable below Health & Beauty Special Tweed Valley )VK`HUK-HJL,UKLYTVSVNPL[YLH[TLU[ (\Z[YHSPH»Z)LZ[9HUNL6M>H[LY7YVK\J[Z ^P[OJVSVUPJHUKV_`NLUJOHTILYZLZZPVU >H[LY:OVW Mon 10am Wed 6pm (Beginners), Sat 10am )UHHFDOO ([3VJHS7YPJLZ $220 ZZZYLWDOLW\OLIHFRP 0HQWLRQWKLVDGGIRUD'LVFRXQWRQRXUHQWLUHZDWHUUDQJH Simon $20 Claire & Julie $15 Yoga Detox Retreat Privates Easter Weekend 22-26 April MULLUMBIMBY... THE HEALTHIEST PLACE ON EARTHTM Simon $90 Claire $70 WEDDING SERVICES 6.30am 8am 10am 12.30pm 5.30pm Iyengar Teacher Training `VNHJVSVUPJZLUKLYTVSVNPL starting now V_`NLUIVK`ZJY\I Dance Moves Quick Fix Fitball THZZHNLSP]PUNQ\PJLZH\UHZ M (10 - 11am) (12.30 - 1pm) (5.30 - 6.30) TAILORED CEREMONIES BY WILL ALLAN ...... [email protected] 07 5590 9757 Michael Kristie Michael Hatha Yoga Total Body Pilates Mat Iyengar Yoga HEALTHY LIVING SHOPHOP T (6.30-7.30am) (9 - 10am) (10 - 11am) (5.30 - 7pm) WINDOW TINTING Mara Leanne Michael Simon* HEALTH Iyengar Yoga Iyengar Yoga Iyengar Yoga W (8 - 9.30am) (10 - 11.30) (5.30 - 7pm) SUNRISE WINDOW TINTING 30 years experience. Cars, homes, etc ...... 0412 158 478 Claire* Claire Claire* MISHKA MASSAGE positive & sensitive. Hatha Yoga Pilates Mat Whole Body Deep tissue work, relaxation. Byron/ Vibrodisc Lexen Vitalmax 750 T (6.30-7.30am) (10 - 11am) (5.30 - 6.30) Refurbished Mara Michael Leanne Mullum. Dip Rem. Ana 0413608927 Black/White 3 Yr Warranty Iyengar Yoga Iyengar Yoga Quick Fix FitBox F (8 - 9.30am) (10 - 11.30) (12.30 - 1pm) (5.15-6.15pm) WINDOW TINTING KA HUNA BODYWORK IN KINGSCLIFF Claire* Claire* Kristie Kristie Bring the joy of life to your body. ,\HQJDU Pilates Mat Iyengar Yoga S (8 - 9am) (10-11.30am) KHDOWKIXQG 1st massage 1/2 price at $40. Remember when people pro- testing in the council public gallery prompted then mayor Warren Polglase to threaten to close the whole gallery? One council watcher says it would be more democratic for only the people creating a disturbance to be chucked out, and praised the current mayor for ‘doing the right thing’ last week by hav- ing a noisy heckler removed and not closing the whole gal- lery instead. QQQQ Further to that story, it’s been pointed out that the person ejected from council’s public gallery was not a supporter of Elizabeth Jack (see right) and we apologise for any confu- sion. Backburner has been told that Ms Jack has never met the Eighty-year-old Elizabeth Jack hard at work as a volunteer on a community tree planting project woman in question. Our infor- on the Tweed River at Byangum. Elizabeth was told to ‘get a job’ by Cr Warren Polglase last mant also says, ‘Sure, pollies year and he was forced to apologise after he was found to have breached the councillors’ code insult each other all the time in of conduct which says councillors should treat others with respect. Members say Elizabeth is parliament but it doesn’t make ‘always fi rst on site, brushcutting, swinging the mattock and planting out the riverbank’. it a justifi cation for an “ex-ex- On Saturday, March 5, the Friends of Wollumbin Landcare will honour her with a tree planting mayor” to throw such an insult in an area to be known as ‘Elizabeth’s Corner’. Locals are invited to join the project from 8am, to such a valuable retired (but meeting at Kyogle Road, 2.5km south of Byangum Bridge. The revegetation project has seen still actively working) woman, thousands of trees established on public land, and is a joint riparian venture with Tweed Shire she doesn’t have to attend coun- Council. For info call Roland on 02 6679 5879. midlife waist cil meetings, doesn’t get paid to attend, but, as a concerned to have a policy report pre- QQQQ opportunity for young people resident, attend she does, every pared about measures to limit Katie walked into another who need support of this kind. month.’ the amount of rubbish swept hornets’ nest when she tried If you were a mother you would QQQQ into waterways at the time of to tinker with lease arrange- understand, councillor Milne.’ Have you noticed extra padding A fundraiser dinner dance for flood. She went on at some ments with a Murwillumbah Nasty enough, but then came around your waistline? fl ood victims to be hosted by length about the sight of con- boys’ boxing club. The club a ‘Th at won’t happen’ jibe from Weight tends to accumulate around the Luffl ey Café in Murwillumbah tainers bobbing down the has graced Murwillumbah’s Cr Phil Youngblutt. A slightly abdomen during the peri-menopause scheduled for this Saturday, Feb- Brisbane River before veteran Amwill Park for the past eight stunned Katie said ‘how rude’ years. councillor Dot Holdom de- to which Cr Youngblutt re- This gradual weight gain is often ruary 26, has been changed to years at a peppercorn rental associated with fl uctuating hormones next Saturday, March 5, at 7pm. scended from the clouds. ‘Have from the council and, in line sponded ‘Sorry, that won’t throughout menopause. Th e event costs $10 a head as you ever been in a fl ood?’ she with its dedication to assisting happen.’ During the alterca- Nusia (before) At the Natural Way we understand a direct donation, plus the cost demanded. ‘Who here has underprivileged kids, it sought tion, Cr Milne made a muffl ed Nusia Gent lost this the negative impact of of a meal with proceeds from been in a fl ood?’ she asked the to continue the lease arrange- remark concerning the honesty much weight the hormonal changes and have auctions and raffl es going to the council in general. All but Cr ments for another two years. of Cr Warren Polglase. An out- Natural Way! developed a weight loss Nusia (after) Queensland Premier’s Flood Milne volunteered they’d sur- Our Katie suggested that, while raged Cr Polglase threatened program addressing these Appeal. Tweed Valley busi- vived a fl ood. ‘If you’re caught it was all fi ne and dandy to sup- to leave the room unless he got body imbalances which nesses have donated raffl e priz- in a fl ood all you’re concerned port the local kids, what about an apology. Mayor Kevin Skin- contribute to this weight problem. es and auction items and that about is saving the child in your the needs of other community- ner directed Katie to apologise. well-known local spruiker and arms – your life,’ thundered Cr oriented groups? Wouldn’t it be ‘Sorry’ was all the aff ronted Cr Call Heidi now on auctioneer, Bernie Quinn, will Holdom. ‘Th e last thing you’re better to defer a decision until Polglase got. All he deserved 0412 638 398 be doing his fastest talking to get worried about is whether a plas- all worthy organistions could too, seeing that Cr Polglase top dollar for the many prizes tic bag has fl oated off .’ Cr Joan be considered? Th is brought a had earlier been carpeted for E: [email protected] on off er. Bookings 6672 8590. van Leishout chipped in that it’s stinging rebuke from Cr Dot breaching the council code of QQQQ awfully diffi cult to ensure stuff Holdom who said she’d ‘never conduct by telling pensioner Greens councillor Katie Milne didn’t break loose in a major heard such a mealy-mouthed Elizabeth Jack to ‘get a job’. Th e had her wings clipped momen- inundation. Th e council voted reason for deferring a decision’. brevity of his email apology www.thenaturalway.com.au tarily at the council meeting 5-2 to give Cr Milne’s motion ‘Th at dear little place just sits to the the anti-dam protester last week when she attempted the order of the boot. on that hill and provides an raised some eyebrows. ,/#!, "53).%33 n ',/"!, .%47/2+ s 9%!23 n BNI is an international referral-based business networking group with a successful chapter based in the Tweed. We meet every Thursday 8.15am–10am. Ash Grunwald March 22 Greg Sheenan March 8 BNI Eagle chapter passed over $2m in business amongst its members last year. BNI MEMBERSHIP VACANCY: BUILDING CONTRACTOR From our experience we believe that a building contractor could expect to receive many good quality referrals of business from our group. Juzzie Smith April 5 Phone our president Gabrielle Robertson on 0414 749 020. She will arrange an obligation-free visit to our meetings so that you can see how we do business... for you. 28 February 24, 2011 Th e Tweed Shire Echo