DOCSLIB.ORG

Logosphere a Digital Library of Formal Proof

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Logosphere a Digital Library of Formal Proof Logosphere A Digital Library of Formal Proof Carsten Schürmann Processor Verification • INTEL (HOL/HOL light). [John Harrison] • $500mio Pentium bug. • AMD (ACL2, Nqthm). [Matt Kaufmann] • Siemens, Microsoft (ASM). [Yuri Gurevich] Newton-Raphson iteration or power series expansion, and it Yet since the error bounds are necessarily pessimistic, as- culminates in a final fma that rounds a ‘result before the fi- suming worst-case rounding errors reinforcing each other nal rounding’ . In general, may be irrational, whereas on all the previous operations, it seems quite likely that the the final is of the form for some floating-point algorithm is in fact correct. How can we bridge the gap? numbers , and and is therefore always rational. This One solution is to utilize more refined theorems [32], shows that in general we cannot expect . However but this is complicated and may still fail to justify several we do require that they always round in the same way. How algorithms that are intuitively believed to work correctly. might this be proved? An ingenious alternative [11] is to observe that there are On general grounds we note that cannot be exactly relatively few cases like whose square roots the midpoint between two floating-point numbers, because come close enough to render the simple theorem inappli- in a floating-point format with bits of precision, a mid- cable, and these can be isolated by fairly straightforward point value has significant digits and therefore its number-theoretic methods. We can therefore: square more than . This is a useful observation. We’ll never be in the tricky case where theNreewatroen-tRwapohseoqn uitearlaltiyoncolropsoewer series expanIssionl,aatned itthe sYpeet csinacle cthaeseerrsor bounds are nectehssaatrilyhapvesesimsiqstuica, raes- floating-point numbers (resolved bcyulmtihneates‘rinoaufinndal ftomaethvaet nro’unds a ‘result berfoooretsthewfii-thin stuhmeincgriwtoicrsat-lcadsiesrtoaunncdiengoefrraorms riedinpfoorciinntg. each other rule.) So in round-to-nearest, anndal roundcinogu’ ld.oInngleynerroalu, ndmay be irrational, whereas on all the previous operations, it seems quite likely that the the final is of the form for some floCatoinng-cplouindte froalmgortithhem issiimn fpaclet cothrrecot.rHemow cthanawt ethbreidagelgthoergiatph?m in different ways if there were a midpnuominbetrsbe,twaenedn tahnedmis,thfeorerfore always rational. This One solution is to utilize more refined theorems [32], will give correct results except possibly for . only then could the closest floating-shpoowisntthant uinmgebneerrasl wtoe ctahnneomt expect . However but this is complicated and may still fail to justify several we do require that they always round in the same way. How algorithms that are intuitively believed to work correctly. differ. For example in the followinmgigdhtiathgisrbaemprowvehde? re large Explicitly shAonwingthenatiousthaleteranalgtivoer[ith11]mis tios ocboserrectrve thatfothrerethaere lines indicate floating-point numbers aOnndgesnmeraallglerorunodns ewse rneopte-that cannot be exactly relatively few cases like whose square roots the midpoint between two floating-point numbers, because (ecofmfeecctliovseleynobuyghrtuonrennidnegr tihteosinmpthleotsheorienmpuintasp)p.li- resent midpoints, would round ‘indoa wflona’tinwg-hpoilinet formawt owuithld bits of precision, a mid- cable, and these can be isolated by fairly straightforward round ‘up’: FormalpoinVt erificationvalue hasat Intel significant digits andBtyhesreofomreeitsstraignhutmfboerrw-thaerodretmic amtehtheomds.aWtiecsca[n1t1he]reffoorem: alized in Newton-Raphson iteration or power series expansion, and it Yet since the esrqrour aboruendms aorerenectehsasanrily p.essTimhisitsic,iass-a useful observation. We’ll culminates in a final fma that rounds a ‘result before the fi- suming worst-case rounding errors reinforcing each other HOL without particular difficulty, one can show that the dif- nal rounding’ . In general, may be irrational, whereas on all the previnoeusvoepJreorbhatneioHninas,rritithssoenemtrsicqukitye lcikaeslyethwaththeere there are two equally close Isolate the special cases that have square the final is of the form for some floating-point algorithm is inflfIanoctetalctoCirnorergpc-to.prHaotoioiwnn,ctaJnFn1wu-1em3brbidegresthe(graeps?olved by thefic‘ruoultndcatoseesvefno’ r squarerorootsowtisthhinatvheecsriitgicnalidfiisctanncde sof a,mcidopnosinitd. ered numbers , and and is therefore always rational. This One solution 2is11to1 NutEiliz2e5tmh oArveenreufiened theorems [32], rule.) So in round-to-nearest, and could only round shows that in general we cannot expect . However but this is complicatedHillsbanordomOayR, stillUSAfail to justify several as -bit integers, suchCotnhcalutdoenfreomofthtehseimfpolelltoheworienmgthdaitothpehaalgnotriinthem we do require that they always round in the same way. How algorithms jthoaihtnnarhde@iiifnftcuehitrievpenslyt.wbienlaiteyveseld.iftcotohwmeorrkecworreerctelya. midpoint between them, for might this be proved? An ingenious alternative [11] is to observe that there are equations has a solutiwoilnl givefcoorrrseoctmreseulitns etxecgeeptrpossibly for , where. On general gWhat’rounds we note that cannot besexactly Intelrelatively few coanselsyl iktehupen could t hwehto?ocselosqsuearsetroflootsating-point numbers to them the midpointAbetlwtehenotwuo gflohating-paoinntanulmybezrsi,nbegcause tAhbsictsroamcet ccloosenenddouiigfthfietor.rnenFdoer ctrheocextlsyamimomnpbapllelliptehonsesioainbreltemotinhpirneuatisp.afpoTllhil-illsoyinwvolivnesgfordmiinaggmraathimes- wroheureghlalrygethe factoExrpblicitlyy whshiocwh ththate thgeualgraonrithtemedisrceolrrectativfoe retrh-e in a floating-point format with bits of precision, a mid- cable, and thelseinceans biendisoiclaatemtdeatbicflyalofmaaiortdliyenlssgotrf-atpihgeohstyifsnotretwmnaarnuddmitsbineternsdedabnedhavsiomr anadller ones rep- point value has significant digits aAnsddethsiegrnesfobreecoimtse morencuommbpleerx-,thfoeromreatlicvemrifiecthatoiodns. Welcinaknintghethre ftworoe:: ror is excessive: (effectively by running it on those inputs). squarewmooreuthland . bTehis ics oa umsefpul loteibccshenraiqvuatetiesonadr.e,Wbeetc’ohlml iengriencreaissinglyaimpmorretausntecninhtthme sidimpoipnltse,r suwfofiucldieronutnd ‘down’ while would never be in the tricky case where there arheatrwdwoaerequinadlulystrcyl.oMseany different Imseotlhaotdestahree usspeedc,iraalngc-ases that havAectusqaluraerqeuirements condition. One cinag fnrom eproapossiitilonyal tasuteoloegy ctrhhoeockatisntwg uitiphrtitnowtuheneuocdsreiut‘oiucflapldd’i:sstanucefofif acmeidptooint.show By some straightforward mathematics [11] formalized in floating-point numbers (resolved by thinete‘rraocutinvedhtigoheerv-oernd’er theorem provers. Our own work is rule.) SoHOLin round-to-ne ar es t, an d co u ld o nl y ro un d [Harrison’03] mainly concerned with the formalCvoernificcluadtioenfroofmflotahtiengs-imple theorem that the algorithm HOL without particular difficulty, one can show that the dif- in diffetrehntawtayfs iof trherae wneyre ammidipdoinpptoboientwimneaethntetmhaetmica,:lfofurnctions. As this paper aims to illus- Mathematical specification will give correct results except possibly for . only then could the closest floating-pointrtanteu,msubcherasptpolictahteiomns require a rather general mathemat- ficult cases for square roots have significands , considered ical framework and the ability to automate special-purpose differ. For example in the following diagram where large Explicitly show that the algorithm is correct for the as -bit integers, such that one of the following diophantine lines indiFloatingcate floating-point num bPersointanpdrosomf aallge orroarithmeticitnhmess rienpa- reliable way. Our w.ork uses the Mathematical model We consider the equations separately for each chosen public-domain interactive theorem prover HOL(Lefigfehct,tiavnedly by running it on those inputs). equations has a solution for some integer , where resent midpoints, would round ‘dowwne’cwlahimilethat thwisoaunld similar ‘LCF-style’ theorem provers round ‘up’: . For example, we might be interested in whether are a good choice for such applicBaytiosnosm. e straighAtfolrtwhaordumgahthemaatnicasl[y11z]ifnorgmalActuitzhedialsinsystemcondition combinatorially is roughly the factor by which the guaranteed relative er- HOL without particular difficulty, one can show that the dif- ror is excessive: In that case and coficuullt dcasnes’fotrwlsqioueaurelodronobtsehoacvpoe spmigonpilfisicciaantdetseds,,ciodtnhseiedreseredoisfa much simpler sufficient has a solution. If so, the possible value(s) 1 Formal Verificationas -bit integercs,osnucdhitthiaot non.e Oof ntThheeeffcoalcaltosnwthieantag(sid)igolepythtiansngetaienmetahthaemtaititcawl prooouflrdighst uisffice to show . Here is the formal theorem in HOL in aalso dmifficoultr[e13], ganed (nii)ecorrraecltness of formaol mfodels are added to the set of difficult cases. It’s quite easy equations has athsoaluttifoonr afonrysomeiidnpteogeirnt : , where Although analyzing this condition Acsomobsitnpartoogrriaamllmy ers knowistorothuegirhRoundclyostth, ewfriatcintgorpbroy- wh icdhtheoethsenogtunaer caensamesstaereidlyriemlaptlyivceoerr re-cwatness of tyhe actifual system [15], were called on to denigrate the idea of formal verifi- would fboe crompl:icated, there is a muchgrsaimmsptlheart sfunffictcioiennctorrectlryorinisaellxciercsusimvset:ances — or to program HOL to enumerate all the solutions of such dio- sometimes even saying precisely what that means — is dif- cation in the 70s. However, these objections seem to have
Load more

Recommended publications
  • Hypertext Semiotics in the Commercialized Internet
    Hypertext Semiotics in the Commercialized Internet Moritz Neumüller Wien, Oktober 2001 DOKTORAT DER SOZIAL- UND WIRTSCHAFTSWISSENSCHAFTEN 1. Beurteiler: Univ. Prof. Dipl.-Ing. Dr. Wolfgang Panny, Institut für Informationsver- arbeitung und Informationswirtschaft der Wirtschaftsuniversität Wien, Abteilung für Angewandte Informatik. 2. Beurteiler: Univ. Prof. Dr. Herbert Hrachovec, Institut für Philosophie der Universität Wien. Betreuer: Gastprofessor Univ. Doz. Dipl.-Ing. Dr. Veith Risak Eingereicht am: Hypertext Semiotics in the Commercialized Internet Dissertation zur Erlangung des akademischen Grades eines Doktors der Sozial- und Wirtschaftswissenschaften an der Wirtschaftsuniversität Wien eingereicht bei 1. Beurteiler: Univ. Prof. Dr. Wolfgang Panny, Institut für Informationsverarbeitung und Informationswirtschaft der Wirtschaftsuniversität Wien, Abteilung für Angewandte Informatik 2. Beurteiler: Univ. Prof. Dr. Herbert Hrachovec, Institut für Philosophie der Universität Wien Betreuer: Gastprofessor Univ. Doz. Dipl.-Ing. Dr. Veith Risak Fachgebiet: Informationswirtschaft von MMag. Moritz Neumüller Wien, im Oktober 2001 Ich versichere: 1. daß ich die Dissertation selbständig verfaßt, andere als die angegebenen Quellen und Hilfsmittel nicht benutzt und mich auch sonst keiner unerlaubten Hilfe bedient habe. 2. daß ich diese Dissertation bisher weder im In- noch im Ausland (einer Beurteilerin / einem Beurteiler zur Begutachtung) in irgendeiner Form als Prüfungsarbeit vorgelegt habe. 3. daß dieses Exemplar mit der beurteilten Arbeit überein
    [Show full text]
  • The Semiosphere, Between Informational Modernity and Ecological Postmodernity Pierre-Louis Patoine Et Jonathan Hope
    Document généré le 28 sept. 2021 03:48 Recherches sémiotiques Semiotic Inquiry The Semiosphere, Between Informational Modernity and Ecological Postmodernity Pierre-Louis Patoine et Jonathan Hope J. M. Lotman Résumé de l'article Volume 35, numéro 1, 2015 Parmi les notions développées par Lotman, celle de sémiopshère est certainement celle qui a été la plus commentée. Dans cet article, nous URI : https://id.erudit.org/iderudit/1050984ar explorons ses dimensions écologiques et biologiques, en remontant au concept DOI : https://doi.org/10.7202/1050984ar de biosphère proposé par Vernadsky et à la vision environnementale de l’art qui apparaît chez Lotman dès La Structure du texte artistique. Notre enquête Aller au sommaire du numéro expose les aspects biosémiotiques de la pensée lotmanienne, aspects qui permettent l’émergence, en son sein, d’un modèle cyclique, homéostatique de la culture, contrebalançant ainsi une vision moderniste où l’art participe à un progrès naïvement linéaire. Éditeur(s) Association canadienne de sémiotique / Canadian Semiotic Association ISSN 0229-8651 (imprimé) 1923-9920 (numérique) Découvrir la revue Citer cet article Patoine, P.-L. & Hope, J. (2015). The Semiosphere, Between Informational Modernity and Ecological Postmodernity. Recherches sémiotiques / Semiotic Inquiry, 35(1), 11–26. https://doi.org/10.7202/1050984ar Tous droits réservés © Association canadienne de sémiotique / Canadian Ce document est protégé par la loi sur le droit d’auteur. L’utilisation des Semiotic Association, 2018 services d’Érudit (y compris la reproduction) est assujettie à sa politique d’utilisation que vous pouvez consulter en ligne. https://apropos.erudit.org/fr/usagers/politique-dutilisation/ Cet article est diffusé et préservé par Érudit.
    [Show full text]
  • John Benjamins Publishing Company
    John Benjamins Publishing Company This is a contribution from Emotion in Language. Theory – research – application. Edited by Ulrike M. Lüdtke. © 2015. John Benjamins Publishing Company This electronic file may not be altered in any way. The author(s) of this article is/are permitted to use this PDF file to generate printed copies to be used by way of offprints, for their personal use only. Permission is granted by the publishers to post this file on a closed server which is accessible to members (students and staff) only of the author’s/s’ institute, it is not permitted to post this PDF on the open internet. For any other use of this material prior written permission should be obtained from the publishers or through the Copyright Clearance Center (for USA: www.copyright.com). Please contact [email protected] or consult our website: www.benjamins.com Tables of Contents, abstracts and guidelines are available at www.benjamins.com Introduction From logos to dialogue Ulrike M. Lüdtke Leibniz University Hannover This book is inspired by many years of pedagogic and therapeutic work with children and adults in preschool, school and clinical settings. The miracle of language devel- opment and the joy of expressive language on the one hand and the vulnerability of language and the sorrow and grief caused by its distortion or even loss on the other opened my eyes to the inseparability of emotion and language. Even though I had just been part of the editing team for Moving Ourselves, Moving Others: Motion and Emotion in Intersubjectivity, Consciousness and Language (2012), I felt there was a strong need for an interdisciplinary volume focusing exclusively on the enormous importance of emotion in language.
    [Show full text]
  • Postmodern Test Theory
    Postmodern Test Theory ____________ Robert J. Mislevy Educational Testing Service ____________ (Reprinted with permission from Transitions in Work and Learning: Implications for Assessment, 1997, by the National Academy of Sciences, Courtesy of the National Academies Press, Washington, D.C.) Postmodern Test Theory Robert J. Mislevy Good heavens! For more than forty years I have been speaking prose without knowing it. Molière, Le Bourgeois Gentilhomme INTRODUCTION Molière’s Monsieur Jourdan was astonished to learn that he had been speaking prose all his life. I know how he felt. For years I have just been doing my job— trying to improve educational assessment by applying ideas from statistics and psychology. Come to find out, I’ve been advancing “neopragmatic postmodernist test theory” without ever intending to do so. This paper tries to convey some sense of what this rather unwieldy phrase means and offers some thoughts about what it implies for educational assessment, present and future. The goods news is that we can foresee some real improvements: assessments that are more open and flexible, better connected with students’ learning, and more educationally useful. The bad news is that we must stop expecting drop-in-from-the-sky assessment to tell us, in 2 hours and for $10, the truth, plus or minus two standard errors. Gary Minda’s (1995) Postmodern Legal Movements inspired the structure of what follows. Almost every page of his book evokes parallels between issues and new directions in jurisprudence on the one hand and the debates and new developments in educational assessment on the other. Excerpts from Minda’s book frame the sections of this paper.
    [Show full text]
  • Poststructuralism, Cultural Studies, and the Composition Classroom: Postmodern Theory in Practice Author(S): James A
    Poststructuralism, Cultural Studies, and the Composition Classroom: Postmodern Theory in Practice Author(s): James A. Berlin Source: Rhetoric Review, Vol. 11, No. 1 (Autumn, 1992), pp. 16-33 Published by: Taylor & Francis, Ltd. Stable URL: https://www.jstor.org/stable/465877 Accessed: 13-02-2019 19:20 UTC REFERENCES Linked references are available on JSTOR for this article: https://www.jstor.org/stable/465877?seq=1&cid=pdf-reference#references_tab_contents You may need to log in to JSTOR to access the linked references. JSTOR is a not-for-profit service that helps scholars, researchers, and students discover, use, and build upon a wide range of content in a trusted digital archive. We use information technology and tools to increase productivity and facilitate new forms of scholarship. For more information about JSTOR, please contact [email protected]. Your use of the JSTOR archive indicates your acceptance of the Terms & Conditions of Use, available at https://about.jstor.org/terms Taylor & Francis, Ltd. is collaborating with JSTOR to digitize, preserve and extend access to Rhetoric Review This content downloaded from 146.111.138.234 on Wed, 13 Feb 2019 19:20:03 UTC All use subject to https://about.jstor.org/terms JAMES A. BERLIN - ~~~~~~~~~~~~~Purdue University Poststructuralism, Cultural Studies, and the Composition Classroom: Postmodern Theory in Practice The uses of postmodern theory in rhetoric and composition studies have been the object of considerable abuse of late. Figures of some repute in the field-the likes of Maxine Hairston and Peter Elbow-as well as anonymous voices from the Burkean Parlor section of Rhetoric Review-most recently, TS, a graduate student, and KF, a voice speaking for "a general English teacher audience" (192)-have joined the chorus of protest.
    [Show full text]
  • By ROLAND BARTHES
    ROLAND BARTHES by ROLAND BARTHES , \) Translate^Jyy Richard Howard >!)• IP /i I UNIVERSITY OF CALIFORNIA PRESS Berkeley • Los Angeles University of California Press Berkeley and Los Angeles, California Translation © 1977 by Farrar, Straus and Giroux, Inc. \ Originally Published in French as Roland Barthes par Roland Barthes \ * © 1975 Éditions du Seuil \ All rights reserved Published by arrangement with Hill and Wing, a division of Farrar, Straus &_ Giroux, Inc. Printed in the United States of America First California printing, 1994 Library of Congress Cataloging-in-Publication Data Barthes, Roland. [Roland Barthes. English] Roland Barthes /by Roland Barthes ; translated by Richard Howard, p. cm. ISBN 978-0-S20-08783-S I. Barthes, Roland. 2. Semiotics. 1. Title. P8S.B33A3 1994 MO'.92—dc20 [B] 94-7S4S CIP 08 07 10 9 8 The paper used in this publication is both acid-free and totally chlorine-free (TCF). It meets the minimum requirements of ANSI/ NISO Z39.48-1992 (R 1997) (Permanence of Paper). © My thanks to the friends who have kindly helped me in the preparation of this book: Jean-Louis Bouttes, Roland Havas, François Wahl, for the text; Jacques Azanza, Yousseff Baccouche, Isabelle Bardet, Alain Benchaya, Myriam de Ravignan, Denis Roche, for the pictures. ft must all be considered as if spoken by a character in a novel. j / To begin with, some images: they are the author's treat to himself, for finishing his book. His pleasure is a matter of fascination (and thereby quite selfish). I have kept only the images which enthrall me, without my knowing why (such ignorance is the very nature of fascination, and what I shall say about each image will never be anything but .
    [Show full text]
  • Media Theory and Semiotics: Key Terms and Concepts Binary
    Media Theory and Semiotics: Key Terms and Concepts Binary structures and semiotic square of oppositions Many systems of meaning are based on binary structures (masculine/ feminine; black/white; natural/artificial), two contrary conceptual categories that also entail or presuppose each other. Semiotic interpretation involves exposing the culturally arbitrary nature of this binary opposition and describing the deeper consequences of this structure throughout a culture. On the semiotic square and logical square of oppositions. Code A code is a learned rule for linking signs to their meanings. The term is used in various ways in media studies and semiotics. In communication studies, a message is often described as being "encoded" from the sender and then "decoded" by the receiver. The encoding process works on multiple levels. For semiotics, a code is the framework, a learned a shared conceptual connection at work in all uses of signs (language, visual). An easy example is seeing the kinds and levels of language use in anyone's language group. "English" is a convenient fiction for all the kinds of actual versions of the language. We have formal, edited, written English (which no one speaks), colloquial, everyday, regional English (regions in the US, UK, and around the world); social contexts for styles and specialized vocabularies (work, office, sports, home); ethnic group usage hybrids, and various kinds of slang (in-group, class-based, group-based, etc.). Moving among all these is called "code-switching." We know what they mean if we belong to the learned, rule-governed, shared-code group using one of these kinds and styles of language.
    [Show full text]
  • Mental Arithmetic Processes: Testing the Independence of Encoding and Calculation
    Running Head: MENTAL ARITHMETIC PROCESSES 1 Mental Arithmetic Processes: Testing the Independence of Encoding and Calculation Adam R. Frampton and Thomas J. Faulkenberry Tarleton State University Author Note Adam R. Frampton and Thomas J. Faulkenberry, Department of Psychological Sciences, Tarleton State University. This research was supported in part by funding from the Tarleton State University Office of Student Research and Creative Activities. Correspondence concerning this article should be addressed to Thomas J. Faulkenberry, Department of Psychological Sciences, Tarleton State University, Box T-0820, Stephenville, TX 76402. Phone: +1 (254) 968-9816. Email: [email protected] MENTAL ARITHMETIC PROCESSES 2 Abstract Previous work has shown that the cognitive processes involved in mental arithmetic can be decomposed into three stages: encoding, calculation, and production. Models of mental arithmetic hypothesize varying degrees of independence between these processes of encoding and calculation. In the present study, we tested whether encoding and calculation are independent by having participants complete an addition verification task. We manipulated problem size (small, large) as well as problem format, having participants verify equations presented either as Arabic digits (e.g., “3 + 7 = 10”) or using words (e.g., “three + seven = ten”). In addition, we collected trial-by-trial strategy reports. Though we found main effects of both problem size and format on response times, we found no interaction between the two factors, supporting the hypothesis that encoding and calculation function independently. However, strategy reports indicated that manipulating format caused a shift from retrieval based strategies to procedural strategies, particularly on large problems. We discuss these results in light of two competing models of mental arithmetic.
    [Show full text]
  • The Semiosphere, Between Informational Modernity and Ecological Postmodernity Pierre-Louis Patoine and Jonathan Hope
    Document generated on 09/29/2021 12:07 a.m. Recherches sémiotiques Semiotic Inquiry The Semiosphere, Between Informational Modernity and Ecological Postmodernity Pierre-Louis Patoine and Jonathan Hope J. M. Lotman Article abstract Volume 35, Number 1, 2015 The notion of semiosphere is certainly one of Lotman’s most discussed ideas. In this essay, we propose to investigate its ecological and biological dimensions, URI: https://id.erudit.org/iderudit/1050984ar tracing them back to Vernadsky’s concept of biosphere and to Lotman’s DOI: https://doi.org/10.7202/1050984ar environmental vision of art articulated in his early work, The Structure of the Artistic Text. Our investigation reveals how the biosemiotic undercurrents in See table of contents Lotmanian thought enable the emergence of a cyclical, homeostatic model of culture that counterbalances a Modernist vision of art as a force working for unquestioned linear progress. Publisher(s) Association canadienne de sémiotique / Canadian Semiotic Association ISSN 0229-8651 (print) 1923-9920 (digital) Explore this journal Cite this article Patoine, P.-L. & Hope, J. (2015). The Semiosphere, Between Informational Modernity and Ecological Postmodernity. Recherches sémiotiques / Semiotic Inquiry, 35(1), 11–26. https://doi.org/10.7202/1050984ar Tous droits réservés © Association canadienne de sémiotique / Canadian This document is protected by copyright law. Use of the services of Érudit Semiotic Association, 2018 (including reproduction) is subject to its terms and conditions, which can be viewed online. https://apropos.erudit.org/en/users/policy-on-use/ This article is disseminated and preserved by Érudit. Érudit is a non-profit inter-university consortium of the Université de Montréal, Université Laval, and the Université du Québec à Montréal.
    [Show full text]
  • Modeling, Dialogue, and Globality: Biosemiotics and Semiotics of Self. 2
    Sign Systems Studies 31.1, 2003 Modeling, dialogue, and globality: Biosemiotics and semiotics of self. 2. Biosemiotics, semiotics of self, and semioethics Susan Petrilli Dept. of Linguistic Practices and Text Analysis, University of Bari Via Garruba 6, 70100 Bari, Italy e-mail: [email protected] Abstract. The main approaches to semiotic inquiry today contradict the idea of the individual as a separate and self-sufficient entity. The body of an organism in the micro- and macrocosm is not an isolated biological entity, it does not belong to the individual, it is not a separate and self-sufficient sphere in itself. The body is an organism that lives in relation to other bodies, it is intercorporeal and interdependent. This concept of the body finds confir- mation in cultural practices and worldviews based on intercorporeity, inter- dependency, exposition and opening, though nowadays such practices are almost extinct. An approach to semiotics that is global and at once capable of surpassing the illusory idea of definitive and ultimate boundaries to identity presupposes dialogue and otherness. Otherness obliges identity to question the tendency to totalizing closure and to reorganize itself always anew in a process related to ‘infinity’, as Emmanuel Levinas teaches us, or to ‘infinite semiosis’, to say it with Charles Sanders Peirce. Another topic of this paper is the interrelation in anthroposemiosis between man and machine and the implications involved for the future of humanity. Our overall purpose is to develop global semiotics in the direction of “semioethics”, as proposed by S. Petrilli and A. Ponzio and their ongoing research.
    [Show full text]
  • Islam and Postmodernity: M
    Volume 3, Issue 1 Journal of Islamic Thought and Civilization Spring 2013 Islam and Postmodernity: M. Arkoun on Deconstruction Dr. Usman Khalil Ms Abida Khan Abstract Ideologies are directly albeit not always perceptibly related to methodological and epistemological themes. Social psychology also reveals that knowledge depends upon the policy of rejection or incorporation of various philosophies. In the journey of human thought dawned the age of reason with the Era of Enlightenment. Gradually, universal values and the scientific method gained supremacy. And then all the grand narratives stood redundant and rejected, giving rise to the need to re-search, re-analyze, and re-think every work done thus far with the aim to de-construct the now-discarded. This research studies the greatly admired post structural theory of deconstruction and its proponents in the Muslim civilizations to evaluate its impact on contemporary Muslim thought. The rationale of the study is a critical appraisal of the theoretical concepts in the Muslim world in response or reaction to the current epistemological influences from the West. This exploration led to the conclusion that the scholars of the Islamic world missed the point by going a bit too far as the Holy Quran and collections of authentic Ahadith explicitly state what Muslims should reject or incorporate. The remedy comprises in updating the conventional way of thinking and interpreting things, acquiring the ability to think the unthinkable and the previously unthought, honest hard word, incessant striving for excellence, as well as discarding getting overwhelmed by whatever gains ‘currency’ in the largely impulsive Western thought. Keywords: Deconstruction, Epitemology, Rethink, Critique, Qur’an Islam and Post Modernism Ever since the commencement of the 19th century, Revivalism, Reformism and Radicalism along with Nationalism and Islamic Socialism seem to be the most significant movements and inclinations of Islamic thinking in the contemporary Muslim world.
    [Show full text]
  • Tartu Paper Chang
    1 Is Language a Primary Modeling System?--On Jurj Lotman's Semiosphere Professor Han-liang Chang National Taiwan University Paper presented at the International Conference on Cultural Semiotics: Cultural Mechanisms, Boundaries, Identities, in observance of Jurj Lotman’s 80s Anniversary, University of Tartu Tartu, Estonia, 26 February - 2 March 2002 The well-known distinction of primary modeling system versus secondary modeling system suggested by Lotman and others (Lotman 1977) is a lasting legacy of the Ta rtu School's that has been adhered to, modified, and refuted by semioticians of culture and nature (Sebeok 1991, 1994, Sebeok and Danesi 2000).1 Adherence aside, modifications and refutations have focused on the issue whether or not language is a primary modeling system (hereinafter PMS) and, if not, what alternative can be made available to replace it. For both biosemiosis and anthroposemiosis, language can only be a secondary modeling system (hereinafter SMS) on top of the biological experience of Unwelt. As Sebeok and Danesi have recently observed: [L]anguage is, by definition, a secondary cohesive modeling system providing humans with the resources for extending primary forms ad infinitum. From a biosemiotic perspective, the language code can be defined as the cohesive system providing the modeling resources for converting what von Uexküll (1909) called 'concrete living existence' into 'active plans.' (2000: 108) Here our co-authors are reiterating Sebeok's entrenched position over the decades. He had observed in 1989, "Solely in the genus Homo have verbal signs emerged. To put it in another way, only hominids possess two mutually sustaining repertoires of signs, the zoosemiotic nonverbal, plus, superimposed, the anthroposemiotic verbal."(1991: 55).
    [Show full text]