Life Sciences Venture Equity Market Review: the Evolving Role of Crossover Investors

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Life Sciences Venture Equity Market Review: The Evolving Role of Crossover Investors June 2021 Securities offered in the United States are offered through Torreya Capital LLC, Member FINRA/SIPC. In Europe such services are offered through Torreya Partners (Europe) LLP, which is authorized and regulated by the UK Financial Conduct Authority. The Market for Equity Privates in Life Sciences TORREYA | PRIVATE LIFE SCIENCES VENTURE FINANCING MARKET REVIEW – JUNE 2021 2 Total Private Venture Financing Volume: 2000-2021 H1 Given volumes in the first half of this year, there is little doubt that 2021 will shape up to be the most active year in history for private financing activity in the life sciences sector. Total Volume of Private Biopharma, Diagnostics and Tools 50000 Financing Rounds by Year Jan 2000 - June 2021 600 (deals over $25mm, excluding medical devices, worldwide) 45000 523 500 40000 35000 373 400 356 30000 334 25000 300 20000 224 226 Transaction Transaction Count 184 200 15000 145 138 121 122 111 10000 109 88 97 96 81 72 100 Aggregate Aggregate Dollar Volume of Private Financings ($mm) 55 5000 40 35 23 0 0 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 H1 Transaction Count Dollar Volume ($mm) Source: Torreya analysis and records, CapitalIQ and Crunchbase TORREYA | PRIVATE LIFE SCIENCES VENTURE FINANCING MARKET REVIEW – JUNE 2021 3 Fresh Venture Capital Flowing into Life Science Sector We are on track to see record amount raised in life science venture capital in 2021. Life Sciences Venture Capital Funds – Raised, $Billions $35 $30 $28.9 $25 $20 $15.4 $15 $14.1 $10.3 $10 $9.1 $7.4 $7.5 $7.5 $7.2 $6.6 $6.8 New Capital New Capital Flowing into Venture Funds ($bn) $6.1 $5.5 $5.7 $5 $3.8 $3.6 $3.9 $2.8 $2.7 $2.6 $2.8 $1.8 $0 2000 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 H1 Source: Venture fund press releases, Torreya analysis and records, CapitalIQ TORREYA | PRIVATE LIFE SCIENCES VENTURE FINANCING MARKET REVIEW – JUNE 2021 4 Fresh Venture Capital Flowing into Life Science Sector Over $10 billion flowed into life science venture capital funds in Q2 2021 – an all-time high Life Science Venture Capital Funds, Amounts Raised by Quarter ($millions) $12,000 $10,086 $10,000 $8,000 $7,796 $6,875 $6,467 $6,200 $6,000 $5,164 $4,000 $3,608 $2,412 $2,017 $2,180 $2,000 $1,582 $1,633 $1,564 $0 Q2 2018 Q3 2018 Q4 2018 Q1 2019 Q2 2019 Q3 2019 Q4 2019 Q1 2020 Q2 2020 Q3 2020 Q4 2020 Q1 2021 Q2 2021 Source: Venture fund press releases, Torreya analysis and records, CapitalIQ TORREYA | PRIVATE LIFE SCIENCES VENTURE FINANCING MARKET REVIEW – JUNE 2021 5 The Role of Crossover Investors TORREYA | PRIVATE LIFE SCIENCES VENTURE FINANCING MARKET REVIEW – JUNE 2021 6 The Role of Crossover Investors • We define crossover investors as late-stage investors that typically participate in the public equity markets but “cross over” to the private markets to gain exposure to attractive equity stories prior to an IPO. • In practice, the presence of crossover investors can be a major plus in structuring and executing a successful IPO. Often, they can reposition or even institutionalize the shareholder profile of a company. • “Cross-over” institutions offer implicit support for an IPO and often explicitly in the form of either insider commitments or anchor orders at the time of the IPO. • Hedge funds are the key drivers of the crossover market. Many of these funds have become large and are looking for new ways to deploy capital while earning a return, hence their increasing participation in privates. • Most hedge funds are allowed to put 5 - 10% of their capital into private investments. These investments are typically held in “side pockets” that are infrequently marked to market. There is substantial discretion on how and when such investments get marked to market. • Several hedge funds and mutual funds have created dedicated teams or subfunds just for crossover investments. For example, Perceptive, RA and RTW have created dedicated venture groups. • The crossover market is susceptible to closure in periods of financial uncertainty. Nevertheless, the crossover market reestablished itself in 2018. Since 2020 the market has taken off dramatically and activity thus far in 2021 is unabated. • Hedge fund managers in the life science sector are generally very strong scientifically and can often rival the in- depth knowledge of their counterparts in long-only funds. Some of the top life science hedge funds have substantially more highly qualified staff on hand than perhaps do the largest public funds. By way of example, Wellington Management (US) is the largest investor in biotechnology stocks with over $40 billion deployed. They have a handful of analysts (one with a Ph.D.). In contrast, Deerfield and Perceptive with less than $8 billion each, have far more analysts. RA Capital has an order of magnitude more analysts. TORREYA | PRIVATE LIFE SCIENCES VENTURE FINANCING MARKET REVIEW – JUNE 2021 7 Investor Types Most Often Seen in Crossover Rounds Crossover Funds Venture Capital Private Equity China Investors Family Offices Selected ▪ Adage Capital ▪ Abingworth ▪ General Atlantic ▪ 6 Dimensions ▪ Emerson Collective Examples ▪ Perceptive ▪ ARCH Venture ▪ GTCR ▪ Decheng Capital (Laurene Powell Jobs) ▪ RA Capital ▪ Forbion ▪ KKR ▪ Legend Capital ▪ Founders Fund (Peter ▪ T. Rowe Price ▪ Orbimed ▪ MVM ▪ Qiming Thiel) ▪ Sofinnova ▪ Invus (Eric Wittouck) Pros ▪ Highly scientifically ▪ Willing to do mid-stage ▪ A commercial launch ▪ Attracted to very good ▪ Attracted to very good knowledgeable ▪ Sophisticated and story can work well for stories stories ▪ Less valuation sensitive medically savvy private equity investors ▪ Tend to be less ▪ Interested in financing ▪ Can dictate terms ▪ Can perform due that are at the borderline governance focused and projects that have ▪ Help get an IPO done diligence that others can of venture (pre- are typically constructive medical impact and ▪ Light hand on leverage near closing commercial) and on boards benefit humanity governance ▪ Many like to lead commercial. ▪ Chinese government ▪ A subset of super high ▪ Supportive and helpful ▪ Collaborative and value ▪ Tend to write larger committed to building net worth investors and add checks than venture out life sciences associated family offices ▪ Less valuation sensitive understanding can invest $50m or more than venture into life sciences companies Cons ▪ Need to be fairly IPO ▪ Valuation sensitive ▪ Can be distracted and ▪ All China investors are ▪ Not always scientifically ready (18 months out or ▪ Can be conflicted very busy government-linked to sophisticated and able to less) ▪ Can have agendas driven ▪ Will often be deep in a some degree. Impacts evaluate opportunities ▪ Distracted. Hard to get by fund life subsector but not as their behavior ▪ Often have idiosyncratic focused on a story ▪ Slow process scientifically strong as ▪ Negotiating with some taste for investment ▪ Not necessarily ▪ Like control and demand crossovers funds not easy opportunities committed to future board representation ▪ Don’t like small check ▪ Communication can be ▪ Relationships with rounds. Less patient. sizes. less direct investor partners ▪ Want to build. important Key Points ▪ Least valuation sensitive ▪ Gives strong syndicate, ▪ Less valuation sensitive ▪ Very interested in life ▪ Super high net worth investor type time to prep for IPO than venture but more science space investors play an ▪ Not governance focused ▪ Term sheets from VCs committed to the long ▪ Can be valuation friendly increasingly important ▪ Distracted and not are the easiest to run than crossovers. ▪ Very “brand sensitive” role in financing life necessarily in for the long generate and can help a ▪ Can be highly committed sciences companies run. financing process to build-out / add-on ▪ Can be valuation ▪ Does not always need a ▪ Can be tough on terms stories insensitive lead investor and governance ▪ Relationship focused TORREYA | PRIVATE LIFE SCIENCES VENTURE FINANCING MARKET REVIEW – JUNE 2021 8 Review of Top Life Sciences Crossover Rounds YTD 2021 PreMoney Value Deal Size Lead Date Issuer Field Headquarters Series ($mm) ($mm) Investor(s) Investors Oncology May-21 Irving, TX -- $7,000 $830.0 Diagnostics Cell and Gene Tx Boston Mar-21 C -- $525.0 Companies Area, MA Low-cost cancer Boston Jan-21 B $1,070 $500.0 drugs Area, MA Bay Mar-21 AI drug discovery C $2,100 $400.0 Area, CA COVID-19 Boston Apr-21 C $1,400 $336.0 antibody Area, MA Sequencing May-21 Oxford, UK -- $2,500 $270.5 Tools 10 biotechs in Boston Feb-21 A $519 $250.0 one Area, MA Chengdu, Feb-21 Vaccines C $700 $230.0 China Boston Jan-21 MAPS Vaccines C $860 $226.0 Area, MA Apr-21 AI drug discovery Oxford, UK D $861 $225.0 In vivo cancer Jun-21 Seattle, WA B $450 $210.0 immunotherapy Bay Apr-21 Research Tools E $4,000 $200.0 Area, CA May-21 Research Tools Singapore A $600 $200.0 Difficult targets May-21 Delaware C $250 $200.0 in cancer Multicompany New May-21 -- $7,100 $200.0 Platform York, NY Jan-21 Cardiometabolic Netherlands A -- $196.0 TORREYA | PRIVATE LIFE SCIENCES VENTURE FINANCING MARKET REVIEW – JUNE 2021 Source: Torreya analysis and records, CapitalIQ, Pitchbook and Crunchbase 9 Crossover Venture Financing Volume in Life Sciences There were 123 crossover financings in biopharma, tools and diagnostics in the first half of 2021. If current trends persist to year-end, we are on track for $32 billion in crossover privates this year. Volume
Recommended publications
  • The-Single-Family-Office-Book.Pdf

    The-Single-Family-Office-Book.Pdf

    i Family Office Help Line: (212) 729-5067 THE SINGLE FAMILY OFFICE Creating, Operating & Managing Investments of a Single Family Office By Richard C. Wilson Billionaire Family Office | Family Offices Group Association ii iii Family Office Help Line: (212) 729-5067 This book is dedicated to my amazing daughters Bella & Maya Wilson. iv v Family Office Help Line: (212) 729-5067 Table of Contents Chapter Page Preface 5 Part 1: Single Family Office Fundamentals 7 Chapter 1: Introduction to Single Family Offices 9 Chapter 2: Single Family Office Talent & Teams 17 Chapter 3: Single Family Office Operations 35 Chapter 4: Single Family Office Governance 47 Part 2: Starting a Single Family Office 59 Chapter 5: Creating Your Family Compass 61 Chapter 6: Starting a Single Family Office 69 Chapter 7: Partners, Vendors, & Service Providers 87 Chapter 8: Investment Committees & Advisory Boards 93 Part 3: Single Family Office Investment Portfolios 109 Chapter 9: Family Office Investment Management 111 Chapter 10: Investment Fund Manager Selection & Monitoring 113 Chapter 11: Direct Investing & Operating Businesses 131 Chapter 12: Co-Investing & Club Deals 171 Chapter 13: Real Estate Investments and Hard Assets 191 Part 4: Single Family Office Best Practices & Models to Emulate 205 Chapter 14: $1 Billion+ Single Family Offices 207 Chapter 15: Intergenerational Money Management 227 Chapter 16: Converting from a Single Family Office into a Multi-Family Office 233 Chapter 17: Outsourced Chief Investment Officers 243 Chapter 18: Virtual Family Offices 247 Chapter 19: The Future of the Single Family Office Industry 261 vi vii Acknowledgements The Single Family Office book would not have been possible to write without the help of many smart and dedicated professionals.
  • Q&A with Denmark West

    Q&A with Denmark West

    SEPTEMBER 2017 V OL. 5 | ISS U E 134 R E P O R T Q&A with Denmark West. Founding Partner of Connectivity Capital Partners (“CVF”). Principle Series: Family Office Insights sits down with Denmark West, Founding Partner of Connectivity Capital Partners & CIO of Connectivity Ventures Fund, to discuss the early stage, mission-oriented fund of CVF that works to improve the human condition in the areas of health, finance, and work. Family Office Insights is a voluntary, “opt-in” collaborative peer-to-peer community of single family offices, qualified investors and institutional investors. If you care to learn more, and perhaps join the community, you are welcome to visit us here at FamilyOfficeInsights.com. P AGE 1 Q: Tell us about your background and your company, Connectivity Capital Partners. A: I started in investment banking after graduating from Harvard and focused on technology. I quickly realized I actually wanted to work inside the technology industry. So while still in my twenties, I found a role at Microsoft, where I had the opportunity to work directly with top executives including CFOs Greg Maffei and John Connors, and CEOs Bill Gates and Steve Ballmer among others. I was tasked with leading some strategic projects, ranging from Software as a Service to Open Source Software, which shape my thinking even today. I was also given the opportunity to lead internet infrastructure investments within a nascent corporate ventures effort. I led investments in Akamai (IPO), InterVU (sold to Akamai), and iBeam (IPO) among others. In 2004, Viacom recruited me to lead strategy and business development.
  • Apollo Global Management Announces Conclusion and Release of Independent Review

    Apollo Global Management Announces Conclusion and Release of Independent Review

    Apollo Global Management Announces Conclusion and Release of Independent Review NEW YORK – January 25, 2021 – Apollo Global Management, Inc. (NYSE: APO) (together with its consolidated subsidiaries, “Apollo”) today announced that the Conflicts Committee of the Board of Directors has completed its previously announced independent review of Chairman and CEO Leon Black’s previous professional relationship with Jeffrey Epstein and publicly released the review’s findings. At a regularly scheduled Board meeting in October 2020, Mr. Black requested the Conflicts Committee, comprised of independent directors, retain outside counsel to conduct an independent and thorough review. The Committee subsequently retained Dechert LLP (“Dechert”), a leading global law firm. Michael Ducey, Chair of the Conflicts Committee said, “On behalf of the Board, we want to thank Dechert LLP for conducting a timely and thorough review. We are releasing the report and findings in its entirety in the interest of being fully transparent to all of our stakeholders.” Key findings of the Dechert report include: • Apollo never retained Epstein for any services and Epstein never invested in any Apollo- managed funds; • Epstein regularly advised Mr. Black on trust and estate planning, tax issues, philanthropic endeavors, and the operation of his Family Office; • All fees paid to Mr. Epstein by Mr. Black or his Family Office were for bona fide tax, estate planning and other related services, and the amounts were intended to be proportional to the value provided by Mr. Epstein; • Epstein’s advice was vetted by respected professional advisors; and • Dechert found no evidence that Mr. Black was involved in any way with Mr.
  • Philadelphia Investment Trends Report

    Philadelphia Investment Trends Report

    Venture impact Technology investment in the Greater Philadelphia region Trends and highlights, January 2008 to June 2013 Innovation, investment and opportunity On behalf of EY, Ben Franklin Technology Partners of Southeastern Pennsylvania and the Greater Philadelphia Alliance for Capital and Technologies (PACT), we are pleased to present this review 421 companies of technology investment trends and highlights in the Greater Philadelphia region. $4.1 billion The technology investment community in the Greater Philadelphia region includes a wide variety of funding sources supporting a diverse array of companies and industry sectors. In this report, Total investment since we’ve analyzed more than a thousand investment rounds and January 2008 exits that occurred in the Philadelphia region since 2008 – including investments from venture capital fi rms (VCs), angel investors (Angels), corporate/strategic investors, seed funds, accelerators and other sources of funding. As shown in this report, 2012 reversed a post-recession slowdown in venture funding in Greater Philadelphia, and to date, 2013 has brought a welcome increase in the amount of new funds available at regional investment fi rms. These are positive signs for our region’s technology companies, as are the increasing number of exits via IPO and acquisition, which serve as further validation of the investment opportunities created by our region’s growing technology sector. We encourage you to explore this report, and we hope that it will provide useful insights into the current state of
  • RESI Boston Program Guide 09-26-2017 Digital

    RESI Boston Program Guide 09-26-2017 Digital

    SEPTEMBER 26 , 2017 BOSTON, MA Early stage investors, fundraising CEOs, scientist-entrepreneurs, strategic partners, and service providers now have an opportunity to Make a Compelling Connection ONSITE GUIDE LIFE SCIENCE NATION Connecting Products, Services & Capital #RESIBOS17 | RESIConference.com | Boston Marriott Copley Place FLOOR PLAN Therapeutics Track 2 Investor Track 3 & track4 Track 1 Device, Panels Workshops & Diagnostic & HCIT Asia Investor Panels Panels Ad-Hoc Meeting Area Breakfast & Lunch DINING 29 25 30 26 31 27 32 28 33 29 34 30 35 Breakfast / LunchBreakfast BUFFETS 37 28 24 27 23 26 22 25 21 24 20 23 19 22 exhibit hall 40 15 13 16 14 17 15 18 16 19 17 20 18 21 39 INNOVATION 14 12 13 11 12 10 11 9 10 8 9 7 8 EXHIBITORS CHALLENGE 36 38 FINALISTS 1 1 2 2 3 3 4 4 5 5 6 6 7 Partnering Check-in PARTNERING Forum Lunch BUFFETS Breakfast / Breakfast RESTROOM cocktail reception REGISTRATION content Welcome to RESI - - - - - - - - - - - - - - - 2 RESI Agenda - - - - - - - - - - - - - - - - - - 3 BOSTON RESI Innovation Challenge - - - - - - - 5 Exhibiting Companies - - - - - - - - - - 12 Track 1: Therapeutics Investor Panels - - - - - - - - - - - - - - - 19 Track 2: Device, Diagnostic, & HCIT Investor Panels - - - - 29 Track 3: Entrepreneur Workshops - - - - - - - - - - - - - - - - - - 38 Track 4: Asia-North America Workshop & Panels - - - - - - 41 Track 5: Partnering Forum - - - - - - - - - - - - - - - - - - - - - - - - 45 Sponsors & Media Partners - - - - - - - - - - - - - - - - - - - - - - - 46 1 welcome to resi On behalf of Life Science Nation (LSN) and our title sponsors WuXi AppTec and Johnson & Johnson Innovation JLABS, I would like to thank you for joining us at RESI Boston. LSN is very happy to welcome you all to Boston, the city where it all began, for our 14th RESI event.
  • Capital International Fund

    Capital International Fund

    Capital International Fund Audited Annual Report 2020 For the year ended 31 December 2020 Société d’Investissement à Capital Variable organised under the laws of the Grand Duchy of Luxembourg R.C.S. Luxembourg B 8833 1RVXEVFULSWLRQFDQEHDFFHSWHGRQWKHEDVLVRIWKHÀQDQFLDOUHSRUWV6XEVFULSWLRQVDUHRQO\YDOLGLIWKH\DUHPDGHRQWKHEDVLVRIWKH prospectus accompanied by the latest annual report and the latest semi-annual report, if published thereafter. Capital International Fund Audited Annual Report for the year ended 31 December 2020 Contents Report of the Board of Directors of the Company to the shareholders .............. 2 Summary information ..................................................... 4 Results (unaudited) ....................................................... 17 Historical data ........................................................... 36 Portfolio breakdown ....................................................... 52 Schedule of investments ................................................... 76 Capital Group New Perspective Fund (LUX) ............................. 76 Capital Group Global Equity Fund (LUX) ................................ 88 Capital Group World Growth and Income (LUX) .......................... 94 Capital Group World Dividend Growers (LUX) ........................... 104 Capital Group New Economy Fund (LUX) ............................... 108 Capital Group New World Fund (LUX) .................................. 115 Capital Group Emerging Markets Growth Fund (LUX) ..................... 131 Capital Group Japan Equity Fund
  • FORM 20-F Cootek

    FORM 20-F Cootek

    Table of Contents UNITED STATES SECURITIES AND EXCHANGE COMMISSION Washington, D.C. 20549 FORM 20-F (Mark One) REGISTRATION STATEMENT PURSUANT TO SECTION 12(b) OR 12(g) OF THE SECURITIES EXCHANGE ACT OF 1934 OR _ ANNUAL REPORT PURSUANT TO SECTION 13 OR 15(d) OF THE SECURITIES EXCHANGE ACT OF 1934 For the fiscal year ended December 31, 2018 OR TRANSITION REPORT PURSUANT TO SECTION 13 OR 15(d) OF THE SECURITIES EXCHANGE ACT OF 1934 For the transition period from to OR SHELL COMPANY REPORT PURSUANT TO SECTION 13 OR 15(d) OF THE SECURITIES EXCHANGE ACT OF 1934 Date of event requiring this shell company report . Commission file number: 001-38665 CooTek (Cayman) Inc. (Exact Name of Registrant as Specified in Its Charter) N/A (Translation of Registrant’s Name Into English) Cayman Islands (Jurisdiction of Incorporation or Organization) Building 7, No. 2007 Hongmei Road, Xuhui District Shanghai, 201103 People’s Republic of China (Address of Principal Executive Offices) Jean Liqin Zhang, Chief Financial Officer Building 7, No. 2007 Hongmei Road, Xuhui District Shanghai, 201103 People’s Republic of China Phone: +86 21 6485-6352 Email: [email protected] (Name, Telephone, E-mail and/or Facsimile number and Address of Company Contact Person) Securities registered or to be registered pursuant to Section 12(b) of the Act: Title of Each Class Name of Each Exchange On Which Registered American depositary shares, each representing 50 Class A New York Stock Exchange ordinary share Class A ordinary shares, par value US$0.00001 per share* New York Stock Exchange* *Not for trading, but only in connection with the listing on the New York Stock Exchange of American depositary shares.
  • Corporate Venturing Report 2019

    Corporate Venturing Report 2019

    Corporate Venturing 2019 Report SUMMIT@RSM All Rights Reserved. Copyright © 2019. Created by Joshua Eckblad, Academic Researcher at TiSEM in The Netherlands. 2 TABLE OF CONTENTS LEAD AUTHORS 03 Forewords Joshua G. Eckblad 06 All Investors In External Startups [email protected] 21 Corporate VC Investors https://www.corporateventuringresearch.org/ 38 Accelerator Investors CentER PhD Candidate, Department of Management 43 2018 Global Startup Fundraising Survey (Our Results) Tilburg School of Economics and Management (TiSEM) Tilburg University, The Netherlands 56 2019 Global Startup Fundraising Survey (Please Distribute) Dr. Tobias Gutmann [email protected] https://www.corporateventuringresearch.org/ LEGAL DISCLAIMER Post-Doctoral Researcher Dr. Ing. h.c. F. Porsche AG Chair of Strategic Management and Digital Entrepreneurship The information contained herein is for the prospects of specific companies. While HHL Leipzig Graduate School of Management, Germany general guidance on matters of interest, and every attempt has been made to ensure that intended for the personal use of the reader the information contained in this report has only. The analyses and conclusions are been obtained and arranged with due care, Christian Lindener based on publicly available information, Wayra is not responsible for any Pitchbook, CBInsights and information inaccuracies, errors or omissions contained [email protected] provided in the course of recent surveys in or relating to, this information. No Managing Director with a sample of startups and corporate information herein may be replicated Wayra Germany firms. without prior consent by Wayra. Wayra Germany GmbH (“Wayra”) accepts no Wayra Germany GmbH liability for any actions taken as response Kaufingerstraße 15 hereto.
  • Q1 09 Fundraising Update

    Q1 09 Fundraising Update

    www.preqin.com Preqin Ltd. Q1 2009 Private Equity Fundraising Update Special Report 23rd April 2009 © 2009 Preqin Ltd. / www.preqin.com 2 ◄ Q1 2009 Fundraising Update Q1 Overview The Coming Turn in Fundraising As everyone is painfully aware, Fig. 1: fundraising conditions in Q1 2009 were dire. Looking across all private Final Close vs. Original Target equity fund types (venture, buyout, mezzanine, distressed, fund of funds etc.), a total of only 78 funds worldwide achieved fi nal closes, raising $49 billion between them. This represents a return to the kind of levels we were experiencing in 2004 following the trough of the previous fundraising depression. As bad as these headline statistics are, they actually disguise just how bad fundraising conditions had become. Faced with a very diffi cult market, many managers who were on the road decided to cut their losses and declare fi nal closes for funds that may have two-thirds of all funds closed were equity fundraising is set to rebound actually raised most of their funding achieving between 80% and 120% strongly: in interim closes six or twelve months of their targeted amount. Around previously – hence much of the money 15% of funds fell short by more than • LP Intentions: Preqin regularly in the ‘fi nal closes’ total was actually 20%, while 20-25% of funds exceeded surveys LP intentions, and even raised in previous quarters. Very little their targets by 20% or more. The in the depths of the credit crisis new money was committed in Q1 situation deteriorated markedly in Q4 in December 2008 these LPs 2009.
  • Semi-Annual Market Review

    Semi-Annual Market Review

    Semi-Annual Market Review HEALTH IT & HEALTH INFORMATION SERVICES JULY 2019 www.hgp.com TABLE OF CONTENTS 1 Health IT Executive Summary 3 2 Health IT Market Trends 6 3 HIT M&A (Including Buyout) 9 4 Health IT Capital Raises (Non-Buyout) 14 5 Healthcare Capital Markets 15 6 Macroeconomics 19 7 Health IT Headlines 21 8 About Healthcare Growth Partners 24 9 HGP Transaction Experience 25 10 Appendix A – M&A Highlights 28 11 Appendix B – Buyout Highlights 31 12 Appendix C – Investment Highlights 34 Copyright© 2019 Healthcare Growth Partners 2 HEALTH IT EXECUTIVE SUMMARY 1 An Accumulating Backlog of Disciplined Sellers Let’s chat about fireside chats. The term first used to describe a series of evening radio addresses given by U.S. President Franklin D. Roosevelt during the Great Depression and World War II is now investment banker speak for “soft launches” of sell-side and capital raise transactions. Every company has a price, and given a market of healthy valuations, more companies are testing the waters to find out whether they can achieve that price. That process now looks a little more informal, or how you might envision a fireside chat. Price (or valuation) discovery for a company can range from a single conversation with an individual buyer to a full-blown auction with hundreds of buyers and everything in between, including a fireside chat. Given the increasing share of informal conversations, the reality is that more companies are for sale than meets the eye. While the healthy valuations publicized and press-released are encouraging more and more companies to price shop, there is a simultaneous statistical phenomenon in perceived valuations that often goes unmentioned: survivorship bias.
  • Growthink Research 2004 Annual Healthcare Venture Capital Report

    Growthink Research 2004 Annual Healthcare Venture Capital Report

    EXECUTIVE SUMMARY & SAMPLE PAGES 2004 ANNUAL REPORT Healthcare Venture Capital Report growthink RESEARCH $5.8 Billion Invested 470 Company Profiles 525 Investor Profiles www.growthinkresearch.com growthink⏐RESEARCH Executive Summary Introduction Four hundred seventy (470) privately held biotechnology, pharmaceutical, medical device and other healthcare companies raised $5.8 billion in venture capital in 2003. These companies received over 30% of the total dollars invested, up from 26% in 2002. Investments in this sector picked up considerably in the latter half of 2003 following the successful IPOs of venture-backed companies such as Acusphere, CancerVax and Myogen. With more healthcare companies slated to go public in 2004, the industry is optimistic for an extraordinary year. Total U.S. Funding by Sector – 2003 Dollars Pct. of No. of Pct. of Average Invested Total Cos. Total Deal Size Connectivity $6,817,557,000 35.8% 576 31.0% $11,836,036 Healthcare $5,813,374,000 30.5% 470 25.3% $12,368,881 Business Software & Services $3,962,150,000 20.8% 542 29.1% $7,310,240 Other $1,438,194,000 7.6% 161 8.7% $8,932,882 E-Content & Commerce $998,950,000 5.2% 111 6.0% $8,999,550 Totals: $19,030,225,000 100.0% 1860 100.0% $10,231,304 Regions Bay Area companies led the nation in raising capital, receiving 23% of the dollars invested. CoTherix (Belmont, CA) and Corgentech (South San Francisco, CA) led the region, which was home to 96 healthcare ventures that raised $1.4 billion. CoTherix, a biopharmaceutical company that develops and commercializes therapeutics for life-threatening diseases, completed a $55 million Series C round.
  • Clear Route to Phase Iib

    Clear Route to Phase Iib

    REPRINT FROM MARCH 24, 2008 BioCentury ® THE BERNSTEIN REPORT ON BIOBUSINESS Article Reprint Page 1 of 9 Ebb & Flow Focus Clear route to Phase IIb By Mike Ward investment with the potential to follow on up to a total of $30- Senior Editor $40 million per company.” Although big series A rounds have become increasingly Indeed, the average size of the 10 most recent rounds Phase4 commonplace, the recent deal for Albireo AB, expected to Ventures has participated in is a touch over $50 million. This is reach $40 million, reflects business as usual for Nomura more than two and a half times the average biotech venture Phase4 Ventures. The London firm has taken an aggres- round over the same period. sive approach to investing its parent’s money in biotech, Phase4 has participated in three series A rounds in the past characterized by large financing rounds geared to providing three years in which the syndicates committed a total of $162 a clear route to Phase IIb data, underpinned by international million to the three companies. syndication. The firm focuses primarily on investment in clinical stage Phase4’s story is one of increasing scale, with rounds companies and as a result has a portfolio that is heavily biased mounting in size from 1999 until the VC toward the U.S. Over 75% of the compa- hit its stride in 2004. Since then, the firm nies Phase4 invests in are in Phase I or has usually taken the lead in $1.3 billion “You need to bring enough II, with an average holding time of about worth of venture rounds.