Anti-GFM2 (Aa 436-612) Polyclonal Antibody (DPABH-12102) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-GFM2 (Aa 436-612) Polyclonal Antibody (DPABH-12102) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Anti-GFM2 (aa 436-612) polyclonal antibody (DPABH-12102) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description GFM2 is a mitochondrial translation elongation factor. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known. Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. Immunogen Recombinant fragment corresponding to Human GFM2 aa 436-612. (BC015712)Sequence: VGLKHTATGDTIVSSKSSALAAARRAEREGEKKHRQNNEAERLLLAGVEI PEPVFFCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGM GELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLDRTLGDK RHLVTVEVEARPIETSSVMPV Isotype IgG Source/Host Rabbit Species Reactivity Mouse, Human Purification Immunogen affinity purified Conjugate Unconjugated Applications IHC-P, WB Format Liquid Size 100 μg Buffer pH: 7.20; Constituents: 98% PBS, 1% BSA Preservative 0.02% Sodium Azide Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved GENE INFORMATION Gene Name GFM2 G elongation factor, mitochondrial 2 [ Homo sapiens ] Official Symbol GFM2 Synonyms GFM2; G elongation factor, mitochondrial 2; ribosome-releasing factor 2, mitochondrial; EFG2; FLJ21661; MSTP027; mitochondrial elongation factor G2; elongation factor G 2, mitochondrial; mitochondrial ribosome recycling factor 2; RRF2; MRRF2; hEFG2; MST027; RRF2mt; EF-G2mt; mEF-G 2; Entrez Gene ID 84340 Protein Refseq NP_115756 UniProt ID Q969S9 Chromosome Location 5q13 Function GTP binding; GTPase activity; nucleotide binding; NOT translation elongation factor activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

View Full Text

Details

  • File Type
    pdf
  • Upload Time
    -
  • Content Languages
    English
  • Upload User
    Anonymous/Not logged-in
  • File Pages
    2 Page
  • File Size
    -

Download

Channel Download Status
Express Download Enable

Copyright

We respect the copyrights and intellectual property rights of all users. All uploaded documents are either original works of the uploader or authorized works of the rightful owners.

  • Not to be reproduced or distributed without explicit permission.
  • Not used for commercial purposes outside of approved use cases.
  • Not used to infringe on the rights of the original creators.
  • If you believe any content infringes your copyright, please contact us immediately.

Support

For help with questions, suggestions, or problems, please contact us