Anti-GFM2 (Aa 436-612) Polyclonal Antibody (DPABH-12102) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-GFM2 (aa 436-612) polyclonal antibody (DPABH-12102) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description GFM2 is a mitochondrial translation elongation factor. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known. Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. Immunogen Recombinant fragment corresponding to Human GFM2 aa 436-612. (BC015712)Sequence: VGLKHTATGDTIVSSKSSALAAARRAEREGEKKHRQNNEAERLLLAGVEI PEPVFFCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGM GELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLDRTLGDK RHLVTVEVEARPIETSSVMPV Isotype IgG Source/Host Rabbit Species Reactivity Mouse, Human Purification Immunogen affinity purified Conjugate Unconjugated Applications IHC-P, WB Format Liquid Size 100 μg Buffer pH: 7.20; Constituents: 98% PBS, 1% BSA Preservative 0.02% Sodium Azide Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved GENE INFORMATION Gene Name GFM2 G elongation factor, mitochondrial 2 [ Homo sapiens ] Official Symbol GFM2 Synonyms GFM2; G elongation factor, mitochondrial 2; ribosome-releasing factor 2, mitochondrial; EFG2; FLJ21661; MSTP027; mitochondrial elongation factor G2; elongation factor G 2, mitochondrial; mitochondrial ribosome recycling factor 2; RRF2; MRRF2; hEFG2; MST027; RRF2mt; EF-G2mt; mEF-G 2; Entrez Gene ID 84340 Protein Refseq NP_115756 UniProt ID Q969S9 Chromosome Location 5q13 Function GTP binding; GTPase activity; nucleotide binding; NOT translation elongation factor activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

Genome-Wide Analysis of Allele-Specific Expression Patterns in Seventeen Tissues of Korean Cattle (Hanwoo)
animals Article Genome-Wide Analysis of Allele-Specific Expression Patterns in Seventeen Tissues of Korean Cattle (Hanwoo) Kyu-Sang Lim 1 , Sun-Sik Chang 2, Bong-Hwan Choi 3, Seung-Hwan Lee 4, Kyung-Tai Lee 3 , Han-Ha Chai 3, Jong-Eun Park 3 , Woncheoul Park 3 and Dajeong Lim 3,* 1 Department of Animal Science, Iowa State University, Ames, IA 50011, USA; [email protected] 2 Hanwoo Research Institute, National Institute of Animal Science, Rural Development Administration, Pyeongchang 25340, Korea; [email protected] 3 Animal Genomics and Bioinformatics Division, National Institute of Animal Science, Rural Development Administration, Wanju 55365, Korea; [email protected] (B.-H.C.); [email protected] (K.-T.L.); [email protected] (H.-H.C.); [email protected] (J.-E.P.); [email protected] (W.P.) 4 Division of Animal and Dairy Science, Chungnam National University, Daejeon 34134, Korea; [email protected] * Correspondence: [email protected] Received: 26 July 2019; Accepted: 23 September 2019; Published: 26 September 2019 Simple Summary: Allele-specific expression (ASE) is the biased allelic expression of genetic variants within the gene. Recently, the next-generation sequencing (NGS) technologies allowed us to detect ASE genes at a transcriptome-wide level. It is essential for the understanding of animal development, cellular programming, and the effect on their complexity because ASE shows developmental, tissue, or species-specific patterns. However, these aspects of ASE still have not been annotated well in farm animals and most studies were conducted mainly at the fetal stages. Hence, the current study focuses on detecting ASE genes in 17 tissues in adult cattle.
[Show full text]
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
Screening of a Clinically and Biochemically Diagnosed SOD Patient Using Exome Sequencing: a Case Report with a Mutations/Variations Analysis Approach
The Egyptian Journal of Medical Human Genetics (2016) 17, 131–136 HOSTED BY Ain Shams University The Egyptian Journal of Medical Human Genetics www.ejmhg.eg.net www.sciencedirect.com CASE REPORT Screening of a clinically and biochemically diagnosed SOD patient using exome sequencing: A case report with a mutations/variations analysis approach Mohamad-Reza Aghanoori a,b,1, Ghazaleh Mohammadzadeh Shahriary c,2, Mahdi Safarpour d,3, Ahmad Ebrahimi d,* a Department of Medical Genetics, Shiraz University of Medical Sciences, Shiraz, Iran b Research and Development Division, RoyaBioGene Co., Tehran, Iran c Department of Genetics, Shahid Chamran University of Ahvaz, Ahvaz, Iran d Cellular and Molecular Research Center, Research Institute for Endocrine Sciences, Shahid Beheshti University of Medical Sciences, Tehran, Iran Received 12 May 2015; accepted 15 June 2015 Available online 22 July 2015 KEYWORDS Abstract Background: Sulfite oxidase deficiency (SOD) is a rare neurometabolic inherited disor- Sulfite oxidase deficiency; der causing severe delay in developmental stages and premature death. The disease follows an auto- Case report; somal recessive pattern of inheritance and causes deficiency in the activity of sulfite oxidase, an Exome sequencing enzyme that normally catalyzes conversion of sulfite to sulfate. Aim of the study: SOD is an underdiagnosed disorder and its diagnosis can be difficult in young infants as early clinical features and neuroimaging changes may imitate some common diseases. Since the prognosis of the disease is poor, using exome sequencing as a powerful and efficient strat- egy for identifying the genes underlying rare mendelian disorders can provide important knowledge about early diagnosis, disease mechanisms, biological pathways, and potential therapeutic targets.
[Show full text]
Tepzz¥ 6Z54za T
(19) TZZ¥ ZZ_T (11) EP 3 260 540 A1 (12) EUROPEAN PATENT APPLICATION (43) Date of publication: (51) Int Cl.: 27.12.2017 Bulletin 2017/52 C12N 15/113 (2010.01) A61K 9/127 (2006.01) A61K 31/713 (2006.01) C12Q 1/68 (2006.01) (21) Application number: 17000579.7 (22) Date of filing: 12.11.2011 (84) Designated Contracting States: • Sarma, Kavitha AL AT BE BG CH CY CZ DE DK EE ES FI FR GB Philadelphia, PA 19146 (US) GR HR HU IE IS IT LI LT LU LV MC MK MT NL NO • Borowsky, Mark PL PT RO RS SE SI SK SM TR Needham, MA 02494 (US) • Ohsumi, Toshiro Kendrick (30) Priority: 12.11.2010 US 412862 P Cambridge, MA 02141 (US) 20.12.2010 US 201061425174 P 28.07.2011 US 201161512754 P (74) Representative: Clegg, Richard Ian et al Mewburn Ellis LLP (62) Document number(s) of the earlier application(s) in City Tower accordance with Art. 76 EPC: 40 Basinghall Street 11840099.3 / 2 638 163 London EC2V 5DE (GB) (71) Applicant: The General Hospital Corporation Remarks: Boston, MA 02114 (US) •Thecomplete document including Reference Tables and the Sequence Listing can be downloaded from (72) Inventors: the EPO website • Lee, Jeannie T •This application was filed on 05-04-2017 as a Boston, MA 02114 (US) divisional application to the application mentioned • Zhao, Jing under INID code 62. San Diego, CA 92122 (US) •Claims filed after the date of receipt of the divisional application (Rule 68(4) EPC). (54) POLYCOMB-ASSOCIATED NON-CODING RNAS (57) This invention relates to long non-coding RNAs (IncRNAs), libraries of those ncRNAs that bind chromatin modifiers, such as Polycomb Repressive Complex 2, inhibitory nucleic acids and methods and compositions for targeting IncRNAs.
[Show full text]
Supplemental Figures
Supplemental Figures Development of a new macrophage-specific TRAP mouse (MacTRAP) and definition of the renal macrophage translational signature Andreas Hofmeister, Maximilian C. Thomassen, Sabrina Markert, André Marquardt, Mathieu Preußner, Martin Rußwurm, Ralph Schermuly, Ulrich Steinhoff, Hermann-Josef Gröne, Joachim Hoyer, Benjamin D. Humphreys, Ivica Grgic Correspondence: Ivica Grgic MD, Klinikum der Philips-Universität Marburg, Baldingerstrasse 1, 35043 Marburg. Phone: +4964215861736, email: [email protected] Sup. Fig. S1 Δ6.7fmsGFP-L10a plasmid (pGL2 backbone) Sup. Fig. S1: Plasmid map of the engineered c-fms-eGFP-L10a expression vector. Mlu1/Sal1 digestion was used for linearization and extraction of the transgene. Sup. Fig. S2 A Neutrophils Monocytes Lymphocytes B Monocytes Monocytes Neutrophils Lymphocytes H - TRAP Ly6g Count FSC CD115 Mac GFP GFP GFP GFP H - Ly6g Count FSC CD115 Wild Wild type GFP GFP GFP GFP Sup. Fig. S2: FACS analysis detects eGFP-L10a signals in monocytes but not in neutrophils or lymphocytes isolated from peripheral blood of MacTRAP mice. (A) Gating strategy to define monocyte, neutrophil and lymphocyte populations. Only single cells contributed to the analysis. (B) GFP-fluorescence was specifically detected in CD115+ monocytes, but not in Ly6g+ neutrophils or lymphocytes of MacTRAP mice. Blood samples from wild-type mice served as negative controls. Representative plots are shown, n=6. Sup. Fig. S3 A eGFP-L10a Ly6g merge+DAPI kidney 7d UUO B eGFP-L10a Ly6g merge+DAPI incision skin Tail Sup. Fig. S3: Immunostaining for mature neutrophils in fibrotic kidney tissue and tail skin biopsies from MacTRAP mice. (A) Only a very small fraction of Ly6g+ neutrophils is positive for eGFP-L10a in fibrotic kidneys after 7d UUO (0.42% ± 0.29%; 468 cells counted, n=3).
[Show full text]
A Genomic Approach to Delineating the Occurrence of Scoliosis in Arthrogryposis Multiplex Congenita
G C A T T A C G G C A T genes Article A Genomic Approach to Delineating the Occurrence of Scoliosis in Arthrogryposis Multiplex Congenita Xenia Latypova 1, Stefan Giovanni Creadore 2, Noémi Dahan-Oliel 3,4, Anxhela Gjyshi Gustafson 2, Steven Wei-Hung Hwang 5, Tanya Bedard 6, Kamran Shazand 2, Harold J. P. van Bosse 5 , Philip F. Giampietro 7,* and Klaus Dieterich 8,* 1 Grenoble Institut Neurosciences, Université Grenoble Alpes, Inserm, U1216, CHU Grenoble Alpes, 38000 Grenoble, France; [email protected] 2 Shriners Hospitals for Children Headquarters, Tampa, FL 33607, USA; [email protected] (S.G.C.); [email protected] (A.G.G.); [email protected] (K.S.) 3 Shriners Hospitals for Children, Montreal, QC H4A 0A9, Canada; [email protected] 4 School of Physical & Occupational Therapy, Faculty of Medicine and Health Sciences, McGill University, Montreal, QC H3G 2M1, Canada 5 Shriners Hospitals for Children, Philadelphia, PA 19140, USA; [email protected] (S.W.-H.H.); [email protected] (H.J.P.v.B.) 6 Alberta Congenital Anomalies Surveillance System, Alberta Health Services, Edmonton, AB T5J 3E4, Canada; [email protected] 7 Department of Pediatrics, University of Illinois-Chicago, Chicago, IL 60607, USA 8 Institut of Advanced Biosciences, Université Grenoble Alpes, Inserm, U1209, CHU Grenoble Alpes, 38000 Grenoble, France * Correspondence: [email protected] (P.F.G.); [email protected] (K.D.) Citation: Latypova, X.; Creadore, S.G.; Dahan-Oliel, N.; Gustafson, Abstract: Arthrogryposis multiplex congenita (AMC) describes a group of conditions characterized A.G.; Wei-Hung Hwang, S.; Bedard, by the presence of non-progressive congenital contractures in multiple body areas.
[Show full text]
Screening of a Clinically and Biochemically Diagnosed SOD Patient Using Exome Sequencing: a Case Report with a Mutations/Variations Analysis Approach
The Egyptian Journal of Medical Human Genetics (2016) 17, 131–136 HOSTED BY Ain Shams University The Egyptian Journal of Medical Human Genetics www.ejmhg.eg.net www.sciencedirect.com CASE REPORT Screening of a clinically and biochemically diagnosed SOD patient using exome sequencing: A case report with a mutations/variations analysis approach Mohamad-Reza Aghanoori a,b,1, Ghazaleh Mohammadzadeh Shahriary c,2, Mahdi Safarpour d,3, Ahmad Ebrahimi d,* a Department of Medical Genetics, Shiraz University of Medical Sciences, Shiraz, Iran b Research and Development Division, RoyaBioGene Co., Tehran, Iran c Department of Genetics, Shahid Chamran University of Ahvaz, Ahvaz, Iran d Cellular and Molecular Research Center, Research Institute for Endocrine Sciences, Shahid Beheshti University of Medical Sciences, Tehran, Iran Received 12 May 2015; accepted 15 June 2015 Available online 22 July 2015 KEYWORDS Abstract Background: Sulfite oxidase deficiency (SOD) is a rare neurometabolic inherited disor- Sulfite oxidase deficiency; der causing severe delay in developmental stages and premature death. The disease follows an auto- Case report; somal recessive pattern of inheritance and causes deficiency in the activity of sulfite oxidase, an Exome sequencing enzyme that normally catalyzes conversion of sulfite to sulfate. Aim of the study: SOD is an underdiagnosed disorder and its diagnosis can be difficult in young infants as early clinical features and neuroimaging changes may imitate some common diseases. Since the prognosis of the disease is poor, using exome sequencing as a powerful and efficient strat- egy for identifying the genes underlying rare mendelian disorders can provide important knowledge about early diagnosis, disease mechanisms, biological pathways, and potential therapeutic targets.
[Show full text]
Tetracyclines Promote Survival and Fitness in Mitochondrial Disease Models
LETTERS https://doi.org/10.1038/s42255-020-00334-y Tetracyclines promote survival and fitness in mitochondrial disease models Elizabeth A. Perry1,2,3,5, Christopher F. Bennett 1,2,5, Chi Luo1,2, Eduardo Balsa1,2, Mark Jedrychowski1,2, Katherine E. O’Malley1,2, Pedro Latorre-Muro 1,2, Richard Porter Ladley 4, Kamar Reda4, Peter M. Wright4, Steven P. Gygi 2, Andrew G. Myers4 and Pere Puigserver 1,2 ✉ Mitochondrial diseases (MDs) are a heterogeneous group of and drugs that inhibit HSP90 and the mammalian target of disorders resulting from mutations in nuclear or mitochondrial rapamycin (mTOR; Fig. 1c). mTOR inhibitors improve lifespan DNA genes encoding mitochondrial proteins1,2. MDs cause in multiple models of MDs12–15, validating our screening platform pathologies with severe tissue damage and ultimately death3,4. for moving compounds towards in vivo testing. Top hits from the There are no cures for MDs and current treatments are only screen were retested in a non-high-throughput 7-d low-glucose palliative5–7. Here we show that tetracyclines improve fitness cell survival assay (Fig. 1d). Among the top-scoring compounds, of cultured MD cells and ameliorate disease in a mouse model tetracyclines such as doxycycline promoted the highest survival of Leigh syndrome. To identify small molecules that prevent and proliferation in MELAS cells (Fig. 1d). These effects were not cellular damage and death under nutrient stress conditions, exclusive to MELAS cybrids as other mitochondrial mutant cells we conduct a chemical high-throughput screen with cells car- such as Rieske (complex III) knockout (KO) mouse fibroblasts16 rying human MD mutations and discover a series of antibiotics and ND1 A3796G and ND6 G14459A (complex I)17 homoplasmic that maintain survival of various MD cells.
[Show full text]
Compound Heterozygous GFM2 Mutations with Leigh Syndrome Complicated by Arthrogryposis Multiplex Congenita
Journal of Human Genetics (2015) 60, 509–513 & 2015 The Japan Society of Human Genetics All rights reserved 1434-5161/15 www.nature.com/jhg ORIGINAL ARTICLE Compound heterozygous GFM2 mutations with Leigh syndrome complicated by arthrogryposis multiplex congenita Shinobu Fukumura1, Chihiro Ohba2, Toshihide Watanabe3, Kimio Minagawa3, Masaru Shimura4, Kei Murayama4, Akira Ohtake5, Hirotomo Saitsu2, Naomichi Matsumoto2 and Hiroyuki Tsutsumi1 Defects in the mitochondrial translation apparatus can impair energy production in affected tissues and organs. Most components of this apparatus are encoded by nuclear genes, including GFM2, which encodes a mitochondrial ribosome recycling factor. A few patients with mutations in some of these genes have been reported to date. Here, we present two female siblings with arthrogryposis multiplex congenita, optic atrophy and severe mental retardation. The younger sister had a progressive cerebellar atrophy and bilateral neuropathological findings in the brainstem. Although her cerebrospinal fluid (CSF) levels of lactate and pyruvate were not increased, brain magnetic resonance spectroscopy showed a lactate peak. Additionally, her CSF lactate/pyruvate and serum beta-hydroxybutyrate/acetoacetate ratios were high, and levels of oxidative phosphorylation in skin fibroblasts were reduced. We therefore diagnosed Leigh syndrome. Genomic investigation confirmed the presence of compound heterozygous GFM2 mutations (c.206+4A4G and c.2029-1G4A) in both siblings, causing aberrant splicing with premature stop codons (p.Gly50Glufs*4
[Show full text]
Supplementary Table 1 Double Treatment Vs Single Treatment
Supplementary table 1 Double treatment vs single treatment Probe ID Symbol Gene name P value Fold change TC0500007292.hg.1 NIM1K NIM1 serine/threonine protein kinase 1.05E-04 5.02 HTA2-neg-47424007_st NA NA 3.44E-03 4.11 HTA2-pos-3475282_st NA NA 3.30E-03 3.24 TC0X00007013.hg.1 MPC1L mitochondrial pyruvate carrier 1-like 5.22E-03 3.21 TC0200010447.hg.1 CASP8 caspase 8, apoptosis-related cysteine peptidase 3.54E-03 2.46 TC0400008390.hg.1 LRIT3 leucine-rich repeat, immunoglobulin-like and transmembrane domains 3 1.86E-03 2.41 TC1700011905.hg.1 DNAH17 dynein, axonemal, heavy chain 17 1.81E-04 2.40 TC0600012064.hg.1 GCM1 glial cells missing homolog 1 (Drosophila) 2.81E-03 2.39 TC0100015789.hg.1 POGZ Transcript Identified by AceView, Entrez Gene ID(s) 23126 3.64E-04 2.38 TC1300010039.hg.1 NEK5 NIMA-related kinase 5 3.39E-03 2.36 TC0900008222.hg.1 STX17 syntaxin 17 1.08E-03 2.29 TC1700012355.hg.1 KRBA2 KRAB-A domain containing 2 5.98E-03 2.28 HTA2-neg-47424044_st NA NA 5.94E-03 2.24 HTA2-neg-47424360_st NA NA 2.12E-03 2.22 TC0800010802.hg.1 C8orf89 chromosome 8 open reading frame 89 6.51E-04 2.20 TC1500010745.hg.1 POLR2M polymerase (RNA) II (DNA directed) polypeptide M 5.19E-03 2.20 TC1500007409.hg.1 GCNT3 glucosaminyl (N-acetyl) transferase 3, mucin type 6.48E-03 2.17 TC2200007132.hg.1 RFPL3 ret finger protein-like 3 5.91E-05 2.17 HTA2-neg-47424024_st NA NA 2.45E-03 2.16 TC0200010474.hg.1 KIAA2012 KIAA2012 5.20E-03 2.16 TC1100007216.hg.1 PRRG4 proline rich Gla (G-carboxyglutamic acid) 4 (transmembrane) 7.43E-03 2.15 TC0400012977.hg.1 SH3D19
[Show full text]
Exploring the Potential of Machine Learning Methods and Selection
From the Institute of Animal Breeding and Genetics Justus-Liebig-University Gießen Exploring the potential of machine learning methods and selection signature analyses for the estimation of genomic breeding values, the estimation of SNP effects and the identification of possible candidate genes in dairy cattle Dissertation to obtain the doctoral degree (Dr. agr.) in the Faculty of Agricultural Science, Nutritional Science and Environmental Management of Justus-Liebig-University Gießen, Germany presented by Saeid Naderi Darbaghshahi born in Esfahan, Iran Gießen, March 2018 1st Referee: Prof. Dr. Sven König Institute of Animal Breeding and Genetics Justus-Liebig-University Gießen, Germany 2nd Referee: Prof. Dr. Nicolas Gengler Animal Science Unit, Numerical Genetics, Genomics and Modeling Agriculture, Bio-engineering and Chemistry Department University of Liège - Gembloux Agro-Bio Tech, Belgium Table of Contents SUMMARY ........................................................................................................................... 1 1st Chapter General introduction ........................................................................................... 3 From conventional pedigree-based selection towards genomic selection ............................. 4 Effects of genomic selection on rate of genetic gain ............................................................. 5 Factors that affect accuracy of genomic prediction ............................................................... 5 Methods of genomic prediction ............................................................................................
[Show full text]
THE USE of WHOLE EXOME SEQUENCING to DETECT NOVEL GENETIC DISORDERS: TWO CASES and an ASSESSMENT of the TECHNOLOGY by Lauren
THE USE OF WHOLE EXOME SEQUENCING TO DETECT NOVEL GENETIC DISORDERS: TWO CASES AND AN ASSESSMENT OF THE TECHNOLOGY by Lauren Westerfield BS Psychology, Florida State University, 2011 Submitted to the Graduate Faculty of Graduate School of Public Health in partial fulfillment of the requirements for the degree of Master of Science University of Pittsburgh 2013 UNIVERSITY OF PITTSBURGH Graduate School of Public Health This thesis was presented by Lauren Westerfield It was defended on March 26, 2013 and approved by Robin Grubs, Ph.D., Assistant Professor, Department of Human Genetics, Graduate School of Public Health, University of Pittsburgh M. Michael Barmada, Ph.D., Associate Professor, Department of Human Genetics, Graduate School of Public Health, University of Pittsburgh Thesis Director: Gerard Vockley, M.D., Ph.D., Professor, Department of Pediatrics, School of Medicine, University of Pittsburgh ii Copyright © by Lauren Westerfield 2013 iii THE USE OF WHOLE EXOME SEQUENCING TO DETECT NOVEL GENETIC DISORDERS: TWO CASES AND AN ASSESSMENT OF THE TECHNOLOGY Lauren Westerfield, MS University of Pittsburgh, 2013 ABSTRACT Over the past several years whole exome sequencing (WES) by high-throughput sequencing of target-enriched genomic DNA has become both technically feasible and financially practical as a means of studying Mendelian disorders. It is also entering the clinical realm as a powerful diagnostic tool for cases that have eluded answers and a cost effective one for cases with a suspected genetically heterogeneous disorder or set of differentials. This thesis examines the strategies for use and impact of such a technology in both the research and clinical setting. It presents an analysis of two cases in which WES was used to determine the causative mutation in the phenotype of an unknown/undiagnosed genetic disorder.
[Show full text]