DOCSLIB.ORG

Identification and Characterization of the Rat DVL2 Gene Using

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Identification and Characterization of the Rat DVL2 Gene Using TurkJBiol 31(2007)81-86 ©TÜB‹TAK IdentificationandCharacterizationoftheRatDVL2GeneUsing BioinformaticTools LokmanVARIfiLI,OsmanÇEN DepartmentofBiology,FacultyofArtsandScience,HarranUniversity,fianl›urfa-TURKEY Received:02.10.2006 Abstract: WeidentifiedandcharacterizedtheratDVL2geneusingbioinformatics.Inadditiontothestructureandchromosomal localizationoftheratDVL2gene,thetranscribedandtranslatedproteinproductofthegenewasanalyzedinsilico.Resultss howed thattheratDVL2geneconsistsof15exonsandislocatedontheratgenomiccontigWGA1854.3onchromosome10.Database searchesusingtheratDVL2aminoacidsequenceasaqueryshowedanumberofhomologousproteinsequencesindifferentspecies, includingM.musculus,P.troglodytes,C.familiaris,H.sapiens,B.taurus,D.rerio,X.laevis,and T.nigroviridis.DAX,PDZsignaling, andDEP-conserveddomainstructureswereidentifiedwithintheratDVL2protein. KeyWords: Bioinformatics,DVL2,ratgenome,Wntsignaling BiyoinformatikMetodlarKullanarakS›çanDVL2GenininTan›mlanmas›veKarakterizasyonu Özet: Buçal›flmadabiyoinformatikyaklafl›mlarkullanaraks›çanDVL2geninitan›mlad›kvekarakterizeettik.S›çanDVL2genininyap› vekromozomallokalizasyonunaekolarakgeninkodlad›¤›proteindeinsilicoolarakanalizedildi.Sonuçlar›m›zagöres›çanDVL2geni 15eksondanoluflmuflve10.kromozomdakigenomikkontigWGA1854.3üzerindebulunmaktad›r.S›çanDVL2proteininin M. musculus,P.troglodytes,C.familiaris,H.sapiens,B.taurus,D.rerio,X.laevis ve T.nigroviridis türlerindekihomologlar›vebunlar aras›ndakihomolojioranlar›aminoasitduzeyindebelirlendi.RatDVL2proteinindeDAX,PDZ-SinyalizasyonveDEPkorunmufl domeynyap›lar›oldu¤ubelirlendi. AnahtarSözcükler: Biyoinformatik,DVL2,ratgenomu,Wntsinyalizasyonu Introduction noinformationaboutthegene,suchasstructure, Wntsignalingisconservedinvariousspeciesandplays sequencelength,thepredictedproteinsequence,or importantrolesindevelopmentanddifferentiation(1-5); functionaldomains,ispresent.Therefore,weaimedto however,abnormalWntsignalingmaycause identifyandfurthercharacterizeit. abnormalities,suchascancer(6).Wntsignalsare Herein,weanalyzedtheratDVL2gene,itsstructure, transducedthroughfrizzledreceptors.Theytransduce thechromosomallocalization,predictedpeptide signalstotheintracellularspacebyactivatingdisheveled sequence,anddomainstructures.Wealsoanalyzedits (DVL)proteins(7).TheDVLfamilyproteinsaremulti- homologuesinotherspeciesandtheirevolutionary domain,intracellulartransducerswithimportant relationship. signalingfunctions(8).AllDVLproteinfamilymembers contain3highlyconserveddomains(9):NterminalDAX (alsocalledDIX)(10),centralPDZ(11),andCterminal MaterialsandMethods DEP(12)domains.Thereare3DVLgenes(DVL1,DVL2, IdentificationDVL2geneinratgenome andDVL3)inthehuman(13)andmousegenomes(14- Newgenefragmentswereidentifiedusinginsilico 16),and2DVLgenes(DVL1andDVL3)intherat toolsanddatabasesearches,aspreviouslydescribed(17- genome.Recently,theratDVL2genehasbeengrossly 20).Toidentifytherelatedgenomicclones,aTBLASTN predictedinsilicoandaddedtotheNCBIGenebank searchthroughtheNCBIserver(http://www.ncbi.nlm. database(GeneID:303251);however,inthisannotation, nih.gov/blast)againstnon-redundantdatabaseswas 81 IdentificationandCharacterizationoftheRatDVL2GeneUsingBioinformaticTools performedusingtheaminoacidsequencesofhuman exon-intronboundariesweredeterminedbyexamining DVL2asthequerysequence.Withinthedetermined theconsensussequenceofexon-intronboundariesand genomicregion,putativeCDSwasdeterminedbyusing thecodonusagewithinthecodingregion(Figure1b). theWise2program(http://www.ebi.ac.uk/wise2).To Analysesofdeducedamino-acidsequence identifythecompletemRNA,BLASTnsearchesagainst ESTdbwereperformedusingthenucleotidesequenceof RatDVL2mRNAwasfoundtoconsistofatleast34 putativeCDSofratDVL2asaquerysequence.This bpof5’UTR,2208bpofcodingregion,andatleast575 processwasrepeatedseveraltimesfortheprecise bpofa3’UTRregion(Figure2).TheratDVL2mRNA determinationofthemRNAsequence. waspredictedtoencodeapeptideof736aminoacids. Inordertoestablishthegenomicorganizationofthe TheBLASTPprogramrevealedthatratDVL2has DVL2gene,themRNAsequencewasBLASTedagainstthe 98%,96%,96%,92%,94%,78%,77%,and74% genomeof R.norvegicus .UsingGenomatixsoftware totalaminoacididentitywiththecorrespondingproteins (http://www.genomatix.de)andinspectingthegt-agrule ofM.musculus (CAI35165),H.sapiens (AAH14844),C. ofintronicsequence,usageoftheexonswasdefined. Deducingandanalyzingtheamino-acidsequence 10q.24 ofDVL2gene A Predictionofthecodingregionwasperformedusing theORFFinderprogram(http://www.ncbi.nlm.nih.gov/ 43.660K 43.720K projects/gorf/).TheBLASTPprogram(http://www. Gabarap Acadvl MGC94192 ncbi.nlm.nih.gov/blast/)atNCBIwasusedtoidentifythe Dv12 homologousproteinsinotherspecies. LOC497670 Amino-acidsequencealignmentswereperformed usingtheClustalWprogram(http://www.ebi.ac.uk/ clustalw).RPS-BLAST(http://www.ncbi.nlm.nih.gov/ blast)wasusedforproteindomainapplicationanalysis. Phylogeneticanalysis Thephylogenetictreeswereconstructedusingthe 43.670K 43.680K neighbor-joiningmethod(NJ)withJones-Taylor- DVL2Gene Thornton(JTT)distances.NJsearcheswereconducted usingtheMEGA3program(21).Thereliabilityofinternal brancheswasassessedusing500bootstrapreplicates. B ExpressionAnalysis TheESTscorrespondingtotheratDVL2genewere searchedforwiththeBLASTnprogram(http// www.ncbi.nlm.nih.gov/blast).Then,thetissuesourcesof ESTscorrespondingtothenewgenewerelisted. Results IdentificationofratDVL2gene TBLASTNsearchesusinghumanDVL2mRNArevealed thattheratDVL2genefragmentswerelocatedwithinthe ratgenomecontigWGA1854.3onchromosome10at thenucleotideposition43.670kb-43.680kb,andthat Figure1. (A)StructureandchromosomallocalizationoftheratDVL2 theywereabout10kbinsize(Figure1a).Theprecise gene.(B)Exon–intronboundariesoftheratDVL2gene. 82 L.VARIfiLI,O.ÇEN familiaris (XP_546582),P.troglodytes (XP_511978),B. ExpressionofratDVL2 taurus (XP_870854), X.laevis (AAH90218,XDSH), D. Weinvestigateddifferentialtissueandorgan rerio (NP_997813),and T.nigroviridis (CAG00725), expressionofratDVL2byanalyzingthesourcesofrat respectively.ClustalWalignmentoftheseproteins DVL2ESTs,asdefinedbytheBLASTnprogram(Table). displayedveryhighsimilarityintheNterminalhalfand morediversityattheCterminus(Figure3). RPS-BLASTresultsrevealedthatratDVL2proteins Discussion includeDAX,PDZsignaling,andDEP-conserveddomains TheDVLgenesofvertebratesarehomologouswiththe spanningfromaminoacid13to93,265to352,and DrosophilaDSHgeneandtheyarehighlyconserved 433to505,respectively(Figure2). throughoutevolution.TheproductsofDVLgenesare Phylogeneticsanalysis requiredforthetransductionofWntsignalsfromthecell surfacetothecytoplasm.AlthoughthemechanismofWnt WeconstructedthephylogenetictreeoftheDVL2 signalingfromfrizzledreceptorstocytoplasmisnot proteinsfromthespeciesgivenabovewithMEGA3 understoodveryclearly,DVLproteinsareconsideredthe (Figure4).TheresultsindicatedthatDVL2isconserved intersectionofWntsignaling(24).Therefore,identification amongallorganismsinvestigated,withveryhigh ofWnt-signalingcomponentsinexperimentalanimals,such conservationamongthemammals. astherat,isveryimportantforunderstandingofthe Figure2. RatDVL2mRNAandproteins.RatDVL2proteinsincludeDAX,PDZsignaling,andDEP- conserveddomains.Thesedomainsareboxed. 83 IdentificationandCharacterizationoftheRatDVL2GeneUsingBioinformaticTools Mus musculus MAGSSAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDTP Rattus norvegicus MAGSSAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDSARLPCFNGRVVSWLVSSESP Pan troglodytes MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNP Homo sapiens MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNP Canis familiaris MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSENP Bos taurus MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNP Xenopus laevis ----------MAETKVIYHLDEEETPYLVKVPVPATDIRLRDFKAALGR-GHAKYFFKAMDQDFGVVKEEISDDNAKLPCFNGRVVSWLVSSEGS Danio rerio ----------MAETKIIYHIDEEETPYLVKIPIAAEKITLLDFKQVLNK-PNYKFFFKSMDQDFGVVKEEISDDSAKLPCFNGRVVSWLVSSDTP Tetraodon nigroviridis ----------MAETKIIYHIDEEETPYLVKIPIAAENITLLDFKQVLNK-PNYKFFFKSMDQDFGVVKEEISDDGAKLPCFNGRVVSWLVSSDTL *** *** ********** * * * * *** * * *** *************** * *************** Mus musculus QPEV---APPAHESRTELVPPP---PPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRDRPRRRDSSEHGAGGHRPGGPSR Rattus norvegicus QPET---APPAHESRTELVPPP---PPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRDRPRRRDSSEHGAGGHRPGVPSR Pan troglodytes QPEM---APPVHEPRAELAPPA---PPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTGGPSR Homo sapiens QPEM---APPVHEPRAELAPPA---PPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTGGPSR Canis familiaris QPEM---APPAHEPRAELAPPP---PPLPPLPPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPGGPSR Bos taurus QPEM---APPAHEPRTDLAPPP---PPLPPLPPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSEHGAGGHRPSGPSR Xenopus laevis QPDS---APPAPATEVRPEPPPPVPPPIPPPPAERTSGIGDSRPPSFHPNVSGSTEQLD--QDNESVISMRRDRVRRRESSEQAGVGRGVNG--R Danio rerio AAEP---VAPPVEVPSQPSPPP---PPLPPPPAERMAGIGDSRPPSFHPNTTGSLESLDDQTETESVVSFRRERPRPRESLEQ--HGPRMNGQSH Tetraodon nigroviridis AAEPPVAVVPPVETTAQPSPPP---PPLPPPPAERTGGIGDSRPPSFHPNATGSVETLDEQTETESVVSFRRERPRHRENMEQ--HGPRMNGQSR * ** ** ** * ** ************* * * * *** * ** * * * * * Mus musculus LERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRMERTSSFSSVTDSTMSLNIITVTLNMEKYNFLG Rattus norvegicus LERHLAGYESSSTLMTSELESTSLGDSDEDDSMSRFSSSTEQSSASRLLKRHRRRRKQRPPRMERTSSFSSVTDSTMSLNIITVTLNMEKYNFLG Pan troglodytes LERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLG
Load more

Recommended publications
  • Systems Analysis Implicates WAVE2&Nbsp
    JACC: BASIC TO TRANSLATIONAL SCIENCE VOL.5,NO.4,2020 ª 2020 THE AUTHORS. PUBLISHED BY ELSEVIER ON BEHALF OF THE AMERICAN COLLEGE OF CARDIOLOGY FOUNDATION. THIS IS AN OPEN ACCESS ARTICLE UNDER THE CC BY-NC-ND LICENSE (http://creativecommons.org/licenses/by-nc-nd/4.0/). PRECLINICAL RESEARCH Systems Analysis Implicates WAVE2 Complex in the Pathogenesis of Developmental Left-Sided Obstructive Heart Defects a b b b Jonathan J. Edwards, MD, Andrew D. Rouillard, PHD, Nicolas F. Fernandez, PHD, Zichen Wang, PHD, b c d d Alexander Lachmann, PHD, Sunita S. Shankaran, PHD, Brent W. Bisgrove, PHD, Bradley Demarest, MS, e f g h Nahid Turan, PHD, Deepak Srivastava, MD, Daniel Bernstein, MD, John Deanfield, MD, h i j k Alessandro Giardini, MD, PHD, George Porter, MD, PHD, Richard Kim, MD, Amy E. Roberts, MD, k l m m,n Jane W. Newburger, MD, MPH, Elizabeth Goldmuntz, MD, Martina Brueckner, MD, Richard P. Lifton, MD, PHD, o,p,q r,s t d Christine E. Seidman, MD, Wendy K. Chung, MD, PHD, Martin Tristani-Firouzi, MD, H. Joseph Yost, PHD, b u,v Avi Ma’ayan, PHD, Bruce D. Gelb, MD VISUAL ABSTRACT Edwards, J.J. et al. J Am Coll Cardiol Basic Trans Science. 2020;5(4):376–86. ISSN 2452-302X https://doi.org/10.1016/j.jacbts.2020.01.012 JACC: BASIC TO TRANSLATIONALSCIENCEVOL.5,NO.4,2020 Edwards et al. 377 APRIL 2020:376– 86 WAVE2 Complex in LVOTO HIGHLIGHTS ABBREVIATIONS AND ACRONYMS Combining CHD phenotype–driven gene set enrichment and CRISPR knockdown screening in zebrafish is an effective approach to identifying novel CHD genes.
    [Show full text]
  • Dishevelled Genes Mediate a Conserved Mammalian PCP
    RESEARCH ARTICLE 1767 Development 133, 1767-1778 (2006) doi:10.1242/dev.02347 Dishevelled genes mediate a conserved mammalian PCP pathway to regulate convergent extension during neurulation Jianbo Wang1, Natasha S. Hamblet1,*, Sharayne Mark2, Mary E. Dickinson3,†, Brendan C. Brinkman4, Neil Segil5, Scott E. Fraser3, Ping Chen2, John B. Wallingford6 and Anthony Wynshaw-Boris1,§ The planar cell polarity (PCP) pathway is conserved throughout evolution, but it mediates distinct developmental processes. In Drosophila, members of the PCP pathway localize in a polarized fashion to specify the cellular polarity within the plane of the epithelium, perpendicular to the apicobasal axis of the cell. In Xenopus and zebrafish, several homologs of the components of the fly PCP pathway control convergent extension. We have shown previously that mammalian PCP homologs regulate both cell polarity and polarized extension in the cochlea in the mouse. Here we show, using mice with null mutations in two mammalian Dishevelled homologs, Dvl1 and Dvl2, that during neurulation a homologous mammalian PCP pathway regulates concomitant lengthening and narrowing of the neural plate, a morphogenetic process defined as convergent extension. Dvl2 genetically interacts with Loop-tail, a point mutation in the mammalian PCP gene Vangl2, during neurulation. By generating Dvl2 BAC (bacterial artificial chromosome) transgenes and introducing different domain deletions and a point mutation identical to the dsh1 allele in fly, we further demonstrated a high degree of conservation between Dvl function in mammalian convergent extension and the PCP pathway in fly. In the neuroepithelium of neurulating embryos, Dvl2 shows DEP domain-dependent membrane localization, a pre-requisite for its involvement in convergent extension.
    [Show full text]
  • Palmitic Acid Effects on Hypothalamic Neurons
    bioRxiv preprint doi: https://doi.org/10.1101/2021.08.03.454666; this version posted August 4, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Running title: Oleic and palmitic acid effects on hypothalamic neurons Concentration-dependent change in hypothalamic neuronal transcriptome by the dietary fatty acids: oleic and palmitic acids Fabiola Pacheco Valencia1^, Amanda F. Marino1^, Christos Noutsos1, Kinning Poon1* 1Department of Biological Sciences, SUNY Old Westbury, Old Westbury NY, United States ^Authors contributed equally to this work *Corresponding Author: Kinning Poon 223 Store Hill Rd Old Westbury, NY 11568, USA 1-516-876-2735 [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2021.08.03.454666; this version posted August 4, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract Prenatal high-fat diet exposure increases hypothalamic neurogenesis events in embryos and programs offspring to be obesity-prone. The molecular mechanism involved in these dietary effects of neurogenesis are unknown. This study investigated the effects of oleic and palmitic acids, which are abundant in a high-fat diet, on the hypothalamic neuronal transcriptome and how these changes impact neurogenesis events. The results show differential effects of low and high concentrations of oleic or palmitic acid treatment on differential gene transcription.
    [Show full text]
  • And Right-Sided Colon Cancer
    Author Manuscript Published OnlineFirst on November 29, 2017; DOI: 10.1158/1541-7786.MCR-17-0483 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. Multi-omics Approach Reveals Distinct Differences in Left- and Right-sided Colon Cancer Running title: Left- and Right-sided Colon Cancer Comparison Wangxiong Hu1*†, Yanmei Yang2*, Xiaofen Li1,3, Minran Huang1, Fei Xu1, Weiting Ge1†, Suzhan Zhang1,4†, Shu Zheng1,4† 1Cancer Institute (Key Laboratory of Cancer Prevention and Intervention, China National Ministry of Education), The Second Affiliated Hospital, Zhejiang University School of Medicine, Hangzhou, Zhejiang 310009, China 2Key Laboratory of Reproductive and Genetics, Ministry of Education, Women’s Hospital, Zhejiang University, Hangzhou, Zhejiang 310006, China 3Department of Abdominal Oncology, West China Hospital, Sichuan University, Chengdu, Sichuan 610041, China 4Research Center for Air Pollution and Health, School of Medicine, Zhejiang University, Hangzhou, Zhejiang 310009, China *These authors contributed equally to this work †Correspondence: Wangxiong Hu Tel: +86-571-87784606 Mailing address: 88 Jiefang Rd, Hangzhou, China 310009 E-mail: [email protected] Weiting Ge Tel: +86-571-87784606 Mailing address: 88 Jiefang Rd, Hangzhou, China 310009 E-mail: [email protected] Suzhan Zhang Tel: +86-571-87784501 Mailing address: 88 Jiefang Rd, Hangzhou, China 310009 1 Downloaded from mcr.aacrjournals.org on September 23, 2021. © 2017 American Association for Cancer Research. Author Manuscript Published OnlineFirst on November 29, 2017; DOI: 10.1158/1541-7786.MCR-17-0483 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. E-mail: [email protected] Shu Zheng Tel: +86-571-87784501 Fax: +86-571-87214404 Mailing address: 88 Jiefang Rd, Hangzhou, China 310009 E-mail: [email protected] Conflicts of interest The authors declare that they have no competing financial interests.
    [Show full text]
  • EPH Receptor A2 Governs a Feedback Loop That Activates Wnt/Β-Catenin
    Peng et al. Cell Death and Disease (2018) 9:1146 DOI 10.1038/s41419-018-1164-y Cell Death & Disease ARTICLE Open Access EPH receptor A2 governs a feedback loop that activates Wnt/β-catenin signaling in gastric cancer Qiu Peng1,2,LingChen3,WeiWu3,JiaWang2, Xiang Zheng2,ZihuaChen3,QinJiang1,JiaqiHan1,LingyuWei2, Lujuan Wang2,JinHuang1 and Jian Ma1,2,4 Abstract The erythropoietin-producing hepatoma (EPH) receptor A2 (EphA2) belongs to the Eph family of receptor tyrosine kinases. EphA2 is highly correlated with the formation of many solid tumors and has been linked to the dysregulation of signaling pathways that promote tumor cell proliferation, migration, and invasion as well as angiogenesis. Deregulation of Wnt signaling is implicated in many forms of human disease including gastric cancer. We previously reported that EphA2 promotes the epithelial–mesenchymal transition through Wnt/β-catenin signaling in gastric cancer. Herein, we present a novel mechanism by which EphA2 regulates Wnt/β-catenin signaling. EphA2 acts as a receptor for Wnt ligands and recruits Axin1 to the plasma membrane by directly binding Dvl2. The EphA2-Dvl2/Axin1 interaction was enhanced by Wnt3a treatment, suggesting that EphA2 acts as a functional receptor for the Wnt/β- catenin pathway and plays a vital role in downstream signaling. We showed that Dvl2 mediates the EphA2-Axin1 interaction by binding to the tyrosine kinase domain of EphA2. We propose that EphA2/Dvl2/Axin1 forms a complex that destabilizes the β-catenin destruction complex and allows β-catenin to translocate to the nucleus and initiate the 1234567890():,; 1234567890():,; 1234567890():,; 1234567890():,; transcription of c-MYC, the primary Wnt signaling target gene.
    [Show full text]
  • A Structural Portrait of the PDZ Domain Family
    Article A Structural Portrait of the PDZ Domain Family Andreas Ernst 1, Brent A. Appleton 2, Ylva Ivarsson 1, Yingnan Zhang 2, David Gfeller 1, Christian Wiesmann 2 and Sachdev S. Sidhu 1 1 - Banting and Best Department of Medical Research and Department of Molecular Genetics, University of Toronto, The Donnelly Centre, 160 College Street, Toronto, ON M5S 3E1, Canada 2 - Department of Early Discovery Biochemistry, Genentech Inc, San Francisco, CA 94080, USA Correspondence to Sachdev S. Sidhu: [email protected] http://dx.doi.org/10.1016/j.jmb.2014.08.012 Edited by A. Keating Abstract PDZ (PSD-95/Discs-large/ZO1) domains are interaction modules that typically bind to specific C-terminal sequences of partner proteins and assemble signaling complexes in multicellular organisms. We have analyzed the existing database of PDZ domain structures in the context of a specificity tree based on binding specificities defined by peptide-phage binding selections. We have identified 16 structures of PDZ domains in complex with high-affinity ligands and have elucidated four additional structures to assemble a structural database that covers most of the branches of the PDZ specificity tree. A detailed comparison of the structures reveals features that are responsible for the diverse specificities across the PDZ domain family. Specificity differences can be explained by differences in PDZ residues that are in contact with the peptide ligands, but these contacts involve both side-chain and main-chain interactions. Most PDZ domains bind peptides in a canonical conformation in which the ligand main chain adopts an extended β-strand conformation by interacting in an antiparallel fashion with a PDZ β-strand.
    [Show full text]
  • The Jackson Laboratory Mouse Genome Informatics Site: Version 2.3.2
    Yeast Yeast 2000; 17: 134±145. Website Review The Jackson Laboratory Mouse Genome Informatics Site: Version 2.3.2 http://www.informatics.jax.org/ Site authors: Mouse Genome Informatics, The Jackson Laboratory, Bar Harbor, Maine. Project PI: Janan Eppig. All screen views from the website are reproduced with the kind permission of Janan Eppig. Jo Wixon Managing EditorÐSchool of Biological Sciences, University of Manchester, Manchester, M13 9PT, UK Site structure user to ®nd the right page to answer his/her query and I have followed this structure for the site guide. The main page is broken down into three sections: Most of the links go through to a page with a list of services, headed by the same title. Each title forms a Searches, data and reports searches of subsections link to the relevant section of the site overview; this of the databases): gives information about the available data, and an $ Genetic and phenotypic data. explanation of what the searches offered on the $ Mapping and marker data. page are designed to do. In some cases, the titles $ Strains and polymorphisms. link to instructions on how to use the searches and $ Expression data some entries include ®gures of tools. Above these titles are links to each of the results from published work). other search topic pages; these allow more rapid $ Mammalian homology data includes Oxford movement around the site. Between these links and grids and comparative maps). the title, on every page, is a pull-down menu, for $ Database reports view the data as lists, as an those who wish to go directly to a search form.
    [Show full text]
  • The Human Gene Connectome As a Map of Short Cuts for Morbid Allele Discovery
    The human gene connectome as a map of short cuts for morbid allele discovery Yuval Itana,1, Shen-Ying Zhanga,b, Guillaume Vogta,b, Avinash Abhyankara, Melina Hermana, Patrick Nitschkec, Dror Friedd, Lluis Quintana-Murcie, Laurent Abela,b, and Jean-Laurent Casanovaa,b,f aSt. Giles Laboratory of Human Genetics of Infectious Diseases, Rockefeller Branch, The Rockefeller University, New York, NY 10065; bLaboratory of Human Genetics of Infectious Diseases, Necker Branch, Paris Descartes University, Institut National de la Santé et de la Recherche Médicale U980, Necker Medical School, 75015 Paris, France; cPlateforme Bioinformatique, Université Paris Descartes, 75116 Paris, France; dDepartment of Computer Science, Ben-Gurion University of the Negev, Beer-Sheva 84105, Israel; eUnit of Human Evolutionary Genetics, Centre National de la Recherche Scientifique, Unité de Recherche Associée 3012, Institut Pasteur, F-75015 Paris, France; and fPediatric Immunology-Hematology Unit, Necker Hospital for Sick Children, 75015 Paris, France Edited* by Bruce Beutler, University of Texas Southwestern Medical Center, Dallas, TX, and approved February 15, 2013 (received for review October 19, 2012) High-throughput genomic data reveal thousands of gene variants to detect a single mutated gene, with the other polymorphic genes per patient, and it is often difficult to determine which of these being of less interest. This goes some way to explaining why, variants underlies disease in a given individual. However, at the despite the abundance of NGS data, the discovery of disease- population level, there may be some degree of phenotypic homo- causing alleles from such data remains somewhat limited. geneity, with alterations of specific physiological pathways under- We developed the human gene connectome (HGC) to over- come this problem.
    [Show full text]
  • Genetic Polymorphisms in APC, DVL2, and AXIN1 Are Associated with Susceptibility, Advanced TNM Stage Or Tumor Location in Colorectal Cancer
    Tohoku J. Exp. Med., 2019, 249, 173-183Wnt Pathway Polymorphisms in Colorectal Cancer 173 Genetic Polymorphisms in APC, DVL2, and AXIN1 Are Associated with Susceptibility, Advanced TNM Stage or Tumor Location in Colorectal Cancer Mónica Alejandra Rosales-Reynoso,1 Anilú Margarita Saucedo-Sariñana,1 Karla Berenice Contreras-Díaz,1 Rosa María Márquez-González,1 Patricio Barros-Núñez,2 Tomás Daniel Pineda-Razo,3 María Eugenia Marin-Contreras,4 Óscar Durán-Anguiano,5 Martha Patricia Gallegos-Arreola,6 Silvia Esperanza Flores-Martínez1 and José Sánchez-Corona1 1Molecular Medicine Division, Centro de Investigación Biomédica de Occidente (CIBO), Instituto Mexicano del Seguro Social (IMSS), Guadalajara, Jalisco, Mexico 2Research Unit of Metabolic Diseases, Pediatric UMAE, Instituto Mexicano del Seguro Social (IMSS), Guadalajara, Jalisco, Mexico 3Medical Oncology Service, Specialty Hospital, Instituto Mexicano del Seguro Social (IMSS), Guadalajara, Jalisco, Mexico 4Gastroenterology Service, Specialty Hospital, Instituto Mexicano del Seguro Social (IMSS), Guadalajara, Jalisco, Mexico 5Coloproctology Service, Specialty Hospital, Instituto Mexicano del Seguro Social (IMSS), Guadalajara, Jalisco, Mexico 6Genetic Division, Centro de Investigación Biomédica de Occidente (CIBO), Instituto Mexicano del Seguro Social (IMSS), Guadalajara, Jalisco, Mexico Colorectal cancer (CRC) is the third most common cancer and the second leading cause of death worldwide. The named “destruction complex” has a critical function in the Wnt/β-catenin pathway regulating the
    [Show full text]
  • Downloaded from the IPA Database
    A physical and regulatory map of host-influenza interactions reveals pathways in H1N1 infection The MIT Faculty has made this article openly available. Please share how this access benefits you. Your story matters. Citation Shapira, Sagi D. et al. “A Physical and Regulatory Map of Host- Influenza Interactions Reveals Pathways in H1N1 Infection.” Cell 139.7 (2009): 1255–1267. Web. As Published http://dx.doi.org/10.1016/j.cell.2009.12.018 Publisher Elsevier B.V. Version Author's final manuscript Citable link http://hdl.handle.net/1721.1/74511 Terms of Use Creative Commons Attribution-Noncommercial-Share Alike 3.0 Detailed Terms http://creativecommons.org/licenses/by-nc-sa/3.0/ NIH Public Access Author Manuscript Cell. Author manuscript; available in PMC 2010 June 28. NIH-PA Author ManuscriptPublished NIH-PA Author Manuscript in final edited NIH-PA Author Manuscript form as: Cell. 2009 December 24; 139(7): 1255±1267. doi:10.1016/j.cell.2009.12.018. A physical and regulatory map of host-influenza interactions reveals pathways in H1N1 infection Sagi D. Shapira1,2,3,*, Irit Gat-Viks1,*, Bennett O.V. Shum1, Amelie Dricot4,6, Marciela M. Degrace1,2,5, Wu Liguo1,2,3, Piyush B. Gupta1, Tong Hao4,6, Serena J. Silver1, David E. Root1, David E. Hill4,6, Aviv Regev1,7,ˆ,†, and Nir Hacohen1,2,3,ˆ,† 1Broad Institute of MIT and Harvard, 7 Cambridge Center, Cambridge, MA 02142, USA 2Center for Immunology and Inflammatory Diseases, Massachusetts General Hospital, 149 13th St., Charlestown, MA 02129 USA 3Department of Medicine, Harvard Medical School, Boston,
    [Show full text]
  • Dvl2 Promotes Intestinal Length and Neoplasia in the Apcmin Mouse Model for Colorectal Cancer
    Published OnlineFirst July 27, 2010; DOI: 10.1158/0008-5472.CAN-10-1616 Published OnlineFirst on July 27, 2010 as 10.1158/0008-5472.CAN-10-1616 Tumor and Stem Cell Biology Cancer Research Dvl2 Promotes Intestinal Length and Neoplasia in the ApcMin Mouse Model for Colorectal Cancer Ciara Metcalfe1, Ashraf E.K. Ibrahim1, Michael Graeb1, Marc de la Roche1, Thomas Schwarz-Romond1, Marc Fiedler1, Douglas J. Winton2, Anthony Corfield3, and Mariann Bienz1 Abstract APC mutations cause activation of Wnt/β-catenin signaling, which invariably leads to colorectal cancer. Similarly, overexpressed Dvl proteins are potent activators of β-catenin signaling. Screening a large tissue microarray of different staged colorectal tumors by immunohistochemistry, we found that Dvl2 has a strong tendency to be overexpressed in colorectal adenomas and carcinomas, in parallel to nuclear β-catenin and Axin2 (a universal transcriptional target of Wnt/β-catenin signaling). Furthermore, deletion of Dvl2 reduced Min the intestinal tumor numbers in a dose-dependent way in the Apc model for colorectal cancer. Interestingly, the small intestines of Dvl2 mutants are shortened, reflecting in part a reduction of their crypt diameter and cell size. Consistent with this, mammalian target of rapamycin (mTOR) signaling is highly active in normal intestinal crypts in which Wnt/β-catenin signaling is active, and activated mTOR signaling (as revealed by Min staining for phosphorylated 4E-BP1) serves as a diagnostic marker of Apc mutant adenomas. Inhibition Min of mTOR signaling in Apc mutant mice by RAD001 (everolimus) reduces their intestinal tumor load, sim- ilarly to Dvl2 deletion. mTOR signaling is also consistently active in human hyperplastic polyps and has a significant tendency for being active in adenomas and carcinomas.
    [Show full text]
  • WNT Signaling in the Control of Hair Growth and Structure
    Developmental Biology 207, 133–149 (1999) Article ID dbio.1998.9140, available online at http://www.idealibrary.com on View metadata, citation and similar papers at core.ac.uk brought to you by CORE WNT Signaling in the Control of Hair Growth provided by Elsevier - Publisher Connector and Structure Sarah E. Millar,*,1,4 Karl Willert,* Patricia C. Salinas,*,†,2 Henk Roelink,*,†,3 Roel Nusse,*,† Daniel J. Sussman,‡ and Gregory S. Barsh*,§ *Howard Hughes Medical Institute, †Department of Developmental Biology, and §Department of Pediatrics and Department of Genetics, Stanford University, Stanford, California 94305-5428; and ‡Division of Human Genetics, University of Maryland, Baltimore, Maryland 21201-1559 Characterization of the molecular pathways controlling differentiation and proliferation in mammalian hair follicles is central to our understanding of the regulation of normal hair growth, the basis of hereditary hair loss diseases, and the origin of follicle-based tumors. We demonstrate that the proto-oncogene Wnt3, which encodes a secreted paracrine signaling molecule, is expressed in developing and mature hair follicles and that its overexpression in transgenic mouse skin causes a short-hair phenotype due to altered differentiation of hair shaft precursor cells, and cyclical balding resulting from hair shaft structural defects and associated with an abnormal profile of protein expression in the hair shaft. A putative effector molecule for WNT3 signaling, the cytoplasmic protein Dishevelled 2 (DVL2), is normally present at high levels in a subset of cells in the outer root sheath and in precursor cells of the hair shaft cortex and cuticle which lie immediately adjacent to Wnt3-expressing cells. Overexpression of Dvl2 in the outer root sheath mimics the short-hair phenotype produced by overexpression of Wnt3, supporting the hypothesis that Wnt3 and Dvl2 have the potential to act in the same pathway in the regulation of hair growth.
    [Show full text]