r4UBMMJPOTQVMMPVUWJDUPSZPWFS -PSJTUPTUBZVOCFBUFOr4USPOH TFDPOEIBMGQSPQFMT8PMGQBDL QBTU1FOEFSr(BUPSTUIVNQ /PSUI#SVOTXJDLr7JLJOHT Sports UBNF8JMEDBUT4FFQBHF# ThePublished News since 1890 every Monday and Tursday forReporter the County of Columbus and her people. Monday, September 3, 2012 Wildlife ofcer briefs group Volume 122, Number 19 Whiteville, on beaver laws By JEFFERSON WEAVER 75 Cents Staff Writer

Local legislation and a fur- buyer’s license would likely Inside Today be required before Columbus 4-A County can get into the beaver bounty business. r5XPIVSUJO-BLF Officer Keith Rogers of the XSFDL4VOEBZ Wildlife Resources Commis- sion met with members of the Columbus County Beaver Committee last week to dis- cuss the commission’s role in encouraging trapping of the problem rodents. Beavers cause hundreds Staff photo by Mark Gilchrist of thousands of dollars in damage annually in Colum- In the long run bus County, damaging trees, Dr. Peter Kindschuh, left, and members of the Whiteville High School girls cross country team were among 410 flooding crops and damming people who completed the nearly 15-mile Take the Lake Walk/Run Saturday. waterways. While the U.S. De- partment of Agriculture traps problem beavers in the county under the Beaver Management Today’s Assistance Program, county Mailer raises questions about absentee ballots commissioners have refused By NICOLE CARTRETTE State Board of Elections. directly to our office,” Strickland said. American Profle to increase the amount of lo- Staff Writer “This mailing has been approved by The mailer makes no mention of the cal funding available for the features “Cider the state board. They have seen it and Oct. 30 deadline to request a ballot by mail program. Mill.” Pressing a A high-quality mailer is popping up say it is ok,” Strickland said. “But I can but does note that the deadline to return in mailboxes across the state urging vot- understand the concern.” “an absentee ballot” is Nov. 5 at 5 p.m. traditional Ameri- See Beavers, page 3-A ers to avoid long lines on election day The mailer directs voters to provide Strickland recommends that individu- can beverage. by using a postage paid card attached to their name, address, county, phone num- als who request an absentee ballot (avail- request an absentee ballot. ber and date of birth on an open postal able Sept. 7) return it “as soon as they Fisher, city That card, however, is addressed to a card that goes to the Americans for Pros- can” by the Nov. 5 deadline. DIDYOB? conservative advocacy group, Americans perity Raleigh office. Strickland said she wanted to assure to discuss for Prosperity; not the Board of Elections. Strickland said her office has not yet voters that her office is available to them. Did you observe ... Any registered voter can request an received any of the cards from Americans “We are here for them,” she said. absentee ballot by mail directly from the for Prosperity. Voters who may have already sent a A lonely banana single meters elections office, Carla Strickland, county “If we have voters who want to cast voter registration card to a third party elections director said. an absentee ballot by mail they can come other than the Board of Elections and feel drifing in the waters By JEFFERSON WEAVER Strickland said she had received calls into the office to make a request or send uncomfortable about it may send a new of Lake Waccamaw Staff Writer about the mailers and made a call to the a request with the same information See Mailer, page 2-A over the weekend The owner of a 48-year- only to be snatched old mobile home park asked Whiteville officials last week Lake’s whale skull may be studied by scientists worldwide up and eaten by to change the rules on water and sewer service. By RAY WYCHE America. hungry Take the The city council refused to Staff Writer The animal lived probably three Lake XTREME! reverse its policy on charging million years ago when the ocean participant Walter a minimum fee for rentals, but The skull of a prehistoric whale covered a portion of what is now the the city’s public works depart- found by Cathy Neilson in May 2008 eastern United States. This is one of Palmer during the ment will coordinate with in shallow waters along the north the youngest examples of the species paddling portion of Jesse Fisher to install single shore of Lake Waccamaw is expected of this whale. meters on each home and lot to generate considerable interest “This is the most complete whale the event?... Blake in the Eastwood Mobile Home throughout the scientific world. skull. It turned out to be the young- McPherson complet- Park. “It’s quite rare and it should at- est specimen; all others are at least 4 Attorney Harold “Butch” tract a lot of attention. It’s really million years old. This one is quite ing basic training at Pope represented Fisher before a unique specimen,” said Dr. Alton a bit younger than that. It is about 3 the N.C. Department the board. The city council Dooley, curator of paleontology for million years old,” Dr. Dooley said. last year approved a policy the Virginia Museum of Natural The skull had lain in the shallow of Corrections as an that bills property owners History in Martinsville, Va., who water off Lake Shore Drive near honor graduate with with multiple services on a assisted North Carolina officials in where Pecan Lane intersects Lake meter for the number of po- identifying the skull. Shore Drive since the ocean that Staff photo by Mark Gilchrist a grade of 96? He tential occupants, not actual The remains of the whale that covered a good portion of the Coastal Virginia Museum of Natural History Paleon- works at Tabor Cor- occupancy. The policy is a may attract so much interest from Plain at that time retreated eastward tologist Dr. Alton Dooley explains to a small standard procedure in many scientists worldwide is the only com- eons ago. audience at the Lake Waccamaw State Park rectional Institute. communities. The owner is plete whale skull of that unnamed Part of the skull was accreted in visitors center how rare the ancient whale … species of the Pleistocene Epoch skull before him is during a reception for the See Meters, page 2-A found on the east coast of North See Whale, page 2-A new exhibit at the park. County Deaths Marion tapped to lead BB&T region Whiteville By NICOLE CARTRETTE Marion be gan his covering business in Pleasant Garden for 50 years, Martha G. Smith Staff Writer banking career in 1981 as having a positive influence on his work ethic. Tabor City as a management trainee “You can see where I get my stability from,” Clinton Jones C. Phillip Marion Jr., Wilmington area executive with Southern National. Marion said, adding that reputation is key. Chadbourn for BB&T Bank, will step up as the southeastern He holds a bachelor’s “Reputation is very important and I believe that regional president for the bank in coming months. degree in business from reputation is all that we have,” Marion said. “I work Bailey Wayne Britt Marion, 54, a Greensboro native who has been hard every day to do what I say I’m going to do and Eddie Powell with BB&T 31 years, will fill a position held by Jeff (1980) and is a graduate give back 100 percent. Etheridge who is retiring. of the Graduate School BB&T has been a great place to learn and grow,” “I’ve spent 20 years in southeastern North Caro- of Banking of the South he said. ”In 31 years I’ve met a lot that have taught lina, in this nine county region,” Marion said. at Louisiana State Uni- me and I have always promised my teachers I would Index His assignments have included Clinton. Lumber- versity in 1995. do my best and not let them down.” &EJUPSJBMT" ton and Wilmington-based positions but Marion said Within five years, he Marion is optimistic about the strength of the Friday he is looking forward to making the region’s had transitioned to a Phillip Marion region. 0CJUVBSJFT" headquarters, Whiteville, home. position with BB&T in “We’ve got a great region and for the last 10 to 12 4QPSUT# “This is something I’ve wanted to do for a long Raleigh, later Winston-Salem and then Lumberton. years we have enjoyed some good times and some $SJNF" time,” Marion said. “Jeff has been a great mentor “Twelve years ago Jeff asked me to transition to challenging times,” Marion said. -JGFTUZMFT" and leader and he has helped prepare me for this the Wilmington market,” Marion said. opportunity.” He credits his family, owners of a floor and tile See Marion, page 2-A Customer Appreciation Week Large Only September 3-9 $ 99 WHITEVILLE 2 Topping Each 5Carry Out Only 640-2211 2-A – The News Reporter, Monday, September 3, 2012

This week, on... Whale Continued from page 1-A

limestone that covers much of Lake Waccamaw’s bottom. When the specimen was re- moved from the lake, represen- September 3, 2012 tatives from the N.C. Museum of Science and from the Lake Waccamaw State Park handled Whiteville.com the delicate task of chipping away the limestone that held Biser Ball the skull and with transport- Sports Trivia ing the skull, with attached Question #153: Former limestone, to the laboratories East Columbus High of the Museum of Science in School girls Raleigh. great T.T. Bennett is now There, the exacting work of playing for what college? separating the bone from the Answer: Find the answer today, at limestone was performed, a Whiteville.com, in our Sports Section. task that was ongoing for sev- eral months until completed Whiteville.com recently. “We are very actively study- The Number ing it,” Dr. Dooley said of the ancient skull. “We have to compare it with other speci- mens that have been found. People are working on papers about it, and we expect paleon- tologists will be coming back. 984 “Only a few museums have participants in the first whale skulls on exhibit. We Staff photo by Mark Gilchrist three Take the Lake Per- have found some 20 or 30 frag- The four women who discovered an ancient whale skeleton in Lake Waccamaw, from left, Priscilla Collette, Cathy sonal Endurance Chal- ments (of ancient whales) in Neilson, Alice Bryant and Deborah Kelso, cut a ceremonial ribbon marking the end of four years of, frst, convincing lenges, including X- Virginia and North Carolina, state scientists they had something worthwhile and then convincing them to let go of it and return it to Lake Wac- TREME! participants. but we didn’t expect to find camaw State Park. At right is park Superintendent Toby Hall. a whale down there (at Lake Whiteville.com Waccamaw). It’s the most Poll Question (remains) we have of that spe- down to see it,” Schneider paleontologist, she has as- The four women took ac- leigh, notified the proper au- of the Week cies,” he added. said. “It is very unusual and sembled a sizeable collection tive parts in discovering the thorities and the excavation At what age did you start Finding a complete skull it’s very complete.” of items she recovered from whale skull. Through the soon got under way. smoking? was a bonus, Dr. Dooley said, Schneider and Dr. Dooley the lake, and which attracted years, Neilson had noticed Officials at the excavation, particularly one of a species said the Lake Waccamaw the interest of Schneider and just beneath the surface of the when a preliminary look at Just about half of the re- never found previously. specimen is the youngest Dr. Dooley. lake in the area of the family the parts of the object not spondents in this week’s North Carolina Paleon- Pleistocene Epoch whale frag- She and three friends — pier an object that everyone accreted with limestone, jok- poll said that “I don’t smoke tologist Vince Schneider, who ment ever found. Priscilla Collette, Alice Bryant assumed was a cypress stump. ingly said if it were a new spe- - never have,” and here is supervised the removal of the The discovery of the whale and Deborah Kelso — formed “I thought it was an old cies of whale — which it may when the other half started. skull from the lake in 2008 and skull can be credited to Cathy the Friends of Lake Wac- stump or an old brown board,” well be — they would combine Half of the smokers began who was in charge of the res- Neilson, who was raised (and camaw State Park to provide Neilson says. in some way the initials of smoking in the pre-or-early- toration, said, “You’re going still lives) off Pecan Lane financial help to the park for Then, about two years ago the four women into a Latin- teen years (age 10-15), to get a lot of inquiries after about 100 feet from where the special projects such as fur- when the water level of the sounding scientific name for while 40 percent started in this thing is in publications.” whale had lain for millions nishing snacks and lunches lake dropped considerably be- the new species. their late teens. About 10 Paleontologists will of years. for Big Sweeps, the annual cause of the drought, she took Anyone wishing to contrib- percent started in their 20s be interested in seeing Neilson spent her leisure litter cleanup drive put on by a closer look and saw that the ute to the Friends of the State and then came the interest- the display of the skull, time in her youth and on the park. mysterious object was bone. Park can contact Neilson at ing news that none of our Schneider said. into her adulthood wading The group, which depends Collette with her SCUBA 910-646-3813. respondents who smoke The specimen is attrac- the shallows of the lake, her on contributions to accom- diving gear and Bryant with All donated funds will be said that they started smok- tively mounted in a Plexiglas eyes searching for anything plish their aims, recently her underwater camera vis- used by the Lake Waccamaw ing later in life than their 20s. case in the Lake Waccamaw unusual. furnished the park with office ited the scene and discovered State Park. This begs the discussion State Park’s Visitors Center. A self-taught (she works as supplies since the state has the object was indeed a bone, that if the legal smoking “I think people will come an x-ray technician) amateur frozen all funds for such items. a very large bone. age was raised to 30, would The four women, through Ray Wyche that effectively put an end to Kelso’s connections in Ra- 910-642-4104 ext. 229 smoking? This Week: Breakfast Meters Continued from page 1-A Mailer Continued from page 1-A billed the minimum amount the city manager, Fisher paid “city-approved” water meters for water, sewer and trash $1,046 on a $1,278 bill in March, that would allow tenants to service every month, whether with an additional $475.50 paid open their own accounts with request to the county board confuse voters in any way.” or not a property is occupied. June 26. At that point, charges the city, rather than paying the of elections if they choose, The group promised to send Your questions answered Minimum charges for unoc- for March and April totaled bill with their rent. Strickland said. corrected fliers to voters. at Whiteville.com cupied or occupied units on $1,148. Total past due amounts “We prefer you change the The first ballot request to For more information on multi-service single-meters is as of Aug. 30 were $1,488.90, policy and base the billing arrive is the one honored and how to request an absentee $34.90 per unit. which did not include June’s on occupied dwellings only,” multiple ballots will not be ballot directly from the board Whiteville.com The city sent Fisher a final billing of $984.25. Pope said. mailed to individual voters. of elections call the Columbus cutoff notice via first class Pope said the cost of pro- While the city council re- Billionaires Charles and County Board of Elections at Photos mail in early August. City viding city services is crip- fused to change the policy, David Koch found Americans 640-6609. of the Week Manager Larry Faison ini- pling Fisher’s business. Public Works Director Travis for Prosperity. The office is located at 50 tially put the disconnection While the park has room Faulk, at the instructions of The organization was ac- Legion Drive, Whiteville. on hold in May after Fisher for 18 mobile homes, eight are the board, will discuss install- cused of trying to suppress The general election is Nov. claimed the city had over- currently unoccupied. The ing individual meters for the Democratic voter turnout in 6 but early One-stop voting billed him for utility services. park, when fully occupied, park. Faulk said Fisher would the 2011 Wisconsin Senate begins Oct. 18. The delay stayed in place due brings in around $2,300 per need a licensed and certi- recall elections. to the retirement of Finance month, Pope said. Under the fied contractor to install the A form mailed to voters Nicole Cartrette Officer Kathy Cox and the current billing system, more meters to city specifications, there instructed recipients 910-642-4104 ext. 225 transition period as Bonnie than $1,000 of that goes to the “and that will cost a lot of to mail the form back to the [email protected] Bray took over Cox’s duties. city for water, sewer and trash money.” Instead, Faulk sug- group’s Wisconsin headquar- Faison pointed out that disposal. gested the city could install ters by Aug. 11, 2011 (two days Fisher, like other affected The attorney said that Fish- the meters for around $300 after the election). landlords, received official er suggested the city purchase each. The organization apolo- notice of the new policy in an install locks on homes gized for the mistake and said SHORT August 2011, before it went or lots with vacant units, or Jefferson Weaver it was a printing error. BROS. Walk / Run into effect in November. rescind the policy. Pope also 910-642-4104 ext. 227 “Due to a mistake during Take the Lake According to correspon- asked if the city would con- [email protected] printing, all applications were dence between Fisher and sider allowing Fisher to install sent out with the Aug. 11 date,” RENT-A-CAR AFP-Wisconsin state Director Matt Seaholm told media out- $ 95 Marion lets at the time. “Americans 19 DAILY Continued from page 1-A for Prosperity-Wisconsin did Hwy. 701, South of Whiteville not intend to print the incor- “I’m delighted to be here. time,” said Marion, who The couple has three adult rect absentee deadline or 642-4175 BB&T is a great bank to enjoys boating, hunting, daughters. work for and we hope to travel and spending time continue to build on what’s with family. Nicole Cartrette good,” Marion said. “I love being around my 910-642-4104 ext. 225 “Jeff has been a tremen- family,” Marion said. “I have [email protected] The dous leader inside and out- three daughters and wife Paddle Challenge side the bank and I want who inspire me every day.” Browns Take the Lake to continue to provide the While Marion will step FRANK THEATRES In Concert leadership he has in the into his new role by Dec. COASTAL community and bank.” 1, he said he and his wife, STADIUM 10 Marion has been a long a school counselor, plan Showtimes (910) 754-7469 time supporter of the United to move to Whiteville at www.FRANKTHEATRES.com Way and a former chairman the end of the school year. 5200 Bridgers Road for the Cape Fear Area. He is the finance chair- man of the Cape Fear Coun- cil of the Boy Scouts of Liberty Worship America, a member of the UNC Wilmington Board of Center Trustees and a former mem- 89 N. Grove St., Clarkton ber of the New Hanover Bike & Hike “No-Hike” Committee of 100. Take the Lake Come celebrate our 5th anniversary His wife Sarah has close ties to the community, he 2007-2012 with Us! FREE said. She is the daughter standard of the late Robert F. Floyd, EVERYONE IS INVITED! SHIPPING Sr., of Fairmont, and Ellen Services starts at 10 am with preaching by on all orders over $20 (Barnes) Floyd formerly Rev. Larry Priest. At 11 am, special singing at Latest Photos, of the Hinson’s Crossroads with The Browns, of Wallace, NC Whiteville.com. area of Fair Bluff. Find Your Fall Look The couple has frequent- Dinner on the grounds following Check back here, on page 2-A of Te ed Lake Waccamaw since New Styles, New Colors For more information, News Reporter each week for the latest 1978. “It’s been a home away on Whiteville.com. BoutiqueBeach Items Nowin the store50% now! off! call Pastor Richard Priest at 640-6147. from home for us for a long 1017 S. Madison St. 642-9881 The News Reporter, Monday, September 3, 2012 – 3-A Still no salary set for new DSS director By NICOLE CARTRETTE roll call vote taken, the so- Staff Writer cial services board approved $65,000. It is unclear if a special But it is merely a recom- called meeting and closed mendation as under state law session held at the Columbus the county commissioners County social services build- have the authority to set the ing Thursday will put an end salary. to weeks of disagreement Russ said the salary of over setting the director’s slightly less than $61,000 was salary. in line with the county’s pay Al McKenzie, a 21-year study but Campbell pointed employee of the Department out the study set a range up of Social Services who is a to more than $80,000 and Work First manager, is the oversees 141 employees. board’s pick for the position. “I don’t think they are go- But commissioners aren’t ing to do the $65,000,” Russ willing to approve the $75,000 said. “I think we ought to go Members of the Columbus County beaver committee were flled in on the legalities of trapping beavers under a pro- salary originally set for by the pay study.” posed bounty system. Wildlife Enforcement Offcer Keith Rogers told the group the county would need to consult an someone, with no prior di- Russ said he “admires” attorney before undertaking the program. rector’s experience, officials McKenzie for accepting the say. job. “I don’t know if he will After a one-hour closed with the salary he is going to Beavers session Thursday Social get,” Russ said. Continued from page 1-A Services board members “Al has the qualifications appeared to be ready to vote to do the job but he doesn’t on a motion by county com- have experience as a direc- Only one USDA trapper hunting them is just not ef- missioner Edwin Russ to pay tor,” Russ said. is assigned full-time to the ficient.” McKenzie $60,598 annually “I think the board of com- county. Due to the amount of In other business, the bea- – about $3,000 more than the missioners wanted someone funding from the state, that ver committee discussed ways $57,000, Russ said commis- with experience under their trapper is called out whenever to encourage trapping; wheth- sioners were willing to pay belt,” Russ said. a public roadway maintained er county-issued tags should last week. But commissioners don’t by the Department of Trans- have an expiration date; and “I thought we had set a have that power under the portation is threatened. how much to fine trappers and different one,” Social Ser- laws of the state. Beavers may be trapped landowners found violating The Social Services board during the regular season, the bounty rules. vices Board Member Marie has the sole authority to hire from Nov. 1 through March Rogers said there is poten- Campbell said. “I thought we 28, or any time a landowner tial for fraud in some quarters, just discussed $65,000. and fire the director. has documentable damage. as some landowners have bea- “I object. I think it should The landowner may also al- ver-plagued land in adjacent be $65,000,” she said turning Nicole Cartrette low others to trap or harvest Wildlife Offcer Keith Rogers talks with retired USDA trap- counties. The chance exists, he the recommendation into a 910-642-4104 ext. 225 beaver by any legal means, per and Wildlife Enforcement Offcer Milton McLean. said, of landowners offering substitute motion. [email protected] including firearms and bows. trappers the chance to sign On a voice vote with no Rogers said that Columbus for taking beaver any time the wild furbearer,” Rogers said, up for the bounty program in County’s local ordinance pro- trapper has permission. “North Carolina requires Columbus but actually trap hibiting the setting of traps “The way we enforce it, a someone be licensed to do so. and sell beavers from other before Jan. 2 is enforced at the foothold trap is a violation of Buying beaver tails on the counties. discretion of the investigating the law,” Rogers said. bounty is still purchasing a “There are a lot of details A larger issue, Rogers furbearer.” NOW OPEN officer. The law was specifi- you have got to get worked cally passed to prevent capture said, is one of trespassing. The $100 licenses are good out,” the Wildlife officer said. of hunting dogs by trappers Trappers for all species must for one year, and do not re- The committee meets again Cookies · Cakes · Pies · Cupcakes pursuing land species, Rogers have written permission to quire specialized training. this month. said, but in some years it has set traps or enter another’s The state does require good Jones, a board member of Brownies · Cake Pops been strictly enforced to cover property, unlike hunters, who record keeping for furbuyers. the N.C. Trappers Association, water trapping as well. only need verbal permission. Columbus County could said after the meeting that the * Made to Order * Traps set for beavers out- An individual trapping for also face problems purchas- NCTA, in cooperation with the side of the regular season a landowner on one side of ing beaver tails outside of the Wildlife Commission, is plan- must be completely sub- a waterway could be cited if regular season. ning a beaver trapping semi- & Home merged, Rogers explained, but he inadvertently set traps on Rogers pointed out that the nar in October. Details will be Baked fluctuating water levels make the property of another land- state prohibits the sale of any announced at a later date. that difficult to maintain. owner, especially if the second part of an animal taken on a property owner does not want damage permit. Whether this Goods “The officers know the Jefferson Weaver difference between a trap set the beavers killed. would cover beaver tails sold 5066 James B. White Hwy. S. Trespassing could also be- for the bounty “needs to be de- 910-642-4104 ext. 227 for beavers and a trap set for [email protected] across from Time Saver in New Hopes(910) 234-4872 a bobcat, raccoon or coyote,” come an issue if the county termined by a lawyer,” Rogers Rogers said. “If the trap is in decided to order “spot checks” said. The law was originally the water, and obviously set of trappers and land where passed to prevent animal dam- beaver problems have been age control agents from selling for beaver, I am confident an BELK.COM officer will not cite the trap- reported. live foxes and coyotes to hunt- per. If the trap is obviously set “You can’t just go on an- ing preserves in the off-season. on dry land, there could be a other man’s land,” Rogers Rogers said trapping is a problem.” said, “and you can’t just go in dying sport, in part due to the Dan Jones, a trapper from and set traps, either.” amount of work involved and Fair Bluff, asked if the coun- If the county passes the the slow furmarkets of recent ty’s ordinance covers the use proposed $30 bounty, Rogers years. of snares. Rogers said snares said, “someone is very likely “It’s tough,” Rogers said, and body-grip traps, generi- going to have to have a fur- “and it requires a lot of time cally referred to by the brand- buyer’s license. and effort. A lot of people don’t name of Conibears, are legal “To purchase any part of a want to do that anymore, but New food safety rules now in efect DAY senior If you’re 55 & older, it’s your day to save The most wide-reaching avoid handling ready-to-eat posted. changes in more than 30 foods with their bare hands, Another change under the TUES., Sept. 4 years in food safety regula- and all restaurants must new rules requires that local with your Belk Rewards Card tions for public eating places have a certified food protec- food trucks and food-serving life on went into effect Saturday. tion manager on hand during pushcarts post a sanitation Columbus County Health the hours of operation. rating card. easy street Department Director Kim Restaurant grading sys- “Our inspectors have EXTRA Smith said, “The new food tems are also changed un- spent the last year learning TUESDAY, Sept. 4 % code establishes practical, der the new regulations. the new rules and how to ad- OFF science-based rules to help Public eating places will no minister them,” Smith said. sale purchases avoid food-borne illnesses, longer earn bonuses for vol- “We have also worked 20 15% OFF home and shoes like noroviruses and salmo- untary food safety training, with our local food provider If you’re *See below for details. In store only nella.” although sanitation grade community to help them senior 55 & older, Under the new rules, food- cards showing the business’ make the transition to the it’s your day with any * to save % sale purchases handling employees must scores will continue to be new system,” she added. other form 10% off Home & Shoes DAY of payment15off

Lancôme Gift a $143 value, yours with any $35 Lancôme purchase Choose 6 beauty favorites & your bag. Offer good while supplies last. One gift per client, please. Offer varies online. Offer valid thru September 23, 2012 % % 30-50off 25-40off Misses & petites career sportswear Casuals* shoes from Easy Spirit®, t from ND New Directions®, Choices, Bandolino, b.ø.c, Rampage, Madden do Kim Rogers®, Ruby Rd. and Girl, Naturalizer, Rock & Candy by red nce Alfred Dunner. Orig. 22.00-82.00 Zigi, BareTraps,® White Mountain, ra clea % Sale 15.40-57.40 Similar styles in LifeStride & more. Orig. 39.00-90.00 % off more tra 30 today’s woman at slightly higher prices. save & an ex Sale 27.30-67.50 take you 5when the current*see ticketed below. price* *Excludes Everyday Value 6 Connect with us for special offers and promotions at Belk.com/getconnected

*If you’re 55 or older, take an extra 20% off storewide, or 15% off in our home & shoes departments with your Belk Rewards Card; 15% off storewide, 10% off in our home & shoes departments with any other form of payment, on your sale purchases *Only excludes Red Dot, clearance, Earlybirds, Night Owls, Doorbusters, Bonus Buys, Everyday Values, Alegria, b.tempt’d, Ladies’ Better Swimwear, Brighton, Buffalo, Cosmetics/Fragrances, Casio, Coach, Dansko, designer sunglasses, Eileen Fisher, Free People, Lacoste, Lucky, Ladies Designer & Contemporary Sportswear & Dresses, Stuart Weitzman, Citizens of Humanity, Cole Haan, Columbia, Donald J Pliner, Dooney & Bourke, Furla, Kate Spade, Keen, Vineyard Vines, Joseph Abboud, Hanky Panky, Herend, Hugo Boss, Hickey Freeman, Hart Schaffner Marx, Austin Reed, Levi’s, Dockers, Lilly Pulitzer, Mattel, Merrell, Minnetonka Moccasin, Miss Me, Munro, Nautica, Original Penguin, Ben Sherman, Ralph Lauren/Polo, Roberto Coin, Seven For All Mankind, Spanx, Thomas Dean, Tommy Bahama, Tumi, Ugg, Under Armour, Gear for Sports, Wacoal; Ladies’, Kids’ and Men’s Designer Shoes, Designer Handbags; Kitchen/novelty electrics/coffee, Le Creuset, Wusthoff, All-Clad, Fine Jewelry watches, trunk shows and service plans; non-merchandise depts., lease depts. and Belk gift cards. Not valid on prior purchases, phone, special orders or on belk.com. Cannot be redeemed for cash, credit or refund, used in combination with any other discount or coupon offer. Valid September 4, 2012 RED DOT: *Limited exclusions in Brighton, St. John, Eileen Fisher, Lilly Pulitzer, Resort, Bridge Collection, Levi’s, Coach, designer handbags and junior denim. Juniors total savings are 55-75% off. Fashion Accessories, Handbags, Small Leather Goods, Hosiery, Home Store and Men’s Tailored Clothing total savings are 45-65%. COUPONS NOT VALID ON RED DOT 4A - The News Reporter, Monday, September 3, 2012 Crime briefs Molested Rape A girl under the age of 16 *OSHUA$AVID:EMATIS  was molested by an adult male OF 0OLEY"RIDGE#HURCH2OAD at a home west of Whiteville .AKINA WASARRESTEDLASTWEEK DURINGAVISITTOTHERESIDENCE on charges of statutory rape according to a recent sheriff ’s involving sex with a girl under report. THEAGEOF DURINGTHE*ULY !UGPERIOD ACCORDINGTOTHE warrant obtained by Sheriff ’s Break-in Detective Scott Norris. Someone forced entry to the &IRST3T0AUL-ISSIONARY"AP- tist Church along Campground Shoplifer 2OADNORTHOF 7HITEVILLE BUT $EREK!RMAND7ILLIAMS  THEREWASNOTHEFTREPORTED AC- OF #HADBOURN WASARRESTED CORDINGTOAN!UGSHERIFF S HERE!UGFORSTEALINGTWO report. BOTTLEOPENERSAND,OGITECH EARPHONESAT7ALMART ACCORD- ing to police records. The items were valued at a total of $40.82. Indecent *AMES$EVON*ENKINS*R  OF )CE0LANT2OAD &AIR "LUFF WASARRESTEDLASTWEEK Church on charges of taking indecent Two Whiteville women were liberties with a girl under the victims of vehicle break-ins Staff photo by Les High AGEOF  ANDALSOCOMMITTING while they were at the House of Sunday wreck a first-degree sex offense with Prayer and Deliverance along THEVICTIMON!UG ACCORDING South Madison Street here on Hallsboro frefghters remove the roof from a truck that and an AirLink helicopter transported the other victim to to a warrant obtained by Sher- !UG ACCORDINGTOPOLICE overturned on U.S. 74-76 Sunday between the two Lake New Hanover Regional Medical Center. A second car was iff ’s Detective Scott Norris. reports. Waccamaw exits. Two people were injured. Lake Wac- involved, but the driver was not hurt. No other information ,EIGH !NDREA +EMP RE- camaw Rescue took one victim to Columbus Regional was available Monday. ported her auto radio was Fugitive DAMAGED ANDASTRAWBERRY Extinguishers Timothy LOLLYPOP VALUEDATCENTS used in church; M o n d e l l was stolen. ,ONG  OF &LORINA'EORGE"ALDWINRE- expensive ride ported the theft of a Nintendo /LD $OTHAN An unknown person en- 2OAD 4ABOR HAND HELDGAMESYSTEM ANDAN Apple IPod. TEREDTHE'RACE%PISCOPAL #ITY WASAR- Church through unlocked rested here DOORS AND SPRAYED TWO FIRE ON!UGON extinguishers onto the carpet a charge of Long Arrested INTHECHURCH ACCORDINGTOA being a fugi- J u s t i n local police report. The dam- TIVEFROM(ORRY#OUNTY 3# 'RAY 2EYN- AGEWASDISCOVEREDATAM authorities where he’s wanted OLDS  OF 3UNDAY 3EPT ONRECENTDRUGCHARGES ACCORD- , E E 7A R D A second local police report ing to sheriff ’s records here. 2OAD .AKI- SHOWEDA2ALEIGHTAXIDRIVER NA WAS AR- FAILEDTOCOLLECTHISFARE rested Aug. for bringing a white female to Firearm   O N T WO 7HITEVILLE&RIDAY T o n y counts each The driver said he delivered , E E 3 H AW of breaking Reynolds THEWOMANTO7ALMART ANDSHE  OF "ALD- and enter- went inside to use the automat- W I N 2O A D ING ANDLARCENYINVOLVING The victim of the Lake Waccamaw wreck Sunday is wheeled to an AirLink helicopter for ic teller machine to get cash 7HITEVILLE TWORECENTTHEFTS BASEDON transport to New Hanover Regional Medical Center in Wilmington. TOPAYFORTHETRIP ANDNEVER was arrest- warrants obtained by Sheriff’s RETURNED THEREPORTNOTED ed recently $ETECTIVE2ENE4REVINO on a felony Shaw 2EYNOLDSISCHARGEDWITH charge of BREAKINGINTO*OHN/TTOWAY Drivers plead to DWI, Driver passes out, wrecks possession of a firearm by a 3TOCKSBARNALONG/SCAR%ZZELL $AKOTA%UGENE2OBERTSON  OF 4ABOR#ITY TOLDLOCALPOLICE felon. He had a Winchester 2OADDURINGTHE!UG PE- 3UNDAYTHATHEhPASSEDOUTvFROMTHEAFTERNOONHEATHERE AND shotgun when he assaulted a one gets prison term RIOD ANDSTEALINGTOOLSVALUED WRECKEDHIS#HEVROLETPICKUPTRUCKINADITCHALONG53 man by pointing the weapon Three drivers plead- at $820. charge on Aug. 24. He NEAR3LIPPERY,OG2OAD at the victim. ed guilty or didn’t The second case is where had a blood-alcohol 2OBERTSONWASINJUREDINTHEPMCRASH THEREPORT Shaw was charged with as- contest driving while level of 0.14 when ar- *UAN&IPPSFARMEQUIPMENT showed. SAULTING*AMES,EWIS(ATCHER impaired charges in rested last year by a and other items were stolen &IVEPEOPLEREPORTEDMINORINJURIESAFTERATWO VEHICLECRASH on Aug. 10 by using the shotgun DWI Court here Aug. Highway Patrol troop- DURINGTHE!UG PERIOD at 10:40 p.m. Saturday in the parking area of the Time Saver to threaten him. Shaw was 24 with Nancy Phillips ER,OWERYWASTOLDTO Tractor batteries were includ- ATTHEINTERSECTIONOF 53"YPASSAND7ASHINGTON3TREET CONVICTEDIN"LADEN#OUNTYON presiding. Three oth- SPENDHOURSOF JAIL ED ANDTHEVALUEOF THEITEMS another local police report showed. 3EPT OF FELONYASSAULT ers pleaded guilty on in lieu of community WAS  ACCORDINGTOTHE $RIVERSWERE#HARLES(ARRINGTON"ROWN  AND-ONICA WITHADEADLYWEAPON INmICT- Aug. 21 before Judge service. warrant. Pittman 3UAREZ"ENNETT  BOTHWITH7HITEVILLEADDRESSES INGSERIOUSINJURIES RECORDS Sherry Tyler. The cas- He will be on unsu- 4HREEPASSENGERSIN"ENNETTSVEHICLEWEREALSOHURT4HEY show. es were: PERVISEDPROBATIONFORAYEAR WERE+ASHANNA7ILSON  7INFORD-ULLINS  AND#HANCY s#HRISTOPHER7,EWIS  ANDWASlNED! DAYJAIL ,EACH !DDRESSESFORTHETHREEWERENOTSHOWNONTHEWRECK Horse OF #LARKTON PLEADEDNOCONTEST term was suspended. report. 4AMMY ,YNNE (UNTER OF on Aug. 24. He had a blood-alco- s,EONARD!USTIN/DHAM Friends 4ABOR#ITYREPORTED!UGTHE hol level of 0.14 when arrested  OF #LARKTON PLEADEDGUILTY Two white male custom- theft of her pregnant Palomino in March by a Highway Patrol on Aug. 24. He will be on unsu- Twins arrested in conspiracy ERSOF 2OCKEFELLERSBARHERE MAREFROM+ENNY#OLEMANS trooper. PERVISEDPROBATIONFORAYEAR ALONG53"YPASSGOTINTO PASTUREINTHEBLOCKOF ,EWISWILLBEONUNSUPER- and was fined $100. He had a Matthew James Pittman warrants were obtained by a fight with each other inside 3IDNEY #HERRY'ROVE2OAD VISEDPROBATIONFORAYEAR AND blood-alcohol level of 0.11 when a n d M a rk #HADBOURN0OLICE$ETECTIVE,T the business at 1:20 a.m. today Clarendon. was fined $100. He was also arrested in June 2011 by a High- J e r o m e $ONALD"RITT -ONDAY ANDBOTHWENTOUT- A sheriff ’s report showed ordered to perform 24 hours way Patrol trooper. 0 I T T M A N side where the fight continued. the mare was discovered miss- of community service within /DHAMWASTOLDTODO 20-year-old The police report showed ING*ULY4HEHORSEHASA DAYS ANDA DAYJAILTERM hours of community service twins from the two men eventually got into STARONITSHEAD ASCARONTHE was suspended. WITHINDAYS ANDA DAYJAIL 7HITEVILLE the same vehicle and left the REAROF HERLEFTANKLE ANDA s*AMES&RANKLIN,OWERY  term was suspended. have been Matthew Pittman scene to an unknown location. white spot on her back. OF 7HITEVILLE DIDNTCONTESTTHE s0RE2EH  OF ,UMBERTON arrested on PLEADEDGUILTYON!UG AND an addition- was put on probation for a year. al charge of He was ordered to do 48 hours conspiracy Break-ins, thefs of community service within t o c o m m i t DAYS ANDHISPROBATIONWAS b r e a k i n g The following were victims s3EPTn2EED2OBERTS-AY s!UGn7ILBUR2OSS TRANSFERREDTO2OBESON#OUNTY and entering of a break-in and/or theft re- 3EMINOLE &LAnBREAK INAT "ARNHILL (ARDY2OAD 7HITE- 2EHSBLOOD ALCOHOLLEVEL and larceny Mark Pittman ported on date shown: HOMEALONG(APPY(OME2OAD VILLEnBREAK IN THEFTOF TWO was 0.15 when arrested in June involving the break-in of Pea- s3EPTn*AMES.ORRIS .AKINA THEFTOF WATERPUMP DIRTBIKES INCLUDING3UZUKI by a Whiteville policeman. He cock’s Stop convenience store G. Cameron %VANS /LD,UMBERTON2OAD s3EPTn4ONY*OHNSON BIKEWITHhSTICKERSALLOVERIT v was fined $250. on Aug. 18. 7HITEVILLEnTHEFTOF PITBULL #OX3UBDIVISION2OAD 4ABOR and red-and-white Honda bike. s*UAN6ELAQUEZ  OF %VER- Seventeen packs of ciga- Byrd dog a few hours it was “res- #ITYnBREAK INOF VEHICLE THEFT s*EREMY!LLEN7ILSON GREEN PLEADEDGUILTYON!UG RETTESWERESTOLEN ANDRECOV- ATTORNEY AT LAW CUEDvIN"LADEN#OUNTY of Teresa Johnson’s purse con- 7ILMINGTONnBREAK INOF AUTO 21. He was put on probation for ered. They are charged with s3EPTn+EYOMARTEE/C- TAININGWALLET CASH AT'RICE!UTOMOTIVE 53  AYEAR lNED ANDTOLDTODO conspiring with each other and • Criminal • Divorce • Wills TAVEES(ERRIOT &LOYD3TREET s!UGn4IME3AVERAT $ELCO THEFTNOTREPORTED 24 hours of community service. Seewillow Jackson of Pocosin • Custody • Child Support s!UGn7ENDY,EE+INGn 7HITEVILLEnBREAK IN THEFTOF .EW(OPEALONG533OUTH He refused a breath test 2OAD ,AKE7ACCAMAW TOCOM- • Traffc • Personal Injury 3HARPCASHREGISTER BLUEGRASS 7HITEVILLEnTHEFTDISCOVERED THEFTOF NOTARYSEALFROM""4 when arrested in June. A 60-day mit the crimes. The additional TRIMMER BLACKh3PIDERMANv !UGOF FEETOF COPPER bank here. JAILTERMWASSUSPENDED 1409 Pinckney St. • Whiteville FOUR WHEELER STERLINGSILVER tubing to compressor for beer s!UGn'RAYANNA2AY s "OBBY 0ITTMAN  OF 840-6280 Cell 642-2258 Offce h-OM vh3OCCER vANDPENGUIN cooler. 9OUNG 3OUTH 4HOMPSON #HADBOURN WASSENTTOPRISON We’re On The Web: s!UGn#OLUMBUS#OUNTY 3TREET 7HITEVILLE n BREAK IN FORDAYS AFTERHEPLEADED Evening & Weekend NECKLACES ASSORTEDCOSTUME Appointments Available JEWELRY 0ARKS2ECREATION 7HITEVILLE OF VEHICLE THEFTOF $ELLLAPTOP guilty on Aug. 21. He has no www.whiteville.com s3EPTn2ON7ALTERS nTHEFTFROMWORKTRUCKALONG COMPUTER PORTABLEHARDDRIVE credit toward the term. computer bag. Pittman had a blood-alcohol %DGEWOOD#IRCLE 7HITEVILLEn /LD3TAGE2OAD.# OF -IL- for information leading to the arrest & BREAK IN THEFTOF CUSTOM MADE WAUKEEGRINDER 3KILSAW 3KIL s!UGn$ONALD2AY7ARD level of 0.08 when arrested in conviction of the person/persons that -AGNUS/RVISOVER AND UNDER GRINDER "LACK$ECKERCORD- 7EST(AY3TREET 7HITEVILLE &EBRUARY(EWASALSOCONVICT- Re w a r d SHOTGUN JEWELRYWITHLISTNOT LESSDRILL TWO#HANNEL,OCK nTHEFTOF COPPERFROMAIRCON- ed of issuing worthless checks broke in and stole property at 3 differ- yet provided. PLIERS SWEATPANTS RAINCOAT ditioner. ONACLOSEDACCOUNT ANDHIS ent times, on 2180 Rough & Ready Rd. s3EPTn*ERRY(YMAN can and five gallons diesel fuel. sentence was included in the 910-625-9412 ,ITTLE 7HITEVILLEnTHEFTOF TWO s !UG  n *3 2ECYCLING Pump taken, 110 days. $500 Harley-Davidson motorcycle 3OLES#EMETERY,ANE 4ABOR helmets while parked at Taco #ITY n BREAK IN THEFT OF FOUR "ELLHERE DIGITALMEMORYCARDS -ILWAU- is recovered s3EPTn-ONICA0AIR .O- KEEGRINDER AIRCOMPRESSOR Someone stole the water You may qualify for LAN!VENUE 7HITEVILLEnBREAK financial records. PUMPATTHE#APE&EAR"APTIST aCing IN THEFTOF 0ANASONIC46 s!UGn"ETTI+RISTINA #HURCHALONG.EILS%DDY F Chapter 13 Bankruptcy -ICROSOFT8BOXSYSTEM SEVEN 4YSON 7HITEVILLEnBREAK IN 2OAD 2IEGELWOOD ANDLEFTTHE foreclosure? games. of home along Thompson pump across the road from the to stop foreclosure. s3EPTn$ORIS'ERRINGER 4OWN2OAD 7HITEVILLE THEFT CHURCH ACCORDINGTOAN!UG Law oFFiCeS oF sheriff ’s report. .ORRIS 0EACOCK2OAD #HAD- OF 0ANASONIC46 We help people file for bankruptcy relief BOURNnTHEFTOF WHITE s!UGn$OROTHY3MITH No other items appeared Bruce F. JoBe, P.A. (ONDA#IVICWITHREVOLVER "ENTON (ALLSBORO2OAD3OUTH to be missing because of the we are a debt reLieF agenCy under the United States Bankruptcy Code. various keys and driver’s li- 7HITEVILLEnBREAK IN THEFTOF break-in of the church and cense in locked car. Campbell-Hausfield generator. pump house. 4312 Ludgate St. • Lumberton, nC • 910-739-1010 • toLL-Free 800.808.9695 Lifestyles Te News Reporter, Monday, September 3, 2012 -- 5A 90-year-old woman volunteers daily to help senior citizens

By CLARA CARTRETTE She said 2,000 people worked News Editor in the shop where fine suits were made. Most people her age would “I worked hard — over time, wait for someone to serve weekends,” she said. “Every- them, but on her 90th birthday thing was done by hand then on Aug. 24, Virginia Bellucci and we made about 1,000 suits of Whiteville was serving se- a day. Machines made it a lot nior citizens at the Columbus better.” County Department of Ag- When she was applying ing’s nutrition site. for her citizenship, the judge Virginia is a faithful daily questioned her about how two-hour volunteer at the de- she got here and asked if she partment, helping serving tea, wanted to go back to Italy. milk or water to those who “I will go back to visit,” come to the nutrition site for she replied. “I’ve got a good lunch. When she sees other husband and this is my place things to do, such as some- now.” He then asked about thing spilled on the floor or a her work and she told him messy table, she doesn’t call she worked for a company someone to clean it up; she that made the best suits in the does it herself. world. “Whatever I see wrong, I fix When she married, Nicollo it,” she said. and his daughters were not Her fellow senior citizens talking to each other, she said. were unaware until that day “She brought peace to that it was Virginia’s birth- the family,” said Rita Proia. day, and they couldn’t believe “Since then, every Sunday she was 90. they used to visit her and “Everyone I serve is young- their father.” er than me,” Virginia said Virginia spends a month in with a smile. Rochester every summer vis- The Rev. Helen Johnson, an iting her stepdaughter Grace, ordained minister who offers grandchildren and a cousin, the blessing before the meal, Loretta, daughter of the uncle calls bingo numbers and leads who introduced Virginia and chair aerobics, thought it was Nicollo, and other relatives a joke when she overheard and friends. She recently re- someone talking about Vir- turned from that annual visit. ginia’s 90th birthday. There was a big early birth- “Really, I thought that was day celebration there, with a joke,” Helen said. “You’re nice gifts from her relatives, not really 90, are you, Miss including two outfits and $90, Virginia?” Her mouth was a dollar for every year of her hanging open when Zizi fi- life. nally convinced her she was, “They still cry because I Virginia Bellucci, center, with Angelo and Rita Proia. indeed, 90. “She’s the best!” Helen added. out,” she said of her daughter. she looks without the assis- She reads a lot and appreci- “I just can’t believe it!” add- After finishing her volun- tance of makeup, Virginia ates good eyesight. ed Creola King. teer duties at the Department smiled and said she just uses “I thank God I still have my In addition to not looking of Aging this past Friday, the soap and water. vision,” she said. and acting like a 90-year-old, Proias took her to Ocean Isle Virginia mystifies her doctors Beach for a Labor Day week- with her good health. end celebration, with all of “The doctor says, ‘I can’t the Proia children attending. find nothing wrong with “All four of our children you,’” she said with a laugh. love her like a grandma,” Rita Virginia is a native Italian said. who obtained U.S. citizenship Their daughter Ellen said through hard work and a lot she calls her Zizi, an Italian of studying after she married word for aunt. and came to the States in 1951. Living together is suitable Her husband Nicollo was also for the Proias and Virginia. Italian but was born in the “I am happy with my sister USA. They met when he went and we get along,” Virginia to Italy to visit his sister and said. “When I got back from her uncle introduced them. New York everybody said ‘I Nicollo was a widower with am glad you’re back.’” two sons and two daughters “We’re really happy to have and they lived in Rochester, her with us,” Rita said. N.Y. “We do the best we can to “It took six months to come make her happy and comfort- into this country,” Virginia able,” Angelo added. said. The Proias said Virginia She has been living with had volunteered in a rest her sister and brother-in- home in Rochester and want- law, Rita and Angelo Proia ed to volunteer after mov- in Whiteville since 2007. The ing here. She helped the rest Proias came to Whiteville in home residents by rolling 1980 and opened Mamma Ri- them around in wheelchairs ta’s restaurant in 1982. They Virginia Bellucci is ready to serve tea. and lending other assistance. have since retired and sold the “I like to help and someday business. maybe somebody will do for “I went to work in a tai- left Rochester,” she said. ginia said she was an engi- me,” she said. lor shop as a seamstress and Each year she visits the neer for Kodak and designed a “This fits her; this is per- worked there for 37 years, do- graves of her husband who special camera that was used fect for her,” Rita said of her ing the same job, sitting in the died in 1970, and their daugh- in Hollywood. involvement at the Depart- same chair,” Virginia said of ter, Mary Jo, Virginia’s only “They were so pleased they ment of Aging. Helen Johnson thought it was a joke when she heard that coming to the United States. child who died at age 37. Vir- gave her $1,000 and took her Reminded of how young Virginia Bellucci was having her 90th birthday.

Creola King couldn’t believe Virginia Bellucci turned 90 years old on Aug. 24. Virginia Bellucci serves the early arrivals tea. 6A -- The News Reporter, Monday, September 3, 2012 Families First fashion show, bridge tournament Oct. 4 Families First Inc. Domes- beautiful and handsome mod- tic Violence/Sexual Assault els will be wearing clothing Shelter and Services will from all four seasons. The hold its annual bridge tour- gently used clothing can be nament/fashion show event purchased at our thrift stores on Thursday, Oct. 4. It will be for a fraction of the original held at Vineland Depot with cost.” the doors opening at 11:30 a.m. Pait said a silent auction for review of silent auction will offer fantastic selections items. and door prizes will also be Lunch will be served dur- awarded. The luncheon will ing the fashion show at noon, be catered by Whiteville Wom- and a bridge tournament will en’s Civic League. Married 50 years begin at 1:30 p.m. Cash Prizes Tickets for the luncheon Jimmy Lanehart and Bertie Benton were united in mar- will be awarded to the top and fashion show are $15 per riage on Aug. 10, 1962. On Aug. 11, they were hon- three players, which will con- person. Tickets are $25 per ored by their children with a 50th anniversary party in sist of three progressions of person to include the bridge the fellowship hall of Western Prong Baptist Church seven hands. tournament. Both prices in- where they are active members. The happy couple was “We are looking forward clude the fashion show, lunch, surrounded by friends and family and enjoyed sharing to a fun time to be had by a chance to bid on silent auc- tion prizes and door prizes. memories of their years together. They are blessed to all,” said Families First Ex- ecutive Director Vickie Pait. Persons interested only in have three children and nine grandchildren. They en- “The fashion show will fea- playing bridge will pay $15. joy watching all of those grandchildren in their , ture clothing donated to our Seating is limited so early basketball, and football games, dance recitals, band two thrift stores, Families ticket purchase is recom- and chorus concerts, Scouts ceremonies, and church Values, located in downtown mended. activities. In the little free time they have, they love to Whiteville and Families Val- Anyone who would like to escape in their RV to the beach or mountains. ues, Too! in Tabor City. Our participate by sponsoring a ta- ble, giving a door prize, being Nancy and Jimmy Oakley a model or for ticket informa- tion, call 642-5996, Monday – Friday, 8:30–5. Bladen County residents can call the Bladen Okaleys celebrate 50th County Families First office at 862-2534. anniversary at reception An anniversary celebra- from their wedding day and Wright reunion tion for Nancy and James also from shortly before their “Jimmy” Oakley Sr. was held 50th wedding anniversary day planned Sept. 23 on Saturday, Aug. 4, from 2 to were on display, along with a 4 p.m. at Whiteville United floral arrangement of mixed The Wright reunion, which Methodist Church. Married flowers, gold balloons, and has been held every year but on Aug. 12, 1962, the couple glass holders with candles one, since 1882, is scheduled marked their 50th anniversa- and gold sand. Of special for Sunday, Sept. 23. It will ry with a reception for family interest was the display of be held at the Faith Activity and friends. the couple’s wedding attire, Center of Forest Lawn Baptist The Oakleys’ children, the bride’s pinafore-collared Church between Tabor City Kim Oakley Duncan and and buttoned dress and the and Vinegar Hill on U.S. 701 James Oakley Jr., along with groom’s pale blue pin-striped across from Forest Lawn Cem- their spouses, Chris Duncan suit, in wonderful condition etery. and Clarissa Oakley, hosted 50 years later. The reunion will begin at the event in the church’s par- Nancy and Jimmy have re- noon and the covered dish lor. They were assisted by sided in Whiteville for all 50 lunch will be served at 12:38 their children: Kaitlin Dun- years of their marriage. They Summer readers p.m. Everyone is urged to can, Jenna Duncan, Grayson are members of Whiteville Rube McCray Memorial Library at Lake Waccamaw fnished its summer reading pro- bring a covered dish, beverag- Oakley and Ryan Oakley. United Methodist Church es, family memorabilia such Several tables were set up and are involved with various gram, “Dream Big…Read!” The four-week program provided story time and crafts as pictures and family Bibles. for children, with a party on the last day. The program was designed to help children for the guests to sit and en- agencies in the community An exhibit of family informa- joy refreshments and one an- where they volunteer their improve reading and social skills, according to Librarian Kim Holmes who expressed tion will be in place and fami- other’s company. Tables were time. thanks to the children, parents, grandparents, volunteers and Friends of the Library ly members are urged to bring covered with white table- The couple enjoyed cel- for making it a success. “We had a fantastic turnout with incredible response from the their own exhibits. cloths and adorned with gold ebrating their marriage mile- community,” Holmes said. The library is open Monday-Thursday from 11 a.m. until 6 Plates, utensils, cups and and white confetti and gold stone with family and friends. p.m., and 11 to 5 on Friday. For more information call 646-4616. ice will be provided. glass stones. Refreshments “We love our family and September has five Sun- were prepared by Clarissa our church family. We think days; however, the Wright and James Oakley Jr. and in- our greatest gifts are our chil- NCSCV meeting reunion has been held on the cluded meatballs, a fruit bas- dren and grandchildren and DocuTime Film fourth Sunday in September ket, a cheeseball, cake and we appreciate the wonderful planned Sept. 9 since 1974. punch. celebration they honored us For further information Pictures of the couple with,” the couple said. Festival features Richard Triebe of Wilm- call Richard Wright at 653- ington will present the Sun- day, Sept. 9 program for N.C. Ken Burns flm Sons of Confederate Veter- Farmers Union The third annual [Mini] shoe. This film features Her- ans Camp 794, “The Colum- DocuTime Film Festival in zog keeping his promise, cook- bus County Volunteers.” The September Fest Wilmington will bring two ac- ing his shoes at the Berkeley, meeting will be held at the claimed documentary shorts Calif. restaurant Chez Panisse N.C. Museum of Forestry at slated Sept. 15 and one feature by pioneer with the help of chef Alice 2:30 p.m. The public is invit- The Farmers Union Civic 20th century filmmakers Ba- Waters, and then eating them ed and there is no admission Association is sponsoring sil Wright, Harry Watt, Mel (and waxing philosophic) on charge. September Fest on Sept. 15 Blank, and Ken Burns to the stage. See the film for Herzog’s Triebe is freelance writer from 10 a.m. until 5 p.m. at big screen in Wilmington. trademark drily humorous re- and historian published in Spaulding Park. Night Mail and Werner marks, but don’t hold out for multiple periodicals. He is the Vendors are welcome to sell Herzog Eats his Shoe are the him to eat the sole of the shoe author of several historical their goods — arts, crafts, food documentary shorts, and — as he says in the film, “One novels and has done exten- and such, but all soft drinks Brooklyn Bridge is the fea- does not eat the bones of the sive research work regarding will be sold by the Civic As- ture. chicken.” (1980; 20 minutes) the Fort Fisher prisoners. He sociation. The fee for booths/ Documentary-lovers can 5:30 p.m. — Brooklyn will speak about the Battles tables is $25. Make checks pay- experience sophisticated and Bridge, Director Ken Burns of Fort Fisher, but will focus able to Farmers Union Civic inspiring entertainment. — Revered for his epic-length on the Confederate prisoners Association. The deadline is [Mini] DocuTime will be held documentaries like The Civil who were captured and what West Point ring Sept. 13. The contact person is U.S. Military Academy Cadet Gilbert Elvington Enzor at UNCW’s King Hall Audi- War, Baseball, Jazz, and Prohi- became of them. A number of Clarence Spaulding, (910)646- torium at 4 p.m. on Saturday, bition, Burns narrowed his fo- men from Columbus County shows off his West Point ring to Alexandria Faith Floyd 4792, (910)840-4811, or cspauld- Sept. 15. Advance Tickets are cus to the Brooklyn Bridge in were captured at Fort Fisher of Loris, S.C. and Alexandra Grace Moring after receiv- [email protected]. available online at www.etix. his debut feature. Narrated by and taken to Elmira prison in ing it during the USMA West Point ring ceremony. Gil The park is located on com or at Sharky’s Box Office historian David McCullough New York. A list of the those is the great nephew of Plan Lanneau Elvington of Fair Farmers Union Road, Clark- on the first floor of the Fisher on whose book the film is men will be on display. ton. Bluff and Alex Grace is Elvington’s third grandchild. Student Center. Advance tick- based, this documentary con- While at the Academy Alex Grace attended a briefng et sales end Sept. 15 at noon, siders the largest bridge of its at the USMA admissions offce. She is a sophomore at but may be purchased at the era: a technical achievement Wando High School in Mount Pleasant, S.C. and has door. The price is $10, but of unparalleled scope marked County Fair Cancellation Earnestine Keaton has can- begun her search for colleges she might attend. free entry for students with by enormous construction booths for rent ID. Parking is available at the problems, equally ingenious celled her historical presenta- Fisher Student Center Lot off solutions, and heroic human Columbus County Fair tion series that was scheduled Hamilton Drive. achievement. The Brooklyn time is just around the corner, to begin on Saturday, Sept. 8, Following is a schedule: Bridge captured the Ameri- and fair officials are now ac- due to unexpected scheduling 4 p.m. — Night Mail; Direc- can imagination and became cepting reservations for booth conflicts. rentals. A new start time will be an- Short on Money? tors Basil Wright and Harry a symbol of strength, vitality, Watt. ingenuity, and promise. (1981; The charge for an 8x10-foot nounced later. Featuring a poem by W.H. 60 minutes) inside vendor booth with elec- We Can Help! Auden as part of its narra- trical outlet is $150, and they tion, Night Mail blends lyri- will be reserved on a first cism and realism to assert an SNCGS to come, first served basis. Some Wishing We Offer Personal Loans from unabashedly positive view of may prefer to have the same booth they had last year, and $1,000.00 to $3,000.00* working life and a hymn to meet Sept.8 Ernest Industrial Britain. On a nar- that will be considered. rative level, the film follows The Southeastern North To reserve a booth contact We like to say YES! Carolina Genealogical Society Ann Ferguson at 910-654-4808 Barnes a London, Midland and Scot- a Happy 95th Birthday! tish Railway (LMS) mail train will meet at the N. C. Museum or email [email protected]. Your tax return prepared here; from London to Scotland. On of Forestry, 415 S. Madison St., com. The fair will be held September 4, 2012 make us your one stop shop! a philosophical level, perhaps Whiteville, on Saturday, Sept. Tuesday through Sunday, Oct. more than any other film of 8 at 2 p. m. Those who wish 9-14. Visit www.columbus- the period (or since), Night may gather at 1 p. m. for con- countyfair.com to learn more Mail encapsulates everything versation and sharing of fam- about what the fair will offer about The Locomotive Age ily histories. this year. that continues to attract such Buddy Harrelson of Mar- fervent admiration in so many ion, S.C. will present a pro- people. (1936; 25 minutes) gram on “Harrelson Family 4:45 — Werner Herzog Eats Myths and DNA Markers.” So- Vineland ciety members and others in- 1615 S J K Powell Blvd Ste A His Shoe; Director Mel Blank. Whiteville NC 28472 As now-famous documen- terested in genealogy and his- tory are invited. Station (910) 641-0189 tarian Errol Morris was work- Available for wedding www.security-fnance.com ing on his first film, veteran director Werner Herzog made receptions & other a bet that if Morris finished events *All loans are subject to our liberal credit policy and credit limitations, if any. the movie, he’d eat his own 642-3157 We Love You Papa! #3129 The News Reporter, Monday, September 3, 2012--7A RBH fundraiser Program on Medicare changes, to feature bakery, other information is Sept. 20 food, auction, A two-hour session on program and a hot lunch are changes to the Medicare pro- free, but reservations must be and music gram will be held Thursday, made in advance for lunch. Ann Pait, chair of the Sept. 20 at the First Baptist Call the RSVP office at 642- Reuben Brown House Pres- Church in Whiteville. Regis- 7141 ext. 294 before Sept. 10 to ervation Society fundraiser, tration will begin at 9:30 a.m. make lunch reservations. announces that The Waymen and the program will be held Some of the questions that will perform Thursday, Sept. from 10 a.m. until noon. will be answered are “Do I 13 from 6-8 p.m. at Vineland The church is located at 412 need to make changes to my Depot. Having performed lo- N. Madison Street at the cor- Part D or supplemental cover- cally since 2005, Forrest Riggs ner of Church Street, three age Plan?” “Confused about plays bass, and Richard Gore blocks south of the court- Medicare or are you new to and Gene Wayman play gui- house. Medicare?” “Is there any help tar. Each has a quality voice The program is sponsored with paying for prescription and the group enjoys play- by Seniors Health Insurance medications?” and “What ing classic rock, country, and Information Program (SHIIP), community resources are songs of the South. the Department of Aging and available for my aging parent Gene and Forrest are from Columbus County RSVP. The or loved one?” Lake Waccamaw and Rich- ard hails from Old Dock. The group enjoys pitching in to Race Sept. 8 for cancer patient benefit charitable groups such Participating in the presentation of a donation to Boys and Girls Home from The Ruth A Tabor City couple will – electric mains 10 minutes; as the Reuben Brown House House were, left to right, Tom Simmons, Ray Cockrell, Gary Faircloth, Jon David, Bev- host a fundraising race on 10-minute lower mains. The Preservation Society. erly Petro, Peggy Pruden, Barbara DeMore, Pat Brown, Vicki Gonzalez, Mike Petro and Saturday, Sept. 8 for a friend track opens at 9 a.m. and the The fundraiser will feature Doug Brown. who was diagnosed with race will begin at noon. not only the Waymen, but breast cancer and underwent The entry fee is $20, and also food, beverage, a silent a double mastectomy Aug. 2. all of the money will go to auction and a corner bakery. Called The Summer Miller Summer “to lift her spirits Members are baking special B&GH welcomes funds for Shootout, the race will be and have fun however she goodies that will be for sale. held on a track at the home wants,” Myssie said. “Anyone The silent auction always has of Eric and Myssie Hanna, who cannot make the race, great selections. teen mom, baby program 588 H. Coleman Lane, Tabor but still feels like making Tickets are $25 per person Boys and Girls Homes of B&GH vice president of com- provide a nurturing, loving, City. a donation, send payments and may be purchased at the North Carolina Inc. (B&GH), munity-based services. “Our Christian-home environment Classes include pro buggy, to our Paypal account: mys- door, from Ann Pait by tele- a non-profit organization of- friends at The Ruth House are for at-risk teenage girls come open buggy, truggy, electric [email protected] or write a phoning 642-2480 and from fering in-home and out-of- helping to make this program to fruition.” buggy, 2wd SCT, and 4wd SCT. check made to Summer Mill- members of RBHPS. home placements for vulner- a reality; they are helping us The Ruth House: A Home Running 3 Qualifiers, five er and mail to 588 H. Coleman Funds received will help able children, has announced stop the cycle of abuse these of New Beginnings Inc. was minutes; 20 minute A mains Lane, Tabor City, N.C. 28463. with the many projects of that a donation from a former teenage girls have experi- founded in 2009 by Maribeth RBHPS, including the A.R. like-minded local charity is enced so they won’t continue and Jeff Achterberg. They Ammons Poetry contest that earmarked for a new program the cycle with their own chil- saw a need and responded by School supplies are involves more than 1,100 stu- serving teenage mothers and dren. And, for that we are tru- establishing the North Caroli- dents in the Columbus Coun- mothers-to-be from across the ly thankful.” na-based nonprofit. They fur- needed for foster care kids ty and Whiteville City school region. The teen mom and baby ther donated the one-acre par- The Department of Social are looking forward to anoth- systems, poetry and other lit- Officials from The Ruth program, called The “Lake” cel of land on which The Ruth Services’ foster care depart- er successful year,” said Dwel- erary readings four times per House of Brunswick County House which stands for “Lov- House was to be built. ment is requesting donations la Hall, foster care supervisor. year, restoration and mainte- presented a check for $7,500 ing And Knowledgeable En- B&GH has been helping of school supplies for foster All supplies can be dropped nance of the Reuben Brown to B&GH President Gary Fair- vironment,” is slated to open children since 1954. Since children of Columbus County, off at Columbus County De- House and the opportunity for cloth on July 24. Participating in September. It will be a then, thousands of children of all ages. partment of Social Services fun at the fundraiser. were Ray Cockrell, B&GH di- residential program for girls have benefited by the ser- “We have appreciated all between 8:30 a.m. and 5 p.m. RBHPS has also appointed rector of planned giving; Jon in the custody of DSS who vices of the not-for-profit, the support from local busi- Monday through Friday. a committee to look into rec- David, Ruth House board; Peg- are pregnant or have a child. 501(c)3 agency. Its mission is ness and county residents for For more information con- ognition of historical, resi- gy Pruden, Ruth House trea- Mothers will be required to at- to provide a comprehensive foster care children and we tact Hall at 641-3237. dential and commercial struc- surer; Pat Brown, Ruth House tend school or a GED program array of services for children tures in Columbus County board; Doug Brown; Barbara and/or have a job during the and youth who have been re- and to offer aid for restora- DeMore, Ruth House vice day while their babies attend moved from their homes due tion. president; Vicki Gonzalez. an area daycare. Mentors who to abuse, neglect or other fam- School supplies are For more information and Ruth House board; Tom Sim- live with the mothers and their ily dysfunction. In addition to for tickets contact Ann Pait at mons, B&GH chairman of the babies in The Lake House will The Lake House, B&GH offers needed for Families First 642-2480 or Richard Wright at board; Gary Faircloth, B&GH educate them on parenting, adoption, family and thera- Families First Inc. is in of the domestic violence pro- 653-2082 ext. 101. President; Beverly Petro, Ruth nutrition, budgeting, exercise, peutic foster care as well as need of school supplies for cli- gram and shelter. “We will ac- House secretary; Mike Petro, safety, self-esteem, indepen- residential care on the cam- ent’s children of all ages. Es- cept new or gently used school Ruth House president. dent living as well as health pus at Lake Waccamaw. The pecially needed are one, three uniforms. You can also call Additionally, the site for issues for both mom and baby. campus features an accredited or five-subject notebooks, the office for specific sizes or County Fair The Ruth House, a one-acre When appropriate, fathering middle and high school, voca- notebook paper, large binders, make a financial contribution parcel in Ocean Isle Beach classes will be made available tional education, recreation hand sanitizer, pencils, ink designated for uniforms. seeks talent with an estimated value of to birth fathers. facilities, farm, chapel and pens, colored pencils, high “Thank you for all your $200,000, has been donated to “The board of directors is cottage life. As many as 180 lighters, pencil pouches and support,” Pate added. “Sup- show entries B&GH. The land will be sold to pleased to have made these vulnerable children are cared crayons. plies and uniforms should be “We are also trying to help delivered to the Families First The Columbus County Fair help sustain operations of the financial resources available for through residential and with school uniforms,” said office at 812 Pinckney Street will be held Oct. 9-14, and is new teen mother program on to The Lake House program,” community-based services Vickie Pait, executive director in Whiteville or call 642-5996. seeking entries for a talent the campus of Boys and Girls says Beverly Petro, spokesper- at any given time. B&GH is contest for all ages. Anyone Homes in Lake Waccamaw. son for The Ruth House. “The nationally accredited by the who sings, dances or has an “We are blessed and en- visions of our two programs Council on Accreditation unusual talent is invited to couraged by this generous are identical. We are seeing (COA). To learn more, visit Lake library seeks friends compete. donation,” says Donna Yalch, The Ruth House mission to www.boysandgirlshomes.org. The Rube McCray Memo- camaw, N.C. 28450, or drop it The Saturday night finale rial Library is conducting its by the library. Visit the web- winners in each division will 2012 membership drive, which site at www.lakewaccamaw. receive cash awards and tro- Symphony will celebrate the is important to the success of com, or phone 646-4616. phies. The entry deadline is the library. Sept. 30, no exceptions. Friends of the Library are Veterans to hold For complete details and music of Ray Charles responsible for the upkeep registration forms visit www. and maintenance of the build- Former Tower of Power of Power, and as a collabora- Charles’s label, Crossover Re- fundraiser Sept. 3 columbuscountyfair.com or ing. Budgets are limited and frontman Ellis Hall on stage tor with Stevie Wonder, Patti cords. This tribute has led to Pizza Hut of Whiteville will contact Columbus County cannot cover many things for R&B and soul classics, LaBelle, Kenny G, John May- performances with symphony hold a fundraising event Mon- the board would like to make Fair talent coordinators Brin- Sept. 28-29 er, Natalie Cole, James Taylor orchestras around the U.S., in- day, Sept. 3 from 5 to 9 p.m. kley Carroll at 625-5134 or The North Carolina Sym- and Earth, Wind & Fire, in ad- cluding the Boston Pops and available to library patrons. A percentage of the money Natalie Carroll at 714-6003. No phony honors an American dition to Ray Charles himself. now the North Carolina Sym- There are four levels of collected will be donated to phone calls after 10 p.m. original with its season-open- Hall also enjoyed great suc- phony. membership: individual, the Disabled American Vet- ing Pops Series concert, “The cess as a member of the multi- Regular tickets to this Pops $10; family, $20; sponsor, $50; erans, Veterans of Foreign Music of Ray Charles,” at platinum California Raisins. Series performance range and benefactor, $100. Any- Wars and Vietnam Veterans Class of 1955 downtown Raleigh’s Meyman- Additionally, he has been from $18 to $67, with $34 tick- one interested in joining The of America. ets for seniors. Students can Friends may send a check di Concert Hall Friday and featured in several films, plans reunion Saturday, Sept. 28-29 at 8 p.m. including Big Momma’s receive $15 tickets. for the desired membership The Whiteville High School Charles’s protégé, friend and House and Steven Spielberg’s To purchase tickets, visit level to Friends of RMML, 301 Class of 1955 will celebrate fellow Georgia native Ellis Catch Me If You Can, and on www.ncsymphony.org or call Flemington Drive, Lake Wac- the 57th year reunion on Fri- Hall joins the orchestra and soundtracks ranging from the Symphony Box Office at television’s The West Wing 919-733-2750 or toll free 877- day and Saturday, Sept. 28- Symphony Resident Conduc- tor William Henry Curry for and NYPD Blue to films in- 627-6724. Meymandi Concert 29. Classmates should bring an evening of R&B and soul cluding Chicken Run and Hall is located in the Progress memorabilia to share. classics. Bruce Almighty. Hall is Energy Center for the Per- Keep Them Anyone who attended Hall, a multi-instrumen- the only artist other than forming Arts, 2 E. South St., school with the Class of 1955 talist, songwriter, arranger Ray Charles to be signed to in Raleigh. healthy! is encouraged to attend. and producer, was appointed For more information con- by Ray Charles as his R&B tact Jack Formy-Duval at heir apparent. He has since Z 843-249-1223 or 910-258-3937 or worked with an incredible list Z [email protected] of music icons, both as lead Z Kid Kare vocalist, keyboardist, song- Z ZZ Book sale at writer, arranger and producer of the legendary group, Tower library Oct. 20 Educational Center The Friends of the Caro- lyn T. High Memorial Library Who are our will sponsor a book sale at Do You Work at Night? the library on Saturday, Oct. WWII vets? 20 from 9 a.m. to 1 p.m. Dona- Neal Hector McNeill of We Can Help! tions of books, tapes, DVDs, Whiteville is interested in get- movies, vinyl records, maga- ting a list of World War II vet- Available Now zines, children’s books, comic erans who reside in Columbus Z Now With 2 Shifts Z books, and such will be appre- County. st ciated. McNeill is especially inter- 1 Shift> 6:30am-6pm These items may be ested in making connection dropped off at the library and with those who served at Iwo nd FLU SHOTS, FLU MISTS: specify they are for the Oct. Jima. So far as he knows, he 2 Shift> 3pm-12am Also Available During Our Saturday Walk-in Hours 20 book sale. Or, call 642-6426 said, he and Mike Byrd of Fair to arrange for a pick-up. This Bluff are the only two still liv- Injection Fee of $15 may be applicable. book sale is to help support ing in Columbus County who the Bookmobile and its out- were at Iwo Jima. Horace Cox reach programs. of Tabor City, who died a few 654-5278 Columbus Pediatrics months ago, also served there. Veterans meet Anyone who knows of & Adolescent Care Vietnam Veterans of Amer- World War II veterans is asked 4881 Chadbourn Hwy 800 Jefferson Street • Suite 116, Whiteville ica meet the first Tuesday of to contact McNeill at 642-2807, or email claracartrette@ 642-2642 each month at 7 p.m. at 1028 S. Chadbourn Madison St., Whiteville. whiteville.com. 8-A – The News Reporter, Monday, September 3, 2012 State warns residents about Mold byproduct can damage corn corn. The fungus can produce corn in small amounts with- By RAY WYCHE a toxin in the corn that can out harming livestock. Afla- current mosquito dangers Staff Writer be harmful to animals and toxin in large levels causes humans. problems with the digestive By RAY WYCHE with the coming of recent County usually comes in the The hot growing season But Extension Service systems of livestock. Staff Writer rains the calls have increased, fall months. this summer, coupled with Agent Michael Shaw said “Everything in the diges- said health department Envi- “We have gotten a number recent rains and high hu- earlier this week that there tive system is going to be The state is warning all ronmental Specialist Brandon of complaints but not as many midity, has the potential of had been little evidence of affected,” said Phyllis Creech- residents to be cautious about Grigsby. as expected,” he said. producing a bumper crop of aflatoxin in the corn crop now Greene, Extension Service mosquitoes in the wake of The health department will “We want to encourage ev- a fungal growth on harvested being harvested. livestock agent. three deaths from mosquito- spray insecticide if special- eryone to protect themselves,” “This year there seems The fungus causes “little borne illnesses reported in the ists determine the mosquito said State Health Director Lau- to be less than in the last or no harm to the corn,” Shaw state this summer. population is heavy enough to ra Gerald. She added that 80 two years,” Shaw said of the said. The warnings repeat those warrant such action. percent of the people infected County board fungus. Farmers can have corn made by officials of the Co- Five cases of West Nile Vi- with West Nile Virus will not N.C. Commissioner of Ag- they are feeding to their live- lumbus County Health Depart- rus, the most common disease show any symptoms. to meet Sept. 4 riculture Steve Troxler has stock tested by contacting the ment: do away with possible spread by the bites of infected As of last week, the U.S. nGrant for additional urged farmers feeding corn Extension Service at 640-6605 breeding sites for mosquitoes, mosquitoes, have been report- Centers for Disease Control to their livestock to have in Government Complex, or don’t venture outside at dusk ed in the state this summer, reports that West Nile has been deputies, courthouse fi- nancing top agenda. the corn tested for aflatoxin. the Border Belt Tobacco Re- or dawn unless absolutely with three of the victims dying reported in 48 states resulting Grain markets buying corn search Station northwest of necessary, and use an insect from the disease. Cases have in 1,590 cases of the disease from farmers test each truck- Whiteville. Due to the Labor Day holi- repellant containing DEET. been reported in Mecklenburg, with 66 deaths. load for the fungus and while day, Columbus County commis- For most of this summer, Forsyth, Wayne, Cabarrus and not refusing to buy tainted sioners will meet on Tuesday, calls to the local health depart- Scotland counties. Ray Wyche Ray Wyche Sept. 4 rather than their regu- corn, will pay a lower price. ment about heavy mosquito Grigsby said the worst time 910-642-4104 ext. 229 Aflatoxin-infected corn 910-642-4104 ext. 229 populations had been few, but for mosquitoes in Columbus lar Monday meeting date. A 6:30 p.m. a public hear- can be mixed with fungus-free ing to consider an installment finance agreement for the new courthouse annex kicks Columbus Charter off the meeting. The project UNCP scientist urges was expected to cost no more Middle School than $9 million but the low bid was nearly $10 million Student Of The Week with officials anticipating the West Nile Virus caution negotiation of a lower price. Seventh-grader Jake McPherson, 12, Subsequent consideration of a is Columbus Charter Middle School’s West Nile Virus, the mos- Mosquitoes, which are ben- stagnant and absolutely still proposal from Sun Trust Bank Student of the Week. The son of quito-born illness that has eficial sources of food for some water to survive,” he said. on the financing is included in Andy and Cindy McPherson, Jake is killed 67 people this year and species of birds and fish, have “Mosquitoes can lay eggs on the agenda. involved with Boy Scouts, his church infected more than 1,500 in the a long and unhealthy relation- moist earth or even dry earth A public transportation youth group, four-wheeling, paintball U.S., is a concern for South- ship with humans. The num- that has a history of collecting contract is on the agenda to be and his German Shepherd, Hachi. His eastern North Carolina, said ber one killer on the planet is water. The eggs survive until approved. favorite classes are reading “because UNC Pembroke entomologist mosquito-born malaria, Dr. water returns.” The sheriff is seeking we read good stories” and science and mosquito researcher Dr. Ezell said. When the adult mosquito approval of a food service “because we get to do labs.” He said W. Bruce Ezell. As many as four mosquito emerges and mates, the trou- proposal by Trinity Services the best thing about CCMS is Principal Carla Fisher because The region’s moist and rela- species have been linked to ble begins for humans. Group, acceptance of a grant “she keeps the school in line.” He said he is most proud of tively cool weather recently is West Nile Virus, although “After mating, they are for equipment via the Gover- his improvement in math and reading. Jake said the most the perfect environment for there may be more, according desperate for a protein source, nor’s Highway Safety Program interesting thing about him is he has been a student at Co- breeding mosquitoes. The Cen- to Dr. Ezell. It is one of many and vertebrate blood is the and two additional officers. lumbu Carter Sool ine it rt bean e oe to o ter for Disease Control said viruses, which are increasing best source,” Dr. Ezell con- A public hearing on an into K-9 law enforcement some day. His favorite performer is 2012 has been a bad year for the in number because we live in cluded. incentive grant for MaXPro Lecrae and his favorite book is the Bible. His favorite movie West Nile Virus. Almost half a more connected world. About a fifth of those infect- Manufacturing, a company is “Hachi” and he loves McChicken sandwiches. the cases reported have been The West Nile Virus is an ed with West Nile Virus will that has bought the shell build- in Texas, compared with three “arbovirus” or arthro/pod/ develop a fever, headaches, ing and will manufacture win- deaths in North Carolina. borne/virus and, in this case, tiredness, body aches, swollen dow tint, is planned at 7 p.m. Sponsored By “There is cause for con- mosquito-borne. lymph glands and possibly a and approval of an incentive cern,” Dr. Ezell said, “and it is Birds, which carry the vi- skin rash that may last only a grant a part of the agenda. CCI ROOFING worthwhile for us to take some rus, are called “viremic” car- few days or a few weeks. Most The building inspections Commercial & Residential precautions.” riers that are not affected by people infected by the virus department will deliver an [email protected] The UNCP scientist gave the disease. will have no symptoms. update to the board. (Nicole Charles Coleman (910) 770-2476 this advice for avoiding con- Dr. Ezell said more research However, severe or neuro- Cartrette) tact with mosquitoes: is needed, but for the virus to invasive cases may develop Plan activities when mos- be transmitted to humans, the West Nile encephalitis or quitoes are less active. They mosquito must have first taken meningitis or poliomyelitis. thrive on the cooler tempera- blood from a bird. This results in headaches, tures at dawn and dusk. “Humans are the second neck stiffness, disorientation, Wear protective clothing blood meal in this case,” he tremors, convulsions, weak- and light colored clothing. said. “This may be a limiting ness, paralysis and coma. Mosquitoes favor dark colors. factor in the spread of the dis- An estimated one in 150 Eliminate standing water. ease because one blood meal is persons infected with West HUNTERS Eliminate water standing in usually sufficient.” Nile Virus develops severe tires, ditches, gutters, tree Dr. Ezell conducted re- symptoms, which may result holes, unused swimming pools search on mosquitoes at in death or lasting neurologi- and any container that collects Clemson University and other cal damage. rainwater. schools and later for the Army Although there is no treat- Use insect repellant with Corps of Engineers on coastal ment for the infection itself, DEET mosquito issues. He is par- the person with severe disease “Our best course now is to ticularly knowledgeable of often needs to be hospitalized. inform the public about these the mosquito life cycle, which Care may involve nursing, IV precautions,” Dr. Ezell said. takes 18 – 22 days from egg to fluids, respiratory support “Source reduction is impor- adult. and prevention of secondary tant.” “Mosquito larvae require infections. Program on Medicare changes, other information is Sept. 20 and PAWN HUNDREDS OF NEW & USED GUNS A two-hour session on The program is sponsored Some of the questions to changes to the Medicare pro- by Seniors Health Insurance be answered are “Do I need to Come See Our Complete Line of gram will be held Thursday, Information Program (SHIIP), make changes to my Part D or Sept. 20 at the First Baptist the Department of Aging and supplemental coverage Plan?” Guns, Ammo, Reloading & Deer Scents Church in Whiteville. Regis- Columbus County RSVP. The “Confused about Medicare or

tration will begin at 9:30 a.m. program and a hot lunch are are you new to Medicare?” “Is Now In Stock and the program will be held free, but reservations must there any help with paying for “ from 10 a.m. until noon. be made in advance for lunch. prescription medications?” Now In Stock The church is located at Call the RSVP office at 642-7141 and “What community re- Browning 412 N. Madison Street at the ext. 294 before Sept. 10 to make sources are available for my 3½ Benelli corner of Church Street, three lunch reservations. aging parent or loved one?” Vinci Auto 5 blocks south of the court- house. • Browning (Full Line Dealer) Now Open • Winchester • Benelli • Remington • Savage • Colt • Ruger • Weatherby • Marlin • LaCrosse Boots Voice concerns on conservation Winchester Super-X Game Loads issues at meeting Express By the Box or Case - All Gauges Available this Tursday FujiJapanese Hibachi Chinese Cuisine The Locally Led Conserva- tion Work Group, for landown- ers, farm managers and oth- ers dependent upon soils for livelihoods, will meet at 10 a. m. Thursday at the Columbus County Agriculture Services Besides Domino’s Center in Government Com- plex north of Whiteville. 140 Whiteville Town Ctr. The Locally Led Group Whiteville, NC meetings are designed to iden- 910.640.1238 tify resource concerns to bring to the attention of the local OPEN HOURS: Monday-Closed Soil and Water Conservation Tuesday - Sunday 11:00 am - 9:30 pm Also Jewelry, TV’s, Stereos, VCR’s District officials who will un- no checks please dertake corrective actions, if possible. Landowners and land man- Bring this coupon in to receive BRYANT’S GUN & PAWN agers will have the opportunity 3551 A Fayetteville Rd, Lumberton, NC • 738-4848 to make comments and to help 10% Off Monday - Friday 9 - 6 • Saturday 9 - 3 identify conservation issues at Fuji Your Total Bill the meeting. Express bryantsgunandpawn.com • Visit us on Facebook Deaths The News Reporter, Monday, September 3, 2012 -- Page 8A

MCARTHUR LEE NANCE MARSHALL HOWARD JUNE KINLAW KOENIG BAILEY WAYNE BRITT CHRISTINE HAMMOND DEATH NOTICE FAYETTEVILLE -- McAr- WARD SR. ELIZABETHTOWN -- June CHADBOURN -- Bailey NICHOLS, S.C. --Christine thur Lee Nance, 67, formerly of SHALLOTTE -- Marshall Kinlaw Koenig, 49, died Thurs- Wayne Britt, 75, died Sunday, Hammond, 83, died Friday Aug. Chadbourn, died Friday, Aug. Howard Ward Sr., 67, died day, Aug. 30, 2012. She was Sept. 2, 2012 at his residence. 31, 2012 at Mullins Nursing 31, 2012 at Cape Fear Valley Wednesday, Aug. 29, 2012 at preceded in death by her step- He was the son of the late Rob- Center. She was born March Medical Center. Lower Cape Fear Hospice and mother, Betty Graham Kinlaw. ert Bailey and Beulah Jenkins 21, 1929 in Horry County the Final rites will be held at 11 LifeCare Center. He was a na- Final rites were held Sun- Britt. daughter of the late Emory and a.m. Monday, Sept. 3 at First tive of Brunswick County, born day, Sept. 2 at Elizabethtown The family will receive Bertie Edwards Hammond. Missionary Baptist Church, Feb. 6, 1945, the son of Marshall Baptist Church with Rev. Chris friends from 7-9 p.m. Tuesday, Final rites were held Sun- 505 South Wilkes Street, Chad- Haig and Nora Hall Ward. Carroll and Dr. Bill Young Sept. 4 at Worthington Funeral day, Sept. 2 at Meares Funeral bourn. Burial will be in Belvue He was formerly a salesman officiating. A private burial Home in Chadbourn. Final Home, Fair Bluff. Burial was Cemetery. Peoples Funeral with Heilig Myers furniture, a was held at Bladen Memorial rites will be held at 11 a.m. in Hammond Cemetery, Nich- Home of Whiteville is han- security officer with Dupont Gardens. Bladen-Gaskins Fu- Wednesday, Sept. 5 at Corinth ols, S.C. dling the arrangements. View- and was employed with CP&L. neral Home of Elizabethtown Baptist Church, Chadbourn She is survived by one ing will be held Monday one A graveside service was handled the arrangements. with Rev. Coy Long Jr. officiat- brother, Will Hammond of hour prior to the service at the held Saturday, Sept. 1 at Jen- She is survived by her hus- ing. Interment will be in Chad- Nichols, S.C.; and two sis- church. There will be no view- nings Branch Church Cem- band, Albert C. Koenig of the bourn Memorial Cemetery. ters, Alice “Judy” Hammond ing after the service. etery in Ocean Isle Beach. home; her mother, Fran Penny He is survived by his wife, of Nichols, S.C. and Veroni- Surviving are his wife, Peacock Funeral Home in of Whiteville; her father, Hu- Carolyn Watkins Britt of the ca “Ronnie Sue” Daniels of Mary O. Nance; one stepson, Whiteville handled the ar- bert Kinlaw of Elizabethtown; home; two sons, Gary Wayne Whiteville. Clinton Owens of Fayetteville; rangements. one son, Cliff Koenig of the Britt of Chadbourn and Greg- Memorials may be made to three sisters, Genora Williams He is survived by two sons, home; and one sister, Denise ory D. Britt of Frewsburg, N.Y.; Hammond Cemetery, c/o Will of Durham, Janice Jackson of Marshall Ward Jr. and Chris Kinlaw Cross of White Lake. one sister, Marie B. Schwab of Hammond, 6325 Jerry Road, Jersey City, N.J. and Barbara Ward, both of Nakina; two In lieu of flowers, memori- New Bern; and three grand- Nichols, S.C. 29581 Brown of Chester, Va.; and four daughters, Melissa Etheridge als may be made to Elizabeth- children. brothers, James Nance and Tedder of Lake Waccamaw, town Baptist Church, Rebuild Liberty Worship Center MARTHA G. SMITH Bernard Nance, both of Jer- Suzanne Ward of Whiteville; the Vision, 1800 West Broad EDDIE POWELL to hold 5th anniversary HALLSBORO -- Martha sey City, N.J., Curtis Nance of one sister, Judy Ann Hood of Street, Elizabethtown, N.C. CHADBOURN -- Eddie Pow- Liberty Worship Center G. Smith, 84, died Satur- Chadbourn and Rufus Nance Clarkton; and nine grandchil- 28337 or Bladen Crisis Center, ell died Friday, Aug. 31, 2012 at will hold its 5th anniversary day, Sept. 1, 2012 at Lower of Petersburg, Va. dren. 208 S. Moorehead Street, Eliza- his residence. at 10 a.m. with Rev. Larry Cape Fear Hospice and Lif- bethtown, N.C. 28337. Final rites are incomplete Priest preaching. There will eCare Center in Whiteville. JOANN B. TURNER CLINTON JONES and will be announced by be singing at 11 a.m. with The She was born April 27, 1928 BLADENBORO -- Joann B. TABOR CITY -- Clinton HORACE MITCHELL Smith Funeral Home of White- Browns of Wallace. Lunch will in Columbus County, the Turner, 66, died Saturday, Sept. Jones died Sunday, Sept. 2, 2012 MEADOWS ville. be served on the grounds fol- daughter of the late Dave 1, 2012. at Lower Cape Fear Hospice BLADENBORO -- Horace lowing the service. and Clyde Green. She was The family will receive and LifeCare Center, White- Mitchell Meadows, 89, died The center is located at 89 N. the widow of Charles L. friends from 6-9 p.m. Tuesday, Friendship MBC to ville. Saturday, Sept. 1, 2012. He was Grove Street, Clarkton. Smith. Final rites are incomplete Sept. 4 at Bladen-Gaskins Fu- preceded in death by his par- hold Homecoming neral Home in Elizabethtown. For more information call She was preceded in death and will be announced by ents, Chas and Rena Meadows; Friendship Missionary Final rites will be held at 4 Priest at 640-6147. by two sisters, Lillian Friendly Funeral Home of his wife, Pauline Meadows; two Baptist Church will hold its p.m. Wednesday, Sept. 5 at the Bright, Clossie Green; and Riegelwood. stepsons, Freddy and Richard Homecoming/Family and funeral home with Rev. Dale six brothers, Edward, Wel- He is survived by his wife, Walters; two brothers, Roy Friends Day Sunday, Sept. 9 West Columbus Viking Hester officiating. Burial will don, William, Leander, Co- Judy Nealey Jones of Tabor and Dan Meadows; two sis- at 11:15 a.m. The guest speaker Booster Club meets be in Sandhills Cemetery. las and John Wesley Green. City; his mother, Eloise Jones ters, Shirley and LauraBelle will be Pastor Rev. Algernon The West Columbus Ath- She is survived by her hus- She was a life long mem- Brown of Tabor City; his fa- Meadows. McKenzie. letic Viking Booster Club will band, Charles Turner; one son, ber of Hallsboro United ther, William Jones of Tabor Visitation will be held from Lunch will be served follow- meet Tuesday, Sept. 4 at 7 p.m. Chris Turner; four daughters, Methodist Church. She was City; four daughters, Charni- 1-2 p.m. Tuesday, Sept. 4 at ing the service. in the library. Kim, Terri, Kristie, Sharlene formerly employed with ska, Fledricka, Shaequanta Lewis-Bowen Funeral Home. A A gospel explosion will be For more information call Turner; two brothers, Kennie the Columbus County Tax McCray, Tamekia Jones, all of graveside service will follow at held at 3 p.m. with special Jerry Haynes at 770-2356. Blackmon, Donald Blackmon; Office where she retired Tabor City; two sons, Clintarus 3 p.m. at Meadows Cemetery in guest “The Mighty Echoes” two sisters, Dorothy Faircloth, in 1993. She was a devoted Jones, Latarus Evans, both of Bladenboro. of Elizabethtown along with Rosie Smith; and five grand- mother and grandmother. Tabor City; seven sisters, Terry He is survived by his step praise dancing. children. She enjoyed her church, Gonzales of Oklahoma, Sharon grandchildren. Revival will begin Monday, family and friends. and Christa Jones, Roshetta Sept. 10-Wednesday, Sept. 12 at Visitation will be held Hemingway, Tressa Graham, Jerusalem Chapel WOW Lodge 130/ 7:30 p.m. each night. The guest from 6-8 p.m. Tuesday, Sept. all of Tabor City, Willette Gore FWBC to hold Family/ speaker will be Rev. Corey 4 at McKenzie Mortuary. A of Green Sea, S.C., Stepha- Evergreen Lodge 1088 Blanks, pastor of Shady Grove celebration of her life will nie Jones of Raleigh; and his Friends Day Sept. 16 to hold ceremony AME Zion Church of Council. be held at 11 a.m. Wednes- stepfather, Eddie Brown of Jerusalem Chapel Freewill The Woodmen of the World The church is located at 239 day, Sept. 5 at the mortuary. Tabor City. Baptist Church will hold its Lodge 130 in Cerro Gordo and W. Columbus Street. DEBT RELIEF Burial will be in Lake Wac- Family and Friends Day Sun- Evergreen Lodge 1088 will Bankruptcy camaw Hillcrest Cemetery, day, Sept. 16 at 11:15 a.m. The Nichols to preach have an Honor and Remem- WOW Lodge 130 to Lake Waccamaw. morning service will be ren- Stop Foreclosures initial sermon Sept. 9 brance Ceremony to Honor She is survived by one son, dered by Pastor Elder Fredrick hold monthly meeting Get A Fresh Start the 9/11 event and those who LeGrande Smith of Cookev- Sister Lisa Nichols of Murray. Lunch will be served. The Woodmen of the World protect and serve the country. ille, Tenn.; a daughter and Bolton will preach her initial An afternoon service at 3 Lodge 130 in Cerro Gordo Attorney The event will be held Tues- son-in-law, Kathryn S. and sermon Sunday, Sept. 9 at 4 p.m. p.m. will be given by Apostle will hold its monthly meeting James day, Sept. 11 at 10 a.m. at Porter Harry Foley of Lake Wac- at Diamond Branch Baptist Anthony Buie of St. Joseph Thursday, Sept. 20 with dinner Robbins Swamp Baptist Church on camaw, brother-in-law, Har- Church, Whiteville. Miracle Revival Center of Red at 7 p.m. Andrew Jackson Hwy., Cerro 922 S. Madison St. old Smith (Clara) of Halls- Nichols is the daughter of Springs along with his choir Plans are to discuss a work Gordo. boro, and sister-in-law, the late James Franklin and and congregation. day and the district meeting Whiteville Eva Smith (Billy, deceased) Rosa Lee Hines and is a mem- Shining Light Ministries in Kinston. of Hallsboro; grandchil- ber of Antioch True Deliver- Clarendon FWBC to The lodge hall is located on dren Brian Worrell (Kate) ance Holiness Church where to hold yard sale Sept. 8 Andrew Jackson Hwy., Cerro CALL 642-4860 www.bankruptcylawwebsite.com of Fairfield Conn., Amber Bishop Bruce Alderman Sr. is hold revival Sept. 10-14 Shining Light Ministries Gordo. W. Bivens of Hallsboro, the pastor. Clarendon Freewill Baptist will hold a yard sale Saturday, Derrick Foley (Kristen) Church will hold its camp Sept. 8 from 8 a.m.-noon. There of Apex, Brent Cowan of Pine Level OFWBC to meeting revival Sept. 10-14 at will be a variety of items in- 7:30 p.m. nightly. There will Tulsa, Okla., Jason Cowan cluding baked goods. Proceeds of Kansas City, Missouri; hold revival Sept. 3-7 be a guest speaker and special will go towards the church seven great-grandchildren, Pine Level Original Freewill singing each night. building fund. Abigail, Annabelle Martha, Baptist Church of Nakina will The church is located at 3960 The church is located at 113 Ewan Worrell, Anna and hold its revival Monday, Sept. Williams Road. WS Railroad Street, Clarkton. Sophie Bivens, all of Halls- 3-Friday, Sept. 7 at 7:30 p.m. Bobby Cartrette is the pas- For more information call boro, Caroline Foley of nightly. The guest speaker will tor. Reba Little at 647-5231. Apex and Bradi Madewell be Rev. Jamie Ward. of Cookeville, Tenn.; and There will be special sing- a special friend, Veneda S. ing nightly. SOCIAL SECURITY DISABILITY Ray. The family will be at 2534 Hallsboro COG to Bella Coola Road, Lake hold plate sale Sept. 7 Waccamaw. DENIED In lieu of flowers, do- Hallsboro Church of God If you have been denied disability, we would like to help you. We are          nations may be made to will hold a fried chicken dinner paid a fee only if we can win your case and you collect benefits. We      Hallsboro United Method- sale Friday, Sept. 7 from 11 a.m. can come to your home and meet with you. As your representative,      ist Church or Lower Cape until. Plates include chicken, our job is to make sure you are treated fairly. Fear Hospice and LifeCare potato salad, green beans, roll     Center, 206 Warrior Trail, and cake. The cost is $6. HAL GRIFFIN ASSOCIATES, INC.        Whiteville, N.C. 28472. For orders call 646-4526 or Call Toll Free 1-800-392-7392 840-4305. www.mckenziemortuary.net

Are You Missing a Golden Opportunity?

Advertise in The News Reporter’s Classifed Section and you’ll reach all of Columbus County in print and online at Whiteville.com. Whether you’re selling your car or home, advertising a yard sale, giving away free kittens, or looking for a new employee, an ad in the Classifeds is the way to go. The News Reporter Call Hanne at 642-4104, ext. 237 or Wanda at 642-4104, and ext. 221 to get your ad started today! Whiteville.com Editorials Te News Reporter, Monday, September 3, 2012 Right message Ask us Q. What is going on with the reno- sent by jury, vation of the old Wal-mart build- ing beside Tractor Supply?

judge last week A. Big Lots is planning to move from its current location Perhaps the citizens of this county are to the old Walmart building in getting fed up with the constant stream of White’s Crossing Plaza in South drug defendants here having their wrists Whiteville. slapped and put on probation, particularly The Walmart building was the men and women involved in the business divided in half once to make way of selling, stealing and dealing in controlled for Tractor Supply, and Big Lots medication. hopes to open in the other half in Twelve men and women – six males and late October. six females – sat in judgment on a Chadbourn man charged with selling 11 pain pills. The defendant had a record of drug convictions, and was no stranger to the Sheriff ’s Drug Nobody wants Unit. The defendant was convicted of three to pay counts of trafficking in the medication – possession, sale and actual delivery of the By TOM CAMPBELL pills in an The point Special to The News Reporter undercover transaction A Chadbourn man got Wilmington Mayor Bill Saffo ex- overseen by the book thrown at him pressed the frustration of many pub- lic officials when discussing trans- the Sheriff ’s last week for selling Drug Unit. portation needs for the Port City. The jury pain pills. That, plus How can you build and maintain decided in a closer look at where roads, Saffo asked, when nobody wants to pay for them? This is the less than 15 all these pills are being Waiting in the wings of how things were minutes the big conundrum, not just for roads man’s guilt, prescribed, are the only but all aspects of the public sector. and quickly ways to curb this epi- By JEFFERSON WEAVER leaves and flower petals. whose sign was in the front yard When you ask the wrong ques- Staff Writer I had to smile as I wandered has good luck moving the house, tions you get wrong answers and returned to demic. the court- through, noting that some of the so someone else can turn it into right now we are asking the wrong room. The highway hummed a home- rooms were finally being put to a home. questions about government. In- Superior Court Judge Douglas Sasser lis- coming of sorts, and I wondered use as Miss Lois had dreamed, There is nothing wrong with stead of heated and unproductive tened attentively to Prosecutor Heath Nance’s what waited in the wings. back when the roof leaked and the house; it just wasn’t my home debate about whether to cut or argument that the defendant – William Leon I was headed back to my home- bees filled the Georgian columns anymore, and in an odd way that expand government let’s begin by Chestnut – should be sent to prison for three town of Clinton for the afternoon. and money was non-existent. hurt more than I expected. fundamentally deciding what we consecutive terms of 70 to 84 months, based It was not on one of the badly Dr. Small, you see, wanted Downtown Clinton has been want and need the public sector to on his criminal history of drug offenses, and needed, hit-or-miss visits with my his home to held up as a prime example of provide for the common good. For other non-violent crimes. brother Mike, but rather to help be turned downtown redevelopment. The instance, is it government’s job to Sasser, a member of the Governor’s Crime a TV production crew with a seg- into a place stores and buildings looked clean build and maintain a transportation Commission, noted before sentencing the ment on the Dr. Victor Small Cul- where local and welcoming; new streetlights network with good arteries to get us alarming number of overdose and drug-relat- tural Arts Center, better known p a i n t e r s, promised to make the courthouse to our jobs, enable the expeditious ed deaths in the group of people between the as the Small House. musicians, square as welcoming at night as movement of goods and services in ages of 18 and 24. My mother played a role in and artists it is in daylight. commerce and provide for safe and Nationally, Sasser pointed out, the drug the early stages of restoring the of all sorts There were no cracks in the efficient travel? If we agree this to be deaths among this age group have surpassed house and fulfilling Dr. Small’s could find windows of my old third-floor a responsibility of government, let’s annually the number of young people, 18 to plans for a community arts center. a venue. office in the Butler Building. I figure out how to pay for it. 24, killed in highway wrecks, and the number When you are passing through His es- doubt the winter wind whistles In 1795, North Carolina opened of deaths due to drug misuse in this state is a town you know well, the de- t a t e l e f t through the art studio of my old the first public university in Ameri- fast approaching the level of fatalities for the tails tend to blur. Sure, there only a lit- Weaver friend Peter (he was one of the ca but our state failed to develop and same age group. are always the trips through the tle bit of first artists Mother featured at prosper largely because most of our Chestnut was sentenced to a total of 210 downtown area at Christmas, or money for that purpose, since the Small House). people were illiterate. Beginning in to 252 months – 17.5 to 21 years – behind bars the rare funeral that requires a he expected the community to The building looked fresh and the 1850’s, we instituted a statewide and barbed wire fence. presence. But you miss the details take on the bulk of the respon- clean and vibrant, not like it did system of public schools, adding None of the jurors stayed behind to hear when you’re in a hurry. sibility. For years, for a variety when 100-year-old dust and occa- language to our Constitution that the sentencing. An alternate, removed before It was strange, to say the least, of reasons, that wasn’t the case, sionally a two-foot square piece of guarantees every child a “sound the jury began deliberating, told prosecutors to greet the Hollywood guys at the but these things happen. That has glass fell from our place upstairs. basic education.” Do we still believe that Chestnut was guilty. Sasser, assistant library (another place my mother changed in the years since Miss The mural at the end of the education should be provided by the district attorney Heath Nance, prosecuting loved) and for the producer to Lois went home. building is gone too, one change public sector? We can debate how officers, and courtroom staff were surprised lead me to the periodical section. I hadn’t been in the house since of which I approved. I understand well the task is being accomplished, with the rapidity of the verdict. The only available chairs were in the dinner after Mother’s burial; that art starts in the artist’s mind, but if we agree education is a pub- In normal cases, a quick verdict is not good front of the windows; I could have I was struck by how beautiful it but the mule in the impressionis- lic function and that our economy news for the defendant. This was the case sworn the one where I sat was had become. Even as her health tic farm scene always struck me and wellbeing depend on an edu- here, but it was good news for our law-abiding the same one I often made use of was failing, she buttonholed as looking way too much like a cated populous we must also agree citizens and law enforcement. on days when unemployment or enough bureaucrats and politi- racehorse. to adequately fund it. The same The mounting problems involving pain cabin fever or rain or a need for cians to get the preservation, if I left lonely, since the place I questions should be asked about medication and other controlled substances solitude led me to the Holliday not restoration, started when visited is a lovely downtown, but other government services. Should here involves hundreds of young residents, Library. the demon of Parkinson’s began not the one I loved. government provide clean water and the money that can be made from the sale It was in the exact same place, its inexorable theft of her mind. After a brief visit with my and sewer services, commerce and of prescription pain pills has drawn older but the trees and bushes out back I was really reluctant to do so, brother, I made my way to the environmental regulations, work- residents into the boiling pot. were different. but I would have been remiss had cemetery, both as a personal place safety controls, police and fire Some doctors are too free with pain medi- When the taping finished, I I not driven a few blocks over and pilgrimage and to check on my protection, a judicial system, jails cation. One man, arrested within the past two wandered to the Small House, gone past the home Mother and folks’ graves. and other services? months, had a prescription that called for 600 which in later years was often Papa loved so much. I wished I Far across the way, another Many of us can identify waste pain pills a month. That’s hard to imagine. identified more with Miss Lois hadn’t. family was saying goodbye; I and inadequate accountability in The defendant was selling part of them, and than with Dr. Small. The door to The trees, like so many big, wondered how many of them also the public sector and we recognize was caught in a transaction. the clinic- turned-office still sticks shambling, honest but non-aes- called Clinton home for a while, dissatisfaction resulting from those Columbus County has had more than 40 in the same way. thetic trees, are gone, replaced and only come back to visit family revelations as the basis for today’s deaths in the past five years due to accidental Miss Lisa—one of Mother’s by spindly interlopers of Brad- or to make the obligatory trip to anti-government sentiment. But or intentional overdoses of medication. Nine- protégés, now a wife and mother ford pears or some such. The the cemetery. does this mean we are unwilling to teen of them were in one year, and involved and director of the center—led ramshackle Model T garage is I wondered if they would go pay for any government services users as young as 19 to others above 40. me around a little bit while we gone; Papa’s volunteer peach by what used to be the old home and infrastructure? Two years ago this county led North Caro- talked of changes and programs. tree, which grew such delicious place, or what used to be Kaleel’s Few of us enjoy paying taxes, but lina in the number of controlled medication She was rightfully proud of the fruit that we had to guard it from sandwich shop, or what was the most recognize there is a price tag prescriptions per capita. It’s probably still a makeover to the front yard. thieves, has also disappeared. old movie theater, now the com- attached to everything we desire. very high ratio. The out-of-control gardenias, All in all, the house looked munity playhouse. Here are three questions to ask in Doctors were pumping out more than azaleas and even some of the trees like so many others of its type, I wondered if they, too, would considering the scope and cost of 165,000 such prescriptions a year – an average that once shaded the massive homogenized and modernized wonder what was waiting in the government. Are we funding the of more than three per person, aged infant to front piazza were gone, and while and turned into something a real wings of the way things were, and needs we have, through consensus, over 100. I admit it makes things look much estate agent can sell to another can never be again. identified as priorities? Are all pay- This development caught the attention of neater, it didn’t seem quite right family, whose children can en- I wondered if they also felt ing fairly and equitably for these drug users as far away as West Virginia. One for sunlight to be full and bright joy the fenced-in but unshaded that while their hometown was a services and are we getting good woman from there was caught here buying on the terraces Mother used backyard. nice town, but just didn’t feel like value for the dollars invested? We pain medication. Two others, who bought to sweep clean of pecan shells, I sincerely hope the agent home anymore. seek answers to those questions as here, were killed in a highway wreck return- individuals, families, in business ing to their West Virginia homes. and in all other aspects of our lives. Last Wednesday’s verdict and tough Why not government? Thumbs down sentencing by Sasser will send another type Te shortest river in the world Government is nothing more message. Defendants in controlled medication than a social contract. That contract cases, with no prior record, or one of little BY RAY LUNDY Beside the river is a plaque with drank its water. The expedition must determine what we want to substance, are usually offered a plea deal by Special to The News Reporter the words, “Shortest River in the had to remove their gear from the do ourselves and what we want the district attorney’s office that involves World.” river and portage 21 miles on foot our government to do for us. Every probation. On April 1, 2011, New Zealand- The headwater of the shortest to get around the five water falls generation should review and re- For every conviction of trafficking in ers Julia Bond and Courtney river is the giant spring whose on the Missouri at Great Falls. vise that contract to reflect current drugs, a fine of $50,000 is automatic. Many de- Kerin made the first descent of glacial waters run underground They arrived at the falls on June times, but that hasn’t happened on a fendants, particularly those with short or no the Roe River in their kayaks. from 60 miles away, high in the 13, 1805, and had to travel around large scale since the Constitutional prior convictions, are given an opportunity to They had studied the task and Little Belt Mountains. the falls on foot. revision of 1971. North Carolina plead to attempted trafficking. This removes danger before them, but it was a In the park, the water gushes Pulling their gear was one of has changed dramatically since the automatic fine. piece of cake. The great spring up out of the ground putting out the most hazardous events of that time so we are long overdue A couple of courtroom observers noted and the river are on the bank 338 million gallons of water per their expedition. In one day Lewis for a social contract revision. Only last Wednesday that when the news of the of the Missouri at Giant Spring day. The spring forms a large pool encountered rattlesnakes, a bear, when we decide what we want from Chestnut case got out, there would be a line of State Park. and the little river. a mountain lion, a wolverine, and government can we then determine defendants wanting to accept plea deals, and They put in and paddled gently The water bubbling out of the three buffalo bulls. All wanted to how much we are willing to pay and drop off the trial calendar. for 201 feet, and then they entered ground is a constant 54 degrees. fight. “Even the beasts seem to how to fund those services. This was already beginning to happen as the mighty Missouri River. That Radiometric dating indicates be against us...,”he commented. What’s not acceptable is to say early as 24 hours later. Career drug dealers is correct. that it takes the water from the What men they were! we want government services but are not usually given the “soft” plea deals, The Roe River is listed in The snow melt 2,900 years to travel As the airplane banked at take- refuse to pay for them. and some of their offers carry stiff penalties. Guinness Book of World Records the 60 miles through the rock to off, on our way home, I looked out Campbell is former assistant It remains to be seen if they’re willing to as the shortest river in the world the spring. A person drinking the window to see the Missouri, North Carolina State Treasurer and take their chances with a jury made up of — yes, 201 feet. the spring water is drinking pure the shortest river, the great falls is creator/host of NC SPIN, a weekly people whose eyes are open to the mounting There is a sidewalk beside the water as old as the pyramids. below, and I thought of the expedi- statewide television discussion of problem of pill abuse. tiny river, and one can walk its The Lewis and Clark Expedi- tion’s misery of portage. My, what state issues airing Sundays at 6 a.m. entire length in about 1 minute. tion saw the great spring and a difference 207 years have made. on WILM-TV. The News Reporter, Monday, September 3, 2012 11-A Can Latin fried 33rd Annual Columbus chicken beat your mother’s? Industrial Golf Tourney By D.G. MARTIN set to tee of on Sept. 14 Special to The News Reporter Golfers from across the area hour, a deluxe golf towel and are invited to participate in the a steak dinner with all the “Nothing says ‘South’ more 33nd Annual Columbus Coun- trimmings. than fried chicken,” says San- ty Industrial Golf Tournament Team prizes and many out- dra Gutierrez, who was born in sponsored once again by the standing door prizes will be the U.S., grew up in Guatemala, Greater Whiteville Chamber awarded. Many are provided and now lives in Cary. She is au- of Commerce. by area businesses. Teams are thor of “The New Southern-La- The tournament will be flighted based on the players’ tino Table: Recipes That Bring held Friday, September 14 at handicaps. Together the Bold and Beloved beautiful Land O Lakes Golf The first Hole-In-One on Flavors of Latin America and Course on Bill Hooks Road off Number 18 could send some the American South” and a re- Highway 701 in Whiteville. Co- lucky winner home with cent guest on UNC-TV’s North chairing this year’s event are a brand new automobile Carolina Bookwatch. Andy Anderson of Commu- courtesy of Quality Ford in Gutierrez celebrates the nity Innovations and Meredith Whiteville. There are lots of coming together of food cul- Jackson of BB&T. options to make the day’s play tures. As peoples from the They remind players that even more fun. various countries of South and the industrial tournament’s Players can opt for a mulli- Central America introduce us goal has been to bring busi- gan, red tee, chance to win $250 to their delicious dishes, we are ness, community, and industry in the BB&T Putting Contest learning from them, and they leaders together from around or win $250 in the Baldwin are learning from us. the area in an informal setting Woods Chipping Contest for But something more is hap- for a day of fun and fellow- $5 each or bundle all 4 for only pening, she says. Not only are ship. It is also an important $15. Players can also sign up we learning from each other, fundraiser supporting the for the Poker Hand for only we are also blending the tra- Staff photo by Mark Gilchrist many worthwhile projects of $5. Other sponsors for the ditions, and a whole new and the Chamber. tournament include: BB&T, changing regional menu is de- New exhibit The Captain’s Choice tour- CenturyLink, Columbus Re- veloping. All this is described N.C. Museum of Natural Sciences Curator of Paleontology Vince Schneider, left, nament will begin with regis- gional Healthcare System, in charming detail in “The New talks with Columbus County tourism director Jennifer Holcomb and Whiteville busi- tration at 11:30 a.m. followed International Paper, First Southern-Latino Table.” by lunch. Play will get un- Citizens Bank, McDuffie Pest She shares 150 recipes that nessman Richard Bachelor last Friday at the Lake Waccamaw State Park visitors derway with a shot-gun start Control, Columbus County illustrate what good things can center before a ribbon-cutting ceremony for a new exhibit of a three million year old at 12:45. The tournament is Farm Bureau and Farm Bu- happen when cooking methods whale skull that was found along the north shore of Lake Waccamaw four years ago. limited to the first 120 golfers reau Insurance. from one tradition are applied registered. The entry deadline is Fri- to the typical dishes of another. The entry fee of $50 in- day, Sept. 7. Call the Whiteville But “The New Southern- cludes green and cart fees, Chamber of Commerce to Latino Table” is more than a free range balls, lunch, a social register at 642-3171 cookbook. It also teaches us that not all “Latino” food cul- SCC ofers ConEd courses tures are the same. Southeastern Community will be charged 50 cents per this free seminar, participants Emergency Preparedness Month She explains that the term College’s Workforce and Com- pound. will evaluate their strengths Gov. Bev Perdue has pro- cies is before they happen,” “Latino” only exists in the munity Development Division Yoga is scheduled for Tues- and weaknesses as a future claimed September as Emer- Perdue said. “The easiest, most context of the United States. It will offer several continuing days and Thursdays, Sept. 11- owner or manager of a small gency Preparedness Month to economical way people can describes anyone with a Latin education classes and semi- Nov. 20, 4-5 p.m., in D-Building, business and determine their encourage families, businesses protect their families and busi- American heritage who lives in nars in the coming weeks. To room 106. The $59 registration potential for success. and schools to prepare them- nesses is to plan ahead, gather the United States. “Outside of pre-register or for more infor- and $1.25 insurance fee must Changes to the 2011 NEC selves for a variety of emergen- those supplies and discuss their the United States, she writes, mation, call (910) 642-7141, ext. be paid at the first meeting. Part II will be held Saturday, cies. She urged every citizen to emergency plans. Those people “you will not find ‘Latinos’ 296, 397 or 425. This course introduces stu- Sept. 15, 8 a.m-4:30 p.m., in have both an emergency plan who are better prepared will but Mexicans, Argentineans, Financial assistance with dents to Yoga practice in the T-Building, room 122. This and kit. fare better during the disaster Guatemalans, and dozens of registration fees and books classical sense, which includes course for electricians will Perdue explained that it does and recover more quickly.” their nationalities, each with to gain new employment- awareness of the breath and continue to discuss the chang- not take a major hurricane or Last year North Carolina their own nationalistic pride. related skills may be available breathing exercises, mind- es to the 2011 National Electric tornado to cause extensive dam- experienced 63 tornadoes, and We come in all different colors through the Workforce Invest- fulness meditation, and the Code. Students should bring age to a home or to disrupt nor- nearly half were during the and have very different food ment Act (WIA) and other physical postures most often a battery powered calculator, mal business operations. The statewide outbreak on April histories.” funding sources. associated with Yoga in the paper and pencil or pen. The heavy rains and severe thun- 16. In addition, there were What difference does this To see if they qualify, West. The course is open to course fee is $65 plus $10 for derstorms that struck Halifax more than 1,400 severe thun- make for this developing blend- students should contact the students of all fitness levels. class materials and lunch. The and Northampton counties in derstorms, more than 375 hail ed food culture? Columbus County JobLink Participants need to bring required textbook is National late August produced extensive storms, as well as Hurricane Gutierrez answers, “The Career Center immediately at their own Yoga mat and wear Electric Code 2011 and can be flooding in only a few hours. Irene and the remnants of key implication here is that (910)642-7141, ext. 261 or visit comfortable clothes. Yoga is purchased on site for a fee of “We all know that the best Tropical Storm Lee. the Southern-Latino movement the Center in A-Building on typically practiced barefoot $84 plus tax. time to prepare for emergen- truly represents multiple cul- the SCC campus. for comfort and safety, as socks tures imparting changes and Two classes of Introduction may slip. contributions to another. So, to Microsoft Excel 2010 will be Computer Keyboarding will for example, the new Southern- offered. One is offered Mon- meet Tuesdays, Sept. 11-Dec. 4, Latino movement is not a Mexi- days, Sept. 10-Nov. 26, 6-8 p.m., 9 a.m.-noon, in T-Building, can movement alone—as is the at the DREAM Center. The room 124. The $65 registration case of Southwestern cuisine, second is offered Tuesdays, fee must be paid at the first in which Mexican elements do Sept. 11-Nov. 27, 2-4 p.m., at meeting. This course is de- predominate. The Southern- Tabor City Fire Department. signed to develop elementary Latino movement is, rather, cat- A $65 registration fee must keyboarding skills. Emphasis apulted by immigrants whose be paid at the first meeting. is placed on mastery of the culinary contributions are as This 24-hour course covers keyboard, good techniques, multicultural and multifaceted the skills needed to create a speed and accuracy. Upon as they are.” basic spreadsheet using Excel, completion, students should Rather than a melding of a Microsoft Office applica- be able to demonstrate basic just two food cultures, it is tion. Participants will create proficiency in keyboarding. “the marriage of the culinary a spreadsheet from scratch, Cooking on a Budget is foodways of more than two generate a chart, and work scheduled for Tuesdays, Sept. dozen countries with those of with simple data-management 11-Oct. 30, 6-9 p.m., in the the entire Southern region of tools. This course is intended kitchen of the Columbus Ca- the United States.” for those who have little or no reer & College Academy in Now, back to fried chicken. experience using electronic Fair Bluff. A $65 registration Can this “marriage” of food- spreadsheets. fee must be paid at first meet- ways improve a Southern fa- Spanish for Health Care ing. The course is designed to vorite? Would Gutierrez dare Professionals will be offered teach students ways to prepare to suggest that it could? on campus in A-Building, tasty, satisfying and healthy She does. I was skeptical. room 228 on Mondays, Sept. meals on a budget. Students Now I am a believer. 10-Nov. 26, 6-8 p.m. A $65 reg- will learn how to use the To get the full recipe that istration fee must be paid at grocery store weekly specials opens the door to even better the first meeting. This course to plan meals. Throughout fried chicken than my mother is designed to help anyone in the course students will gain made, a multicultural one, you health care communicate with kitchen skills, food knowledge will have to buy the book and Spanish-speaking patients, and health tips. find the recipe for “Latin fried their family members and con- Fabulous Event Planning chicken with smoky ketchup.” cerned friends. Learn how to for the Beginner will be held But, using Gutierrez’s own communicate and understand Tuesdays, Sept. 18-Oct. 9, words I can give you enough of patients’ needs and medical 6-9p.m., in T-Building, room her directions for cooking the problems, collect medical and 122. Students will leave with chicken to make your mouth insurance information, set up an outline for implementing a water and, maybe even, make appointments, and prescribe successful event. This course you a multicultural foodie. medication. will focus on creative event Here is her description. Windows Live Movie Maker ideas, timelines, budgets and “Crispy, juicy, spicy, and moist, will meet Mondays, Sept. 10- volunteer management. The my version takes a bath in Oct. 29, 6-9 p.m. in T-Building, cost is $65. spiced-up buttermilk before room 124. The $65 registration Making Team Relation- it’s cooked. This is one of the fee must be paid at the first ships Magical will be held most requested recipes in my meeting. The course begins Wednesday, Sept. 12, 9 a.m.- cooking classes. Chicken is with a basic overview of the noon, in T-Building, room first fried, then blasted in a hot Movie Maker interface and 120. During this free seminar, oven to finish cooking, creat- quickly advances to cover attendees will learn how to get ing a crunchy exterior. This topics such as capturing im- people to listen, how to cre- cooking method prevents the ages, importing video, editing ate better relationships with spices and flour from burning movie clips, adding special customers, how to get along and allows excess fat to render effects, adding music and nar- with anyone in the workplace out. The result is chicken that ration, inserting transitions, and how to be more effective is moist but not greasy. Made and sharing movies in sales. this way, chicken can be kept Ceramics: Introduction Motor Vehicle Dealer Pre- in a warm oven for a full hour to Throwing, on the Potter’s Licensing will be held Wednes- before serving without becom- Wheel will be offered Tues- day, Sept. 12, 9 a.m.-4 p.m. and ing soggy. No more burnt coat- days and Thursdays, Sept. 11- Thursday, Sept. 13, 9 a.m.-4 ings and undercooked chicken! Oct. 9, 6-8 p.m. in D-Building, p.m., in T-Building, room 122. My secret to a crunchy crust room 111. The $64 registration This 12-hour course is for is to use self-rising instead of fee must be paid at the first those who are trying to re- all-purpose flour.” meeting. Deena Sarvis will ceive their license to become Martin hosts “North Caroli- guide students through the independent auto dealers. na Bookwatch,” which airs Fri- process of creating pottery The cost is $65 plus $5 for class days at 9:30 p.m. and Sundays from scratch. Students will materials. at 5 p.m. on UNC-TV. For more work clay on the wheel, fire, Do You Have What it Takes information or to view prior and glaze their own ceramics to Own a Business will be held programs visit the webpage at pieces. Students who choose to Thursday, Sept. 13, 6-9 p.m., in www.unctv.org/ncbookwatch take home finished products T-Building, room 122. During 12-A – The News Reporter, Monday, September 3, 2012 Native Rufus Yates named to BB&T executive team BB&T Corporation (NYSE: and chief corporate communi- BBT) has named two new cations officer of Winston-Sa- members to its executive lem-based Brand and Commu- management team. The an- nications Strategy, Williams, nouncement, which is effec- 59, leads BB&T’s corporate ad- tive immediately, is part of a vertising, marketing strategy, long-term plan to increase its sports marketing and commu- top leadership group. nications groups. A native of Rufus Yates, president and Yokohama, Japan, she joined CEO of Scott & Stringfellow BB&T in 2003 as part of the LLC and manager of BB&T First Virginia Bank merger. Capital Markets, and Cynthia She has 26 years of financial Williams, chief corporate services experience, served communications officer, will as regional branch operations join the 10 current members manager before moving to on the executive management Winston-Salem to manage Sar- team, which sets policy and banes-Oxley compliance. She direction for the corporation. has served as chief corporate BB&T last expanded its communications officer since executive management team 2009. She began her career in Tangy McAllister was happy to make it to the front of the line Friday at the Whiteville in December 2006. public accounting and later License Plate Agency. The end of the month is one of the peak times for plate renewals. “These moves position our was responsible for internal management team for the audit and retail bank sales and future,” said Chairman and administration. Chief Executive Officer Kelly Williams serves on the Business steady at plate ofce S. King. “Rufus and Cynthia boards of the Winston-Salem are both proven leaders who, Foundation and Winston- By NICOLE CARTRETTE until the local office opened. ments, suggestions and spe- along with the rest of our man- Salem State University Foun- Staff Writer Merritt said he appreciated cialty plate requests may be agement team, will continue to dation and is a member of the the support of local dealer- emailed to whitevillepa.gmail. build on our 140-year legacy Northwest Piedmont Work- The Whiteville License ships and individual custom- com. as a solid and stable financial Rufus Yates force Development Board, Na- Plate Agency (LPA) is enjoy- ers. Friday, Lyndon’s wife The office is open Monday institution.” tional Black Theatre Festival ing a steady business since Pam, co-owner and operator, through Friday from 9 a.m. A native of Chadbourn, Finance Committee, Winston- opening a few weeks ago. employees Joi Thomas and to 5 p.m. but closed for lunch Yates is the son of Glenn Yates Services LLC, BB&T’s securi- Salem Chapter of the Links A line of customers filled Misty Hodge were serving from 12:30 to 1:30 p.m. and the late Edna Yates. He ties clearing broker dealer. As Inc. and the Women’s Leader- the agency’s lobby late Friday customers at three terminals. joined BB&T as part of the executive vice president and ship Council for BB&T and afternoon, as many were hope- It has been nearly a year Southern National merger in manager of Winston-Salem- United Way of Forsyth County. ful to take care of renewals since a license plate agency 1995. A 33-year banking vet- based BB&T Capital Markets, She earned a bachelor’s and other business before the at Hill Plaza closed in Septem- Farmers Union eran, he served as a city execu- Yates is also responsible for degree in business admin- end of the month. ber 2011. A temporary office tive and managed corporate the corporate banking, loan istration from Wayne State Tangy McAllister of White- opened for a short period of September Fest banking activities before as- syndications, and interest-rate University and MBA from ville was among them. McAl- time at the Driver’s License suming his current responsi- derivative groups. James Madison University. lister said she waited about office here, but offered limited slated Sept. 15 bilities. Prior to joining BB&T, He serves on the boards She is also a graduate of the 15 minutes in line but didn’t services. he served as a chief lending of several BB&T subsidiar- ABA Stonier Graduate School mind. Columbus County resi- The Farmers Union Civic officer and managed corporate ies, including BB&T Capital of Banking. “I had to do this in Febru- dents have had to travel to Association is sponsoring Sep- relationships throughout the Partners, Sterling Capital BB&T’s other Executive ary and had to go all the way Bladen, Robeson or Bruns- tember Fest on Sept. 15 from 10 southeastern United States. Management, and Farr and Management team members to Elizabethtown,” McAllister wick counties for license plate a.m. until 5 p.m. at Spaulding “I am very pleased to be Associates. include King, Chief Operating said. personal services. Park. joining BB&T’s executive Yates serves on the High Officer Chris Henson, Presi- “I waited longer there than LPAs offer vehicle registra- Vendors are welcome to sell management team. BB&T has Point University Board of dent of Community Banking I did here. It’s not bad at all,” tion services and title transac- their goods — arts, crafts, food a long history of serving cli- Visitors and is an active mem- Ricky Brown, Chief Financial she said. tions, as well as vehicle license and such, but all soft drinks ents and growing shareholder ber of the ABA Securities As- Officer Daryl Bible, Chief Owner-operator Lyndon plate renewals, replacement will be sold by the Civic As- value, and I look forward to sociation, Securities Industry Risk Officer Clarke Starnes, Merritt said Friday had been tags and duplicate registra- sociation. The fee for booths/ being part of the bright future and Financial Markets Asso- Enterprise Risk Manager one of the busiest days. tions. Currently, about 120 tables is $25. Make checks pay- of our company,” Yates said. ciation, and U.S. Chamber of Barbara Duck, Administrative “People have been very license plate agencies via con- able to Farmers Union Civic As president and CEO of Commerce – Center for Capital Services Manager Rob Greene, kind,” Merritt said. “ We are tracts with the state operate Association. The deadline is Richmond, Va.-based Scott Markets Competitiveness. He Deposit Services Manager still learning on the go and we across North Carolina. Sept. 13. The contact person is & Stringfellow, Yates, 55, is earned his bachelor’s degree Donna Goodrich, Chief Mar- just want to make sure we get The agency is now located Clarence Spaulding, (910)646- responsible for the Private Cli- in economics at UNC Chapel keting Officer and Lending the paperwork right for the at 201 East Main Street in 4792, (910)840-4811, or cspauld- ent Group and Capital Markets Hill and holds Series 7, 66 and Group Manager Steve Wiggs people.” Whiteville and adjacent to [email protected]. activities. In addition, he over- 24 securities licenses. and Operations Division Man- He suspects a lot of people Merritt’s Sporting Goods. The park is located on Farm- sees Clearview Correspondent As executive vice president ager Leon Wilson. held off on getting things done Pam Merritt said com- ers Union Road, Clarkton. Labor Day Honda Motor BLOWOUT Clearance On Hondas! • 910.579.0752

$1000’s Below Retail 2HP • 5 HP • 9.9 HP • 15 HP • 20 HP • 25 HP • 40 HP • 75 HP • Your Full Line Crestliner Dealer Sportsman and Jons In Stock • 14ft to 18 ft 90 HP • 150 HP • 225 HP • 250 HP % Payments 2.99 As Low As99 On Honda $ Motors 99 Per Month With Approved Financing With Credit Approved Credit Prices Start At $ Jimmy’s Marine is proud to ofer Superior Service 4,499 and Certifed Warranty Center for 14 ft. Boat, Trailer, 4 stroke Honda engine • Dock Service Also Available at Lake Waccamaw Call for details Large Selection of Pre Owned Boats in ALL SIZES Consignment available for selling your boat OptiMax Now Offering Aluminum Welding & T-Top Fabrication www.jimmysmarine.com #FBDI%SJWF 0DFBO*TMF#FBDI /$t Serving All NC & SC coastal areas plus Lake Waccamaw Sports Te News Reporter, Monday, September 3, 2012 Stallions pull out victory over Loris to stay unbeaten VINEGAR HILL - Seven turnovers and a ball into the end zone and then recovered it for victory. the touchdown. The play had been set up by a The South Columbus Stallions fumbled the pass from McKever to Dashawn Daniels. football away the all over the field Friday night, Daniels carried on a successful two-point but they still managed to come away with a 16- conversion for a 16-8 lead with 11:03 left in the 14 win over longtime border rival Loris, S.C. first half. “The win is definitely a positive, but giving The only score of the second half came on a up that many fumbles is unacceptable,” said 54-yard extra-effort run to the end zone by the Stallion head coach Jake Fonvielle, whose Stal- Lions’ Levi Moody with a little more than eight lions pushed their record to 3-0. “Fortunately, minutes left in the game. our defense was able to bail us out.” The aggressive South Columbus defense and The South Columbus defense held Loris to untimely breakdowns in the Lions’s offensive Staff photo by Fuller Royal net 27 yards of total offense. It was Loris’ first execution were big factors in the outcome of Whiteville High senior quarterback Fuquon Thompson (center) turns to make a hand-off loss in three games this season. The SCHS the game. in Friday night’s home game against Pender. Thompson rushed for 159 yards and three win also avenged a 17-12 loss to the Lions last Along with its troubles of hanging on to the touchdowns in the Wolfpack’s 41-18 victory over the visiting Patriots. Other Wolfpack season at Loris. football, the Stallions were also penalized 13 players pictured are Antonio Faulk (7) and Zach Wilson (51). In between the fumbles, the two-time defend- times for 110 yards. ing Waccamaw 2A-3A Conference champion “We need to cut down on the number of South Columbus team rolled up more than 250 penalties, but we play with a lot of intensity yards of total offense. The Stallions have now and aggressiveness and sometimes the flags Strong second half propels won 14 of the 21 meetings in the annual border starting piling up.” clash. It marked the eighth straight game that In this Friday’s 7:30 p.m. road game with South Columbus had defeated the Lions on its Hoggard, the Stallions will be taking on a Hog- Wolfpack past Pender 41-18 homefield. gard team that bounced Purnell Swett 53-10 last Friday. blocked a punt. Patriots to make the score 7-2 SCHS will travel to Wilmington Friday to By DAN BISER Coach Scott Braswell’s Hoggard team opened Tyqwan McDougal added with 2 minutes, 30 seconds left take on the unbeaten 4A Hoggard Vikings. Sports Editor South Columbus, which opened its 2012 the season with a 38-14 thumping of West scoring runs of 26 and 18 in the first quarter. Brunswick and a 38-6 pounding of Fayetteville yards, finishing with 89 yards On the Wolfpack’s first pos- season with wins over East Columbus and Red Despite holding a 13-10 half- Seventy-First. on only 10 carries. session of the second quarter, Springs, fell behind in the game’s opening mo- time lead, the first 24 minutes The Stallions and Vikings will meet for The Wolfpack defense was Thompson broke a 38-yard run ments when Loris back Ryan Bellamy made a of action had mostly turned the fourth straight season. Last fall, Hoggard led by Rysheen McMillan, to the Pender 29-yard line, and dazzling 71-yard punt return for a touchdown. into a struggle for the White- defeated SCHS 42-28, In 2010, South Columbus Austin Reaves, Brian Pridgen, McDougal burst up the middle Orlin Mejia’s extra-point kick made the ville Wolfpack Friday. won 8-7, and the Stallions also won in 2009 by Algere Adams, Elgin Collier, for 26 yards and a touchdown score 7-0 with nine minutes, 50 seconds left in The second half turned a 20-6 score. Ryan Ciamillo, Adam Bastug two plays later. the first quarter. out to be entirely different as and 270-pound lineman Spen- Maggioli’s PAT attempt was South Columbus tied the score on its next the Wolfpack took charge and Loris 7 0 0 7 - 14 cer Campbell. blocked, leaving the score 13-2. possession, getting a 26-yard touchdown pass raced to a 41-18 victory over the S. Columbus 8 8 0 0 - 16 Campbell had an especially Pender then drove 81 yards from Pharoah McKever to Samuel Dixon. McK- visiting Pender Patriots. strong second half from his in 12 plays and got the score ever then ran a keeper for a two-point conver- It was the second straight L - Ryan Bellamy 71 punt return (Olin Mejia kick). defensive tackle position. on a five-yard run by Hansley. sion to give the Stallions an 8-7 victory with just win for Coach Luke Little’s SC - Samuel Dixon 26 pass from Pharoah McKever). “We played with a lot more He also ran the two-point con- over six minutes left in the opening quarter. Wolfpack and also the second SC - McKever 2 run (Dashaun Daniels run). enthusiasm and a lot more version to make the halftime South Columbus drove to another score straight week it had scored 41 L - Levi Moody 54 run (Mejia kick). confidence in the second half,” score 13-10. early in the second quarter. Fittingly, McKever points on its homefield. Little said. “I think we wore Early in the second half, ran a keeper from two yards out, fumbled the “We weren’t executing like Pender down a little bit in the Thompson blocked a Patriot we needed to and weren’t doing second half.” punt and recovered the ball a good job of tackling in the Coach Tony Hudson’s Pend- at the Pender 16. One play first half,” Little said. “Pender er squad saw its season record later, he carried the ball into was doing a good job of con- slip to 1-2. The Patriot offense the end zone from 15 yards trolling the football and we was led by the running of out. He added the two-point knew at halftime that we had Hansley, Caleb Johnson and conversion and the Wolfpack to start doing things like they Sam Dixon and the quarter- surge was on. needed to get done out there if backing of Nick Wells. Wells The fourth quarter saw we expected to win.” left the game with a leg injury Thompson score on a 15-yard- The Wolfpack defense early in the second half, but er (off his fumbled snap) and stepped up the tempo and kept later returned to action. Antonio Powell had a two-yard the Patriot attack under con- For the second straight scoring plunge and McDougal trol for most of the final two week, Whiteville took the blasted 18 yards for the final quarters. game-opening kickoff and TD. WHS senior quarterback drove it for a score. The eight- Hansley sprinted 34 yards Fuquon Thompson got plen- play drive covered 62 yards and for Pender’s second TD of the ty of mileage off the option took nine plays. Thompson night. keeper, rushing for 159 yards, broke free for a 33-yard scoring Whiteville will travel to including touchdown runs of run on a third-down snap to take on East Columbus Fri- 33, 15 and 24 yards. His last TD put the Wolfpack ahead to stay. day at 7:30 p.m., at Lake Wac- run came after he fumbled the Gerardo Maggioli kicked camaw. East Columbus has snap. He picked the ball up and the extra point for a 7-0 White- beaten the Wolfpack in each sprinted through the middle, ville lead with four minutes of the past two seasons. cut to his left and into the end gone in the game. zone. A Pender punt to the two- Thompson also scored on a See Wolfpack on 2B yard line set up a safety for the two-point conversion run and Vikings tame Wildcats NEWTON GROVE - West Columbus High lead to 14-6. senior Ethan Morris returned a pass intercep- Hobbton rang up two quick touch- Photo by Deuce Niven - Tabor-Loris Tribune tion 69 yards for a touchdown in the game’s downs midway through the third quarter South Columbus back Reggie Frink tries to break a tackle as he heads to the open feld final seconds Friday night to seal a 32-24 on a 24-yard scamper by Barksdale and in Friday night’s high school football battle with longtime rival Loris, S.C., at South non-conference football victory over the host another four-run by Davis to make the Columbus. South Columbus claimed a 16-14 win to put its season record at 3-0. SCHS Hobbton Wildcats. score 18-14. lineman Daniel Buck (75) is also pictured on the play. Coach Jake Fonvielle’s Stallions It marked the first win of the season for West Columbus regained the lead 20-14 West Columbus, which also got a 34-yard late in the third quarter on a five-yard run will travel to Wilmington Friday to take on the unbeaten 4A Hoggard Vikings. touchdown pass reception by Morris and a by Dawson, but Hobbton battled back on three-touchdown rushing effort by Savon a one-yard run by A. Owens early in the Dawson. fourth quarter to give the Wildcats their The loss left both teams with 1-2 records. 24-20 advantage. Gators thump N. Brunswick First year WCHS Coach Mark Little said “I’m pleased that our guys stayed with his Viking squad gave a good effort in coming it and kept playing hard,” Little said. LELAND - Elijah Gresham John Mitchell. It gave East ter when he leaped high for the away with the win. “That turned out to be a key in getting and Tarrin Manning returned Columbus a 20-0 lead. 13-yard pass from Young for the “We changed some things around on the late interception return.” first-half pass interceptions for The game had originally touchdown. defense and made a few switches on offense West Columbus finished the night with touchdowns Friday to help spur been scheduled to be played Young completed four of that helped us out tonight,” said Little, whose 205 yards rushing and 90 yards passing the East Columbus Gators to at the East Columbus, but was seven pass attempts for 45 squad trailed the host Wildcat team 24-20 with while Hobbton had 227 yards rushing and a 20-6 non-conference football switched to North Brunswick yards and added 44 yards rush- less than three minutes left in the game. 77 yards passing. victory over longtime rival because of wet field conditions ing on 10 carries. Nick McClure Dawson scored his third touchdown of the The Vikings will play their third North Brunswick. at ECHS. rushed 13 times for 60 yards. night on a 26-yard run with two minutes and straight road game Friday when they are East Columbus had a total East Columbus got its first Senior linebacker Henry three seconds left for a 26-24 lead. scheduled to travel to Monroe to take on of four interceptions for the score when Gresham came up Baldwin had another big night The Hobbton offense quickly battled back, Central Academy. evening and did not allow a with a low pass to the right flat defensively for the Gator squad. moving the ball into Viking territory. North Brunswick score until and sprinted 30 yards for the It was the first loss of the But Morris latched on to a pass by Hobbton W. Columbus 6 8 6 12 - 32 the fourth quarter. touchdown. season for Coach Garry Bish- quarterback Z. Barksdale at the WCHS 31-yard Hobbton 0 6 12 6 - 24 “It was an outstanding ef- Later in the first half, Man- op’s Scorpion squad, which had line and sped all the way to the goal line for fort by our defense,” said Ga- ning picked off another Scor- opened the season with wins the game-clinching points with three seconds WC - Savon Dawson 10 run (PAT failed). tor Head Coach Toby Kasell, pion pass. After having the ball over Pender and Heide Trask. left on the clock. WC - Ethan Morris 34 pass from Harvey whose Gators won their second knocked from his hands, Man- East Columbus will play West Columbus jumped to a 6-0 lead mid- Lesane (Lesane run). straight game to put their ning recovered and sprinted 60 host to the Whiteville Wolfpack way through the first quarter, and increased H - R. Davis 4 run (PAT failed). season record at 2-1. “We got yards for another Gator score. Friday night at 7:30 in a big its lead to 14-0 with 3:23 left in the second H - Z. Barksdale 24 run (PAT failed). after the football all night and Young ran a quarterback keep- intra-county match-up. quarter on the 34-yard touchdown pass from H - R. Davis 4 run (PAT failed). came up with some big plays. er for the two-point conversion East Columbus pounded Harvey Lesane to Morris. Lesane executed a WC - Dawson 5 run (PAT failed). The interceptions really gave that gave East Columbus the the Wolfpack 48-14 last season successful two-point conversion run. H - A. Owens 1 run (PAT failed). us a lift.” 14-0 lead it held at halftime. and took a 20-6 victory over the Hobbton got on the scoreboard with 21 WC - Dawson 7 run (PAT failed) East Columbus got its other Mitchell made his third WHS squad in 2010. seconds left in the half on a four-yard run by WC - Morris 69 int. return. score on 13-yard second half touchdown reception in as R. Davis. The score cut the Viking halftime pass from Derreck Young to many games in the third quar- 2B - The News Reporter, Monday, September 3, 2012 Vike booters take 3-2 win over Swett PEMBROKE - Brandon Scott kicked in the game- winning goal with less than 1-1/2 minutes remaining to lift the West Columbus Viking boys soccer team to a 3-2 road win over 4A Purnell Swett oon Thursday. It was the second goal of the game for Scott. Jamal Mc- Millian scored the other goal for the Vikings, who put their season record at 1-2. Goalkeeper Austin Red- wine had eight saves for Coach Adam Boyd’s Vikings, who will play host to Boys and Girls Homes Tuesday and White- ville Wednesday. Both matches are set to begin at 5 p.m. Summertime Grizzly Staff photo by Fuller Royal Ronald Thompson, a former baseball standout at West Whiteville High defenders Rysheen McMillan (25) and Algere Adams (right) down Pender High quarterback Nicky Wells in Friday night’s non-conference football game at Legion Columbus High School and Southeastern Community JV football Stadium. Whiteville won the game 41-18. Coach Luke Little’s Wolfpack will play East College, played for the Gastonia Grizzlies of the Coastal Thursday’s results Columbus Friday night at East Columbus. Plains League this summer. Thompson, who earned All-Region 10 honors at Southeastern this past season West Columbus 42 and helped pace the Rams to the 2011 National Junior Hobbton 0 701 Bowling College Athletic Association Division II World Series in MONDAY NIGHT MIXED South Columbus24 Enid Okla., is set to play the next two seasons for the AUGUST 27 Loris 16 North Carolina Central University baseball team. The W-L Triple D’s 5-0 son of Ronell and Patricia Thompson of Chadbourn is North Brunswick 35 701 Lanes 4-1 East Columbus 6 an outfelder. Untouchables 4-1 Fantastic 4 4-1 Team 6 1-4 Split Personality 1-4 Team Destruction 0-5 MEN Top Scratch Games:Jimmy Ev- ans, 204; Kim Manley, 195; Josh Simmons, 190; John Puckett, 190. Top Scratch Series: Jimmy Ev- ans, 571; John Puckett, 5325; L.J. Dan Frink Sr., 504; Jeff Barker, 499. WOMEN Top Scratch Games: Sherry Biser Manley, 198; Marsha Frink, 152; Iris Freeman, 144; Pat Ridgeway, 133. Top Scratch Series: Sherry Man- ley, 527; Iris Freeman, 401; Marsha Frink, 398; Pat Ridgeway, 387.

WEDNESDAY MORNING SENIORS AUGUST 29 W-L Roby Os 23-7 Hurricanes 21-9 Road Runners 18-12 Mac Attack 17-13 Two Ships 17-13 Pressing On 13-17 High Rollers 13-17 Beware 12-28 Golden Girls 8-22 Wannabees 8-22 MEN Top Scratch Games: Albert Brown, 189; Mac McDowell, 182; John Worthington, 158; Carlton Whiteville High tennis player Ashlyn Cox returns a net shot during a doubles match Crawley, 153. against West Brunswick last Thursday at the Whiteville High courts. In background is Top Scratch Series: Albert Crystal Cecil photo doubles partner Meredith Thompson. Cox and Thompson won the match as Whiteville Brown, 527; Mac McDowell, 472; went on to defeat West Brunswick 7-2. East Columbus senior linebacker Henry Baldwin comes John Worthington, 451; Charlton up with one of four pass interceptions made by the Gators Crawley, 427. in their 20-6 Friday night football victory over the North WOMEN Top Scratch Games: Vivian Brunswick Scorpions at Leland. The Gators are now car- Lady Wolfpack netters defeat. W. Brunswick Lawson, 174; Augusta Burnett, 154; rying a 2-1 record and they will play host to the Whiteville Pat Roby, 149; Lillian Crawley, 136. Wolfpack Friday night at 7:30. Top Scratch Series: Augusta The Whiteville High School High (W) def. Rachel Norton, 6-0, def. Murray-M.High, 8-5; C. High- Burnett, 417; Vivian Lawson, 393; girls tennis team opened Wac- 6-1; Maleah Murray (W) def. Victoria Washington (W) def. Harmon-Jones, Pat Roby, 392; Sarah Shipman, 362.1 camaw 2A-3A Conference play Jordan, 6-2, 6-1; Margaret High (W) 8-1; Thompson-Ashlyn Cox (W) def. Thursday with a 7-2 win over def. Sarah Harmon, 6-1, 6-1; Madison Jordan-Carter, 8-0. visiting West Brunswick. Hege (W) def. Anna James, 6-3, 5-7, Results follow: 10-7; Kianna Washington (W) def. Haley Grimes, 6-3, 6-1. Exhibition: Meredith Thompson (W) def. Haley SEPTEMBER Whiteville 7, W. Brunswick 2 Singles: Penny Watts (WB) def. Carter. Fairness... Doubles: Watts-Norton (WB) Olivia Butler, 3-6, 6-5, 10-7; Carly We’ve chosen the SPECIALS automobile business for our livelihood. We think it SCHS drubs West Bladen 6-3 Open 7 Days A Week is a good and honorable DUBLIN - The South Co- Tanner (WB) def. Anna Naughton, lumbus High School girls ten- 6-3, 6-2: Hanna Dowless (WB) def. business. We’ve been in nis team handed West Bladen Elizabeth Buffkin, 6-1, 6-0; Kendar it for a long time and Prices Good its first loss of the season Taylor (SC) def. Josie Ludlum, 6-4, September 1-30, 2012 work hard at it every day. by a 6-3 score Thursday in a 6-0; Abby Leonard (SC) def. Nicole Waccamaw 2A-3A Conference Nye, 6-3, 6-4; Dericka Spivey (SC) We refuse to do anything tennis match. def. Alica Avellanda, 3-6, 6-2, 11-9. that would jeopardize the Results follow: Doubles: Koonce-Naughton Red Bull Zero Frank’s Ice Gatorade (SC) def. Storms-Tanner, 8-1; Dow- business we’ve built and S. Columbus 6, W. Bladen 3 less-Nye (WB) def. Buffkin-Spivey, the reputation we’ve 12 Oz. Cans 10 Lb. Bag 32 oz. Singles: Jaclyn Koonce (SC) 8-3; Taylor-Leonard (SC) def. Lud- come to have in the lum-Whitney Nye, 8-2. def. Lexi Storms (WB), 6-4, 6-1; Erica area. That’s why “fair- ness” is such an impor- W - Fuquon Thompson 33 run 2/$ ¢ 2/$ (Gerardo Maggioli kick). tant word to us. Wolfpack P - Safety. WHS player tackled in end zone We know that unless The Gators bumped North W -Tykwan McDougal 26 run (kick 5 Brunswick 20-6 Friday to put you’re treated fairly, you 99 3 blocked). their record at 2-1. P- Devin Hansley 5 run (Hansley won’t be satisfied; you P W run). won’t recommend us to Dale Jr. Pepsi Cheerwine WCHS girls First downs 11 9 W - Thompson 15 run (Thompson Rushes-yards 58-267 36-286 run). your friends; you won’t 44 oz. Fountain Drink 16 oz. Products 20 oz Singles tennis practices Yards passing 0 0 W - Thompson 24 run (kick failed). come back . . . and we Passes 0-6-0 0 W - Antonio Powell 2 run (Mag- Fumbles 1-1 4-2 gioli kick). won’t continue in the car Penalties-yards 10-50 7-60 W - McDougal 18 run (Maggioli business! It’s that simple. Punts-avg. 2-33.5 1-26 kick) $ 39 2/$ 2/$ 50 P - Hansely 34 run (Hansley run). Pender 2 8 0 8 - 16 Whiteville 7 6 8 20 - 41 SHORT 1 2 2 Smith Foundation Breakfast set BROS. Sam’s Pit Stop The Leo Smith Foundation fast on Saturday, Sept. 8, AUTO SALES WHITEVILLE - 2 Locations: 503 Jefferson Street & 1707 South Madison Street in conjunction with the Tri- at 9 a.m.. at the Whiteville 642-6543 BOLTON: 1128 Green Swamp Road • HALLSBORO: 4236 Sam Potts Hwy. County Sports Hall of Fame Board of Education build- • DELCO: Hwy. 74-76 • LAKE WACCAMAW: Old Hwy. 74, across from post offce will have a fund-raiser break- ing. Hwy. 701 - South of Wal-Mart • CHADBOURN: 101 Strawberry Blvd. -The News Reporter, Whiteville, North Carolina, Monday, September 3, 2012 The News Reporter Scheduling a community event? TV EVENING VIEWER Check out our 24-hour WUNC-TV Sept. 3 - 9, 2012 Community Calendar at:Whiteville 8:00 8:30 9:00 9:30 10:00 10:30 11:00 11:30 Monday Antiques Road. Mobile, AL Market Warr. Brimfeld, MA Antiques Road.Phoeniz, Az As Time Goes BBC WN .com Tuesday PBS Convention Coverage - A Newshour Special Report - Democratic Convention Keeping Up BBC WN Whiteville Wed. PBS Convention Coverage - A Newshour Special Report - Democratic Convention Yes, Minister BBC WN Thursday PBS Convention Coverage - A Newshour Special Report - Democratic Convention Are you being BBC WN Friday Wash.Week NC Weekend NC People NC Bookwatch Great Perfor. P. McCartney Bluegrass BBC WN Saturday Ed Sullivan’s Top Performers 1966-1969 (My Music) Joe Bonamassa: Beacon Theatre R.Steves Sunday Great Perf. Jackie Evancho: Judy Collins Live at the Met. Mus. of Art Eastenders Friday Evening September 7, 2012 8:00 8:30 9:00 9:30 10:00 10:30 11:00 11:30 12:00 12:30 WWAY/ABC Stand Up to Cancer 20/20 Local Nightline Jimmy Kimmel Live Monday Evening September 3, 2012 WILM/CBS Stand Up to Cancer CSI: NY Blue Bloods Local Late Show Letterman Ferguson 8:00 8:30 9:00 9:30 10:00 10:30 11:00 11:30 12:00 12:30 WECT/NBC Stand Up to Cancer Grimm Dateline NBC Local Tonight Show w/Leno J. Fallon WWAY/ABC Bachelor Pad Castle Local Nightline Jimmy Kimmel Live WSFX/FOX Stand Up to Cancer Bones Local WILM/CBS How I Met Big Bang 2 Broke G Mike Hawaii Five-0 Local Late Show Letterman Ferguson Cable Channels WECT/NBC Stars Earn Stripes Grimm Local Tonight Show w/Leno J. Fallon A&E Coma Coma Coma WSFX/FOX Hotel Hell Local DISC Yukon Men Bering Sea G. Yukon Men Bering Sea G. Yukon Men Cable Channels DISN ANT Farm Jessie Phineas Gravity ANT Farm Good Luck Code 9 Jessie Good Luck ANT Farm A&E Storage Storage Coma Coma Coma ESPN NASCAR Racing Baseball Tonight SportsCenter SportsCenter DISC American Chopper American Chopper Fast N' Loud American Chopper Fast N' Loud FAM Princess Princess Diaries 2 The 700 Club Prince Prince DISN Shake It Up! Shake It Vampire Phineas Jessie ANT Farm Wizards Wizards FOOD Diners Diners Diners Diners Diners Diners Diners Diners Diners Diners HGTV ESPN College Football SportsCenter SportsCenter Kitchen Kitchen Kitchen Cousins Hunters Hunt Intl Hunt Intl Hunt Intl Kitchen Cousins HIST American Pickers American Pickers American Pickers American Pickers American Pickers FAM Switched at Birth Sweet Home Alabama The 700 Club Prince Prince NICK Victoriou Victoriou Friends Friends Friends Friends Friends Friends Friends Friends FOOD Diners Diners Diners Diners Diners Diners Diners Diners Diners Diners SPIKE Without a Paddle Super Troopers Gangland Gangland HGTV Love It or List It Love It or List It Hunters Hunt Intl Love It or List It Love It or List It TBS Stand Up to Cancer Worse Worse Worse Worse Daddy's Little Girls HIST Pawn Pawn American Pickers Pawn Pawn Cnt. Cars Cnt. Cars Pawn Pawn TCM Birdman of Alcatraz Cell 2455, Death Row Convicts NICK ET Extra-Terr. George George Friends Friends Friends Friends TLC Say Yes Say Yes Say Yes Say Yes Gown Gown Say Yes Say Yes Gown Gown SPIKE Jurassic Park III Jurassic Park Jurassic Park III TNT Inglourious Basterds Braveheart TBS Fam. Guy Fam. Guy Fam. Guy Fam. Guy Fam. Guy Fam. Guy Conan Office Office TRAV Ghost Adventures Ghost Adventures The Dead Files The Dead Files Ghost Adventures TCM The Palm Beach Story My Brilliant Career Shadows in Paradise USA Law & Order: SVU Law & Order: SVU Law & Order: SVU CSI: Crime Scene CSI: Crime Scene TLC Little People Bates Bates 19 Kids and Counting Little People Bates Bates WGN How I Met How I Met How I Met How I Met WGN News at Nine Funniest Home Videos Chris Chris TNT Major Crimes Major Crimes Perception Major Crimes Perception Premium Channels TRAV No Reservation No Reservation No Reservation No Reservation No Reservation HBO Stand Up to Cancer Stand Up to Cancer Real Time/Bill Maher Real Time/Bill Maher Hard Knocks USA WWE Monday Night RAW Fast & Furious MAX Collateral Strike Back Skin-Max Strike Back Erotic WGN Funniest Home Videos Funniest Home Videos WGN News at Nine Funniest Home Videos Chris Chris SHOW Stand Up to Cancer Our Idiot Brother The Big Lebowski Weeds Premium Channels ©2009 Hometown Content, listings by Zap2it HBO Real Time/Bill Maher The Dilemma Hard Knocks 24/7 Boxing MAX Strike Back Strike Ba Strike Back Strike Back Cowboys & Aliens SHOW Twil: Eclipse Weeds Web Ther. Weeds Web Ther. Blitz $ ©2009 Hometown Content, listings by Zap2it 45.00/year Tuesday Evening September 4, 2012 Take us for a year. 8:00 8:30 9:00 9:30 10:00 10:30 11:00 11:30 12:00 12:30 642-4104 WWAY/ABC Middle Last Man Happy Apt. 23 Convention Local Nightline Jimmy Kimmel Live WILM/CBS NCIS NCIS: Los Angeles Convention Local Late Show Letterman Ferguson HOME DELIVERY WECT/NBC America's Got Talent Convention Local Tonight Show w/Leno J. Fallon WSFX/FOX Hell's Kitchen MasterChef Local WHERE Cable Channels The News Reporter AVAILABLE A&E Coma Coma Coma DISC Yukon Men Yukon Men Bering Sea G. Yukon Men Bering Sea G. DISN Spy Kids Gravity Code 9 Austin Vampire Phineas Jessie ANT Farm Wizards Wizards ESPN MLB Baseball MLB Baseball Saturday Evening September 8, 2012 FAM Hill Nannies Hill Nannies Hill Nannies The 700 Club Prince Prince 8:00 8:30 9:00 9:30 10:00 10:30 11:00 11:30 12:00 12:30 FOOD Cupcake Wars Chopped Chopped Chopped Chopped WWAY/ABC NASCAR Racing Local HGTV Love It or List It Property Property Hunters Hunt Intl Million Million Property Property WILM/CBS '12 U.S. Open 48 Hours Mystery Local HIST Pawn Pawn Top Gear Cnt. Cars Cnt. Cars Top Gear Pawn Pawn WECT/NBC Grimm Saving Hope Law & Order: SVU Local Saturday Night Live NICK Friends Friends Friends Friends Friends Friends Friends Friends Friends Friends WSFX/FOX College Football Touch Biased Local Cable Channels A&E Independence Day Storage Storage Independence Day DISC Fast N' Loud Texas Car Wars American Chopper Texas Car Wars American Chopper DISN Vampire ANT Farm Good Luck Jessie ANT Farm Vampire Shake It Jessie Austin Phineas SPIKE Bar Rescue Bar Rescue Bar Rescue Bar Rescue Rescue ESPN College Football Score College Football TBS Big Bang Big Bang Big Bang Big Bang Big Bang Big Bang Conan Office Office FAM A Bug's Life A Bug's Life Willy Wonka TCM Mr. Blandings High Society Somebody Up FOOD Chopped Chopped Chopped Iron Chef America Chopped TLC High School Moms 19 Kids 19 Kids Abby Abby High School Moms 19 Kids 19 Kids HGTV Love It or List It Love It or List It Hunters Hunt Intl Hunters Hunt Intl Love It or List It TNT Bones Bones Bones CSI: NY CSI: NY HIST Pawn Pawn Pawn Pawn Pawn Pawn Pawn Pawn Pawn Pawn TRAV Mysteries-Museum Mysteries-Museum Toy Hntr Toy Hntr Bizarre Foods Mysteries-Museum NICK How to Rock You Gotta iCarly Friends Friends Friends Friends Friends Friends USA Law & Order: SVU White Collar Covert Affairs Royal Pains White Collar WGN How I Met How I Met How I Met How I Met WGN News at Nine Funniest Home Videos Chris Chris Premium Channels HBO Hop Hard Knocks Hard Knocks Unknown MAX Point Break Hall Pass SHOW Weeds Web Ther. Larry Wilmore's Katt Williams Weeds Gigolos The Real L Word SPIKE Super Tro MacGruber Stripes ©2009 Hometown Content, listings by Zap2it TBS Big Bang Big Bang Madea Goes to Jail How Stella Got Her Groove Back TCM The Goodbye Girl Bachelor-Bob. TLC 9/11 Emergency Room 9/11: Heroes 9/11 Emergency Room 9/11: Heroes Like us on Facebook TNT Saving Private Ryan Flags of Our Fathers TRAV Ghost Adventures Ghost Adventures Ghost Adventures Ghost Adventures Ghost Adventures USA NCIS NCIS NCIS CSI: Crime Scene CSI: Crime Scene WGN Funniest Home Videos Funniest Home Videos WGN News at Nine Funniest Home Videos Chris Chris Premium Channels www.facebook.com/thenewsreporter HBO Extremely Loud Boxing 24/7 MAX Jaws Strike Back The Hangover Part II Wednesday Evening September 5, 2012 SHOW Jay Mohr: Funny Boxing Access Weeds Gigolos 8:00 8:30 9:00 9:30 10:00 10:30 11:00 11:30 12:00 12:30 ©2009 Hometown Content, listings by Zap2it WWAY/ABC Middle Suburg. Mod Fam Suburg. Convention Local Nightline Jimmy Kimmel Live WILM/CBS Big Brother Criminal Minds Convention Local Late Show Letterman Ferguson WECT/NBC Football NFL Football Local Tonight Show w/Leno WSFX/FOX So You Think Local Cable Channels A&E Storage Storage Storage Storage Hoggers Hoggers Hoggers Hoggers Storage Storage CLASSIFIEDS SELL! DISC American Guns American Guns Dirty Jobs Down American Guns Dirty Jobs Down DISN Shake It Spy Kids 3: Game Over Austin Phineas Jessie ANT Farm Wizards Wizards Call 642-4104 to be included in The News Reporter’s Classifieds. ESPN World/Poker World/Poker Baseball Tonight SportsCenter SportsCenter FAM Pretty Woman My Best Friend's The 700 Club Prince Prince Sunday Evening September 9, 2012 FOOD Restaurant: Im. Restaurant: Im. Restaurant Stakeout Restaurant: Im. Restaurant: Im. 8:00 8:30 9:00 9:30 10:00 10:30 11:00 11:30 12:00 12:30 HGTV Property Brothers Buying and Selling Hunters Hunt Intl Property Brothers Buying and Selling WWAY/ABC Once Upon a Time Once Upon a Time Once Upon a Time Local HIST Cajun Pwn Cajun Pwn Cajun Pwn Cajun Pwn American American American American Cajun Pwn Cajun Pwn WILM/CBS Big Brother The Good Wife The Mentalist Local NICK Friends Friends Friends Friends Friends Friends Friends Friends Friends Friends WECT/NBC Football NFL Football Local Dateline NBC SPIKE Auction Auction Auction Auction Auction Auction Auction Auction Auction Auction WSFX/FOX Simpsons Simpsons Fam. Guy Fam. Guy Local TBS Family Guy Fam. Guy Big Bang Big Bang Big Bang Conan Sullivan Office Cable Channels TCM To Have and Have Not The Big Sleep Dark Passage A&E Storage Storage Storage Storage Storage Storage Storage Storage Storage Storage TLC Honey Honey Honey Honey Honey Honey Honey Honey Honey Honey DISC Survivorman Ten Days One Car Too Far MythBusters One Car Too Far MythBusters TNT The Mentalist The Mentalist The Mentalist CSI: NY CSI: NY DISN Austin Adventures of Sharkboy Jessie Austin Gravity ANT Farm Wizards Wizards TRAV Man, Food Man, Food Toy Hntr Toy Hntr Sandwich Paradise Man, Food Man, Food Toy Hntr Toy Hntr ESPN MLB Baseball SportsCenter SportCtr USA NCIS Royal Pains NCIS NCIS Royal Pains FAM The Incredibles The Incredibles J. Osteen Ed Young WGN Funniest Home Videos Funniest Home Videos WGN News at Nine Funniest Home Videos Chris Chris FOOD Premium Channels Cupcake Wars Food Truck Race Iron Chef America Restaurant Stakeout Food Truck Race HGTV Buying and Selling Property Brothers Handyman Holmes Inspection Property Brothers HBO Dinner 24/7 Horrible Bosses Real Time/Bill Maher Black Swan HIST American Pickers Ice Road Truckers Ice Road Truckers America's Book American Pickers MAX The Terminal Crazy, Stupid, Love. Dirty Blondes NICK Friends Friends Friends Friends Friends Friends Friends Friends Friends Friends SHOW Traffic Access Weeds The Mechanic Fubar SPIKE Bar Rescue Bar Rescue Flip Men Flip Men Bar Rescue Bar Rescue ©2009 Hometown Content, listings by Zap2it TBS I Can Do Bad I Can Do Bad TCM A Walk in the Sun Les Misérables Sea Hawk Thursday Evening September 6, 2012 TLC Medium Medium Medium Medium Breaking Amish Medium Medium Breaking Amish 8:00 8:30 9:00 9:30 10:00 10:30 11:00 11:30 12:00 12:30 TNT Gran Torino Leverage Leverage Gran Torino WWAY/ABC Wipeout Rookie Blue Convention Local Nightline Jimmy Kimmel Live TRAV Man v Fd Man v Fd Man v Fd Man v Fd Manliest Restaurants Hot Dog Paradise Man v Fd Man v Fd WILM/CBS Big Bang Two Men Big Brother Convention Local Late Show Letterman Ferguson USA Law & Order: SVU Law & Order: SVU Law & Order: SVU White Collar Law & Order: SVU WECT/NBC America's Got Talent Convention Local Tonight Show w/Leno J. Fallon WGN How I Met How I Met How I Met How I Met News/Nine Replay The Unit Monk WSFX/FOX Raising New Girl Glee Local Premium Channels Cable Channels HBO Extremely Loud Bridesmaids Real Time/Bill Maher What Nbr A&E The First 48 The First 48 The First 48 The First 48 The First 48 MAX Underworld The Hangover Part II DISC Property Wars Auction Auction Texas Car Wars Auction Auction Texas Car Wars SHOW Dexter Homeland Weeds Web Ther. Weeds Web Ther. The Real L Word DISN Shake It 16 Wishes Jessie Phineas Jessie ANT Farm Wizards Wizards ©2009 Hometown Content, listings by Zap2it ESPN College Football SportsCenter SportsCenter FAM Mulan Mulan The 700 Club Prince Prince FOOD Chopped Chopped Extreme Chef Food Truck Race Chopped HGTV Buying and Selling You Live in What? Hunters Hunt Intl Abroad Hunt Intl You Live in What? HIST Pawn Pawn Pawn Pawn Cnt. Cars Cnt. Cars Great Lake Warriors Pawn Pawn Now you can NICK Friends Friends Friends Friends Friends Friends Friends Friends Friends Friends SPIKE iMPACT Wrestling UFC Unleashed MMA Ways Die Ways Die Ways Die TBS Fam. Guy Fam. Guy Big Bang Big Bang Sullivan Big Bang Conan Sullivan Office Check your TCM Comrades Kodak Grocery Life Barney Speed Knockout The Great Toe Mystery TLC Say Yes Say Yes Four Weddings Four Weddings Four Weddings Four Weddings TNT The Mentalist The Mentalist The Mentalist CSI: NY CSI: NY TRAV Toy Hntr Toy Hntr Trip Flip Trip Flip Extreme Tours Waterprks Waterprks Trip Flip Trip Flip local listings at: Whiteville USA NCIS NCIS NCIS Covert Affairs He's Just Not WGN How I Met How I Met How I Met How I Met WGN News at Nine Funniest Home Videos Chris Chris .com Premium Channels Whiteville HBO Harry Potter-Sorcerer's Hard Knocks 24/7 Road Cathouse Real Sex The Change-Up MAX The Bone Collector Man on Fire Sexy SHOW Lara Croft-Life The Real L Word Gigolos The Real L Word Gigolos ©2009 Hometown Content, listings by Zap2it 4B - The News Reporter, Monday, September 3, 2012 Sell it, find it...in the Classifieds NOTICES 180 Farm Supplies AUTOMOTIVE 435 Water Front Homes 010 Found 190 Farm Equipment 320 Cars 440 Commercial 020 Lost 200 Computers/Software 330 Trucks 460 Lots 030 Personals 210 Heaters & Firewood 335 Vans & SUVs 470 Land 060 Special Notices 230 Miscellaneous 340 Vehicle Accessories 480 Farms WANTED 240 Produce 350 Travel Trailers 490 Auctions 360 Motorcycles 070 Wanted To Buy EMPLOYMENT RENTALS 365 ATVs SELLIn theYOUR classifeds... HOME 080 Wanted To Rent 250 General Employment 500 Houses SALE ITEMS 255 Drivers & Delivery MARINE 510 Resort Homes 370 Boats 085 Auctions 260 Health/Medical 520 Apartments 375 Jet Skis 090 Lawn Mowers 270 Employment Wanted 530 Manufactured Housing $ 95 100 Pets & Animals 380 Trailers 540 Condominiums 110 Appliances SERVICES 390 Motors 550 Rooms 120 Antiques 275 Financial Services 400 Accessories 570 Commercial Your ad runs29 3 times (twice in the News Reporter, and SAMPLE 130 Yard & Garage Sales 280 Child Care REAL ESTATE 580 Land once in the News Times) and reaches practically all the 140 Clothing 290 Business Opportunities 590 Equipment households in Columbus County. It’s working for others; 2000 Redman Silverlake double- 295 Schools/Institutions SALES 150 Furniture 410 Permanent Homes 600 Farms why not give it a try? wide. 1680 sq. ft. Wind Zone 2. To 160 Musical Items 300 Insurance 420 Manufactured Housing 610 Manufactured be moved. $30,000.00 or best offer. 170 Televisions, Satellites 310 Business Services 430 Resort Homes Housing Lots Serious inquiries 910-840-4107. 315 Farm Services Call 642-4104 Te News Reporter www.whiteville.com CLASSIFIEDS Simple To Pay! Don’t Wait To Call... CORRECTIONS "  Persons should check their adver-  All major credit cards accepted Monday tisement for accuracy the frst time it as well as Visa debit cards. appears in the newspaper so that any  "  Deadline: Friday, 2 pm necessary changes can be made. The 642-4104 newspaper will not be liable for mis- "  #!!!!   Thursday takes in an ad beyond the frst issue. Deadline: Wednesday, 10 am If a mistake is found, please notify  !   WANDA or HANNE at 642-4104.

SERVICES

FREE KITTENS need loving homes. TAX PROFESSIONALS TRAINING. All shots, dewormed & litter trained. 230 Miscellaneous Empower yourself with a clearer EVERGREEN BEHAVIORAL 15wks 803-427-3712 Cerro Gordo understanding of taxes in our Tuition MANAGEMENT, Inc. !BUYING JUNK CARS, trucks, vans Free Tax School. JOB opportuni- is currently recruiting for the following & tractors. Paying top $$ for anything. MINIATURE DACHSHUND PUP- CHICKENS FOR SALE. Polish Crest- ties after completion of course! 910- positions for our Whiteville location: Pick up free 24/7. (910) 770-3131. PIES FOR SALE. Call 910-642-8575. ed Top Hats. Call 910-770-3526 640-1274 Small fee for books and materials. CORBETT TIMBER COMPANY Day Treatment Program Director DEER CORN FOR SALE. $6 per bag. Medical Receptionist Buyers of land and timber. We buy Maxx Douglas 910-640-9004 or 910- pine saw timber, hardwood saw tim- Certified Medical Assistant (CMA) 654-4258. Part-Time Job Coach ber, and pulpwood - 5 acres or great- BED 2 PC, BRAND NEW. Full mat- er. Call days 642-2909. ACTT Para-Professional tress sets $99. Queen $109. King DELIVERY DRIVERS NEEDED. Evergreen Behavioral Management, I BUY/TOW Junk Cars $175-600. $189. Can deliver. Call 910-794-4111. Class B CDL permit or license LOWER CAPE FEAR HOSPICE Inc. is currently recruiting for the fol- I Tkae free junk metal, appliances. Dealer. required for local deliveries. & LIFECARECENTER lowing positions for our Evergreen, MUSCADINE GRAPES by the bush- No overnights. References required, Open 24/7. Call now 910-385-8585 SOLID OAK DINING ROOM suite, THE LARGEST HOSPICE NC location: el or half bushel. 910-840-2336 must be neat in appearance, have a 8 chairs and lighted china cabinet. AGENCY IN SOUTHEASTERN Supervisor In Charge (Preferred current 7 year DMV report. Must have $1,200. 910-914-1384 NORTH CAROLINA candidates will be: DHHS 080 Wanted to Rent OKRA FOR SALE fresh daily, 5 lb or a criminal background check. Drivers HAS THE FOLLOWING Certified Medication Aide & 100 lbs. Call Allen 910-654-4381 or will be drug tested. CPR/First Aid) 910-770-4663 OPENING: LIKE TO RENT FARM LAND FOR Benefit package includes: Paid vaca- Please visit our website at www. 2013. Pay Now. 910-840-7561 tion, accumulated sick days, health, evergreeenbehavioral.com to apply. dental & vision insurance, retire- Nurse Practitioner - provides HAY FOR SALE Evergreen Behavioral Management, ment program. Applications taken direct patient care for patients Round & Square Bales Inc. is an Equal Opportunity Employ- by appointment only!!! No walk-ins. with life limiting illnesses in SPRIGGING/PLANTING er, M/F/D/V Call and ask for Teresa. 910-654-3101 Bladen County and Columbus of Coastal Bermuda grass. Call 910- County. Is responsible for using LPN, MEDICAL ASSISTANT, and 100 Pets & Animals 649-6145 or 910-770-0910. expert skills in the implementation Medical Receptionist needed for busy and evalution of plans of care. Urgent Care in Whiteville. Only those Effectively manages the plan of ABCA BORDER COLLIE/ CARPENTER HELPER. Must have with a positive attitude and good work valid drivers license & transportation. care for each patient based on ethic need apply. AKC Lab hybrid cross (Bora- Coastal Carolina Behavioral Must be reliable 654-5725. Healthcare is currently seeking clinical knowledge, data, patient For immediate consideration, fax 2007 KUBOTA 50 hp 4x4. Heavy duty dor) puppies. $50. Very Intel- LPC’s, LCSW’s, and LCAS’s for its preference and benefits to the resume to 866-251-5115 or email bucket loader, ROP canopy. Like new. ligent breeds. Please call EXPERIENCED GRILL COOK Whiteville, NC office. Please call 910- patient. Works with Palliative Care resume medhumanresources@gmail. 78 hrs. Garage kept. $19,500. OBO. NEEDED. Call Donut Shop 910- 640-3535 and/or email resume to: Center physicians in the hospital, com 910-520-8940 Call 910-477-0203 640-3317. info@coastalcarolinabehavioral- nursing homes and physician’s office and patient’s homes. BOAR GOAT full blooded & percent- REDUCED! 30+ft Nomad tagalong healthcare.com age billys and nannys all ages $75 and INSTRUMENTATION AND Graduate of an accredited school SERVICES camper. 40 KV PTO generator, Don- of nursing, either through an AD, up. Call 234-0150. keys. Call 910-207-8810 ELECTRICAL TECH NEEDED: REGISTERED NURSE: Strong background in troubleshoot- Bladen County Hospital, Elizabeth- Diploma or BSN program 280 Child/Elderly Care ing, calibration and setup of instru- town NC is seeking RNs to function required. Graduate of a Masters mentation. (Temp, Pressure Transmit- as a “Flex Nurse” to float among all degree in nursing program with a ters & Flow Meters). Bailey and PLC departments based on patient need. major or postmasters as a nurse ANN’S DAYCARE is now accepting Special Discount knowledge and a plus if Medium to Must be licensed with NCBON, 2 practitioner required. Current applications for children ages 0 - 12. High voltage experience is available. years critical care or ED experience license to practice in NC required. After school care and part-time care on Water Taps Working in a Food Grade Chemical preferred. Emergency Dept based Approval for practice as a nurse also available. Contact 910-0642- Facility. position. Full Time and Per Diem practitioner by the NC Board of 6937 for more information. Fax resume to 910-454-1025 or email positions available 7p-7a. Competi- Nursing required, Minimum of five By directive of the Columbus County I WOULD LIKE to do private duty to [email protected] tive Salary, Excellent Benefits. Send years general medical experience work with the elderly and work day, Resume to gparks@capefearvalley. in inpatients, outpatient and nurs- Commissioners, a special rate for ¾” night or live in. Available anytime. Call MAINTENANCE PERSON needed com or by fax to GParks 910-862- ing home settings. 910-914-1054. residential water taps is being offered by the 15 hours/wk. Must have electric & 1127 Email resumes to plumbing experience. Apply in person [email protected] or fax to Public Utilities Department. at Landmark Estate, 621 Nolan Ave, RN OR LPN NEEDED at Shoreland 910-341-1907. EOE Whiteville, NC or fax resume to 910- Healthcare. Apply in person 200 Flow- Through October 1, 2012 you may connect ers Pridgen Drive, Whiteville. 642-3833. REGISTERED NURSE: Bladen Coun- FOR SALE - 3 sections, deluxe res- to County water for $100.00 plus the $50.00 ty Hospital, Elizabethtown NC is seek- taurant buffet. Has 9 wells plus salad security deposit where water mains are pres- ing RNs to function as a “Flex Nurse” bar area. Includes cabinets, complete to float among all departments based and ready to use. $2,500. Call 910- ently available. Please contact the Public Util- on patient need. Must be licensed 918-9177 for an appointment to see. FREE with NCBON, 2 years critical care or THINKING ABOUT BUYING A ities Department, 612 North Madison Street, ED experience preferred. Emergency BUSINESS OPPORTUNITY! The Home Security Dept based position. Full Time and News Reporter and The Federal Whiteville, N.C. at 910-642-5257. Per Diem positions available 7p-7a. Protect Trade Commission, the nation’s con- System! Your Competitive Salary, Excellent Bene- sumer protection agency, say inves- Home fits. Send Resume to gparks@cape- * tigate before you invest. Visit ftc. “Providing safe, quality drinking water $ fearvalley.com or by fax to GParks gov/bizopps to learn how to tell a 850 Value! 910-862-1127 for you and your family” real deal from a raw deal. Call Today, Protect Tomorrow! 1-866-981-3108 * With $99 Customer Installation charge and purchase of alarm monitoring services.

LAKE HOUSE CO-PARENTS Boys & Girls Homes of North Carolina, Inc is accepting ap- plications for the position of TEEN MOM CO-PARENTS FOR OUR B&GH Lake House – a Teen Mom & Baby Home. This position requires a high school diploma, but preference is for a BSW. Ability to han- dle teenagers with behavioral issues. This position will be responsible for 24 hour care for 3 teen moms and their babies. You will live in the house as a “foster parent”, coordinating doctor visits, transporting to school, jobs, daycare, guidance with shopping and prepar- Hip Implant Recall Alert ing meals as well as many other similar duties. You are edu- cating and providing role models for the teen moms. Sal- Several types of metal on metal hip implants ary is $25,000 per employee. Exempt salaried position. We used for hip replacement have been failing at ofer an excellent beneft package. This position is located high rates. If you have had an implant failure, on the Lake Waccamaw campus. EOE you may be entitled to compensation. You can apply online at www.boysandgirlshomes.org , by email at [email protected], or fax to 910-646-3609 Please call us at 1-866-960-5800. and/or mail applications to Boys & Girls Homes of NC, Inc – The Law Office of P. O. Box 127, Lake Waccamaw, NC 28450 – Attn: Tesa Bush, Toll Free: 1-866-960-5800 Michael W. Patrick Human Resources Manager. For questions, please call Tesa Chapel Hill, NC www.ncproductslaw.com Bush at 910-646-3083 ext 205. Additional counsel may be associated to assist with the cases. The News Reporter, Monday, September 3, 2012 - 5B

SERVICES

3 BR, 2 BATH in Whiteville Central SMALL 2 BR HOUSE for rent on *WACCAMAW SHORES, L.W. 1 br MARINE Heat/Air, $650 mo + $650 security Bussy Rd. in Hallsboro. No pets. Call duplex, large kitchen, full bath, laun- dep. References req. No pets. 654- between 6 pm-9pm 642-8694. dry & living room. References & lease com- 4973 required. No pets. Call 640-8646 or *** Dee Watts Backhoe CRAIGCAT, WORLD’S FINEST pact powerboat craigcatofwilming- 654-6792. Service **** 3BR FURNISHED HOUSE CH/A ton.com demos available 910-617- Lots 0.69-4.87 acres Clarendon - Insured, tree removal, split firewood, excellent neighborhood. Deposit req. 0364 Quiet, private area, stick-built or MADISON HILL APARTMENTS bucket truck, top soil, fill dirt, marl for modular, seller will consider financ- No pets, no smokers. 642-4923 a 206 S, Madison St., Whiteville, NC driveway, land clearing. Also mow- ing. www.maryannbechtel.com 800- Cypress Village Apartments 4 BR, 1 brick house. Chadbourn. One Bedroom Apts. ing & yard work. 640-2463 or mobile 250-1902 197 Orange St., Fair Bluff, N.C. 3 br., 1 ba. house in Cerro Gordo. 3 "3-%05"$*+*2*&16.,,3-*25 770-0534. 1 and 2 bedrooms with Handicap br., 2 ba. mobile home. 2 br., 2 ba., r..,6 ).301,"*-2&-"-$& accessible units available. a mobile home. Both in Cerro Gordo. Rental assistance up to 100% ******WARD’S EXCAVATION****** Free laundry facilities + Community Call 910-640-6063. based on income. Income restric- Insured. Lot clearing, demolition, tree room **24 hour maintenance** tion may apply removal, crush/run, top soil/sand. Call 2.25 ACRES HIGHWAY frontage. BOLTON, NC 3 BR, 1 bath house for Section 8 Assistance Available Seniors 62 years and older 910-212-8737 or 910-642-7033. Rowan Store, Black River. $48,000. rent. $550/month with $550 deposit. Income Restrictions may apply   910-642-0344 Seniors 62 years and older Bobby Hinson Construction Absolutely no pets or smoking, refer- Hours: Mon.-Fri. 9 am to 2 pm 910-649-7971 Lot clearing, pond building, bushhog- ences required. House has just been &+"5   20 ACRES, 25 YEAR TIMBER 1st Hours: Monday - Friday, 8 am-2 pm ging, lots and hedge rows with mini 10 ft. 2 in. Bass Boat. $1,000. remodeled, in excellent condition! Professionally Managed by trim. Road frontage. Lake Waccamaw. TDD Relay 1-800-735-2962 excavator. Call 640-7606. Call 840-1388. $59,000 910-477-0203 (910)770-1560 Community Management Professionally Managed by Corporation BRICK HOUSE, 3 BR, 2 bath 1,600 Community Management Carpentry Work LIKE NEW 2008 fiberglass 3hp boat Roofing, painting and wallpaper. No sq. ft. City. $750 month + security Corporation with trailer. Call day time 910-654- dep. 336-870-2501. job too small. Workmanship guaran- 4440 teed. Call 642-4226. LAKEFRONT WITH PIER: down- stairs unit-2 BR, 1 bath available Sept LARRY HINSON’S BACKHOE 1; upstairs unit-3 bedrooms, 2 bath 2 BEDROOM APT. for rent. White- All types of backhoe work, lot clear- available Oct 1 (year lease).Call 910- ville area. $450. Call Clint at 234-4676 ing, sand, top soil and marl. ****Publisher’s Notice**** 602-3437, 910-617-5105 Call 654-4503. Equal Housing Opportunity PET SITTING AND WILL DO LIGHT ****Publisher’s Notice**** All real estate advertised herein is HOUSE CLEANING. Will provide subject to the Federal Fair Housing personnel references. 910-234-0203. Equal Housing City of Whiteville Survey – Recycling Program Opportunity Act, North Carolina and Columbus All real estate advertised herein is Fair Housing Law which makes it ille- INTRODUCTION: subject to the Federal Fair Housing gal to advertise any preference, limi- Whiteville City Council is considering a residential recycling program and wants to know if you Act, North Carolina and Columbus tation discrimination based on race, Fair Housing Law which makes it ille- color, religion, sex, handicap, familial want to recycle. The materials that would be collected from your curb are Glass: clear-green- gal to advertise any preference, limi- status or national origin, or intention brown, Plastic bottles and containers (numbers 1-7), Paper in the form of news-magazines- to make any such preferences, limi- tation discrimination based on race, catalogs-phone books-junk mail-office paper, Aluminum and Steel cans and Cardboard such color, religion, sex, handicap, familial tations or discrimination. We will not knowingly accept any advertising for as cereal boxes and shoe boxes; however the program will not accept food contaminated boxes 2004 LINCOLN TOWNCAR, 60,000 status or national origin, or intention to make any such preferences, limi- real estate which is in violation of the miles. Call 910-640-1712, cell 918- or plastic bags. tations or discrimination. We will not law. All person are hereby informed 1011. knowingly accept any advertising for that all dwellings advertised are avail- The collection of recycling materials would be performed in a similar manner as household able on an equal opportunity basis. To 2004 VW BEETLE GLS TDI, auto, real estate which is in violation of the trash, a Cart would be provided for that specific purpose. There are costs associated with law. All person are hereby informed complain of discrimination, call HUD power pkg, sunroof, 82k. $12,500. toll-free at 1-800-765-9372. providing recycling programs that exceed the value of materials collected for recycling. The Fair Bluff Ford 649-7531 that all dwellings advertised are avail- able on an equal opportunity basis. To suggested cost of this service through a User Fee is $3.47 per month per household which has 2 BEDROOM HOUSE FOR RENT 2007 LINCOLN SIGNATURE complain of discrimination, call HUD an equivalent tax rate of 1.97 cents in the Ad Valorum rate. The future cost of this service if Under 60,000 miles. Excellent. toll-free at 1-800-765-9372. on E. Clay St. Stove and refrigerator Asking $15,000. furnished. $500 month, plus $500 provided by the City, will be adjusted based on changes in petroleum costs and increases in the PECAN ORCHARD. Brick home, 3 deposit. No pets. 642-4254. Call 910-253-3542 BR, 2.5 b, db garage, secluded lot. consumer price index. 2007 MINI COOPER, red, excellent $229,500. Call Rick for appt 910- 2 BEDROOM UNFURNISHED house At the end of this survey is the section Recycling Facts, if you would like to preview that page 445-3854. shape, brand new tires, 2 sunroofs near city limits in Whiteville. Good before starting, skip over the questions and return to them once you are done reviewing the $9,700. 918-7267 neighborhood. References. No pets. Call 642-3740. Recycling Facts. 2008 MERCURY SABLE, 4 dr, V6 auto, moonroof, 82k, $12,500. Fair Completed ‘print’ surveys are to be delivered to: City Clerk, Post Office Box 607/317 S. Madi- a 2 BEDROOM, 2 bath house with car- Bluff Ford 910-649-7531 port. Central heat/air. Good location. son St, Whiteville, NC 28472. The Survey is available Online and may be completed electroni- 2010 FORD FUSION, 4dr, sedan, SE, $600 per month, plus deposit. Refer- cally through these web sources: ences required. Call 910-880-0977. V6 auto, loaded, 38k. $15,800. Fair Whiteville: http://www.whitevillecity.com/ Bluff Ford. 910-649-7531 2 BR HOUSE near the school in Fair News Reporter: http://www.whitevillecity.com/ 2011 CHEVY IMPALA, V6, 4 door Bluff. $500 a month. Security Deposit. Survey Monkey: http://www.surveymonkey.com/s/F266FF9 sedan, flexible fuel, 32k, $16,500. Fair Call 642-2736. Bluff Ford 649-7531 3 Br, 2 Bath, fireplace, 2000 dou - ble wide, bricked up. 1900 sq. ft. Please take a few moments to answer the following multiple choice questions – thanks! Near charter school. 910-914-1384 2 BR, 2 BA IN WOODED ACRES 2011 CHEVY MALIBU, 4 door sedan, Lake Waccamaw. References req. If you Strongly Disagree with the questions please mark it with a 1, if you Strongly Agree mark heated leather, 34k, $17,900. Fair No pets. Call 640-9435, 642-5801. Bluff Ford 649-7531 3/4 ACRE LOT w/improvement it with a 5 and if you have do not have an opinion mark Don’t Care: 16X80 3BR, 2 bath. Ready to move 2 BR, 2 BATH, all appliances fur- 1: Strongly Disagree 2011 LINCOLN MKZ, 4 door sedan, in. Double carport & storage for more SYNC, leather, 21k. $25,900. Fair nished. Good neighborhood. 910- Disagree info. 910-654-4128 625-5626, 642-5071 Bluff Ford 649-7531 3: Neutral 2012 FORD TAURUS SEL, 4dr, DOUBLE WIDE 3BR, 2 bath, fire- 3 BR HOUSE in Chadbourn. No pets. Agree place, incl carport and shed. Must sedan, auto, moonroof, 14k. $25,900. $450 month + $450 security dep., ref- 5: Strongly Agree be moved. Call 910-646-6326 erences req. Call 654-4973 Fair Bluff Ford. 910-649-7531 Don’t Care 73 MGB orange, good condition, new NEW 3 BED, 2 bath singlewide wind ~ SURVEY ~ tires, runs good. 4 sp. Chrome wire zone II, starting at $23,990 Oakwood wheels. $4,500. 918-7267 Homes, Chadbourn 910-654-4128 WELLONTON APARTMENTS Should the City of Whiteville sponsor a recycling program? 1 - - 3 - - 5 Don’t Care 88 JAGUAR XJS V12, white convert- NEW WIND ZONE II double wide able, runs good, good condition, new 1,500 sq ft starting at $39,900. call 200 W. 6th St. Will your household participate in Whiteville’s recycling program? 1 - - 3 - - 5 Don’t Care tires. $5,500. 918-7267 Oakwood Homes, Chadbourn 910- Chadbourn, NC 28431 How should the city’s recycling program be funded? 92 THUNDERBIRD SUPER coupe, 654-4128 silver, auto, good interior, good cond. Family Households a) Increase Property Taxes 1 - - 3 - - 5 Don’t Care $2,900. 918-7267 OAKWOOD HOMES Chadbourn. Singlewides, double wides and mod- 1, 2 & 3 Bedroom b) Add User Fee 1 - - 3 - - 5 Don’t Care ulars. LOT MODEL CLEARANCE c) Other: ______1 - - 3 - - 5 Don’t Care SALE 910-654-4128 Apartments Should this program be funded by reducing and/or changing other city services? 2000 CHEVY SILVERADO, gold, 3 dr, Units for Persons with long bed, gooseneck, new tires, extra Disabilities Available a) Police (eliminate approximately two positions) 1 - - 3 - - 5 Don’t Care clean, $6,500, 918-7267 b) Fire (eliminate approximately two positions) 1 - - 3 - - 5 Don’t Care RESTAURANT FOR SALE Rental Assistance c) Recreation (triple the amount of existing registration fees) 1 - - 3 - - 5 Don’t Care 2008 FORD F-450 Dually Crew cab Fully equipped, good location. Priced Lariat, loaded. White & silver. 35k for quick sale. For more info call 910- Available d) Street/Stormwater Maintenance (eliminate approximately two positions) 1 - - 3 - - 5 Don’t Care original miles. Excellent condition. 918-3528 e) Other: ______1 - - 3 - - 5 Don’t Care $34,900. OBO 910-477-0203 Please Call: RESTAURANT IN WHITEVILLE. 910-654-3067 Remarks: ______2009 GMC SIERRA, reg. cab, 4.3l V6 Brand new! Turnkey $18,000 OBO ______engine, auto transmission, cruise, a/c Great lease. Call Ken Wells @ Coast- TDD/TYY ~ end of survey ~ 2,800 miles 642-3587 al Business Brokers 843-448-1090 1-800-735-2962 \ 2011 FORD F-150 XLT crew cab, 4x2, Office Hours: RECYCLING FACTS power pkg, 17k. $26,900. Fair Bluff Mon. - Fri. 9 - 2 pm s )THASBEENESTIMATEDTHATRECYCLING RE USE ANDCOMPOSTINGCREATESIXTOTENTIMESASMANY Ford. 910-649-7531 Other times by appointment jobs as waste incineration and landfills. LOT FOR SALE: Williams Township/ “This institution is an equal opportunity s 2ECYCLINGSAVESTOTIMESTHEENERGYGENERATEDBYWASTE TO ENERGYPLANTS EVENWITHOUT Mollie area. Large lot, nice commu- provider and counting the wasted energy in the burned materials. EQUAL HOUSING nity. Call 642-2872 or 653-3582. OPPORTUNITY employer.” 2001 CHEVROLET EXPRESS hand- s -AKINGATONOFPAPERFROMRECYCLEDPAPERSAVESUPTOTREESANDUSESPERCENTLESS icap van includes wheelchair lift, water than does creating paper from virgin pulp. raised roof, tie downs for wheelchair, s )N ABOUTPOUNDSOFPAPERWERERECYCLEDFOREACHPERSONINTHE53 new tires. Very clean. 105,600 k miles. Call 910-641-1250. s OFALUMINUMBEERANDSOFTDRINKCANSWERERECYCLEDIN 25 minute ride with a full size s 'LASSFOODANDDRINKCONTAINERSMADEUPOFALLTHEWASTEGENERATEDIN/NLY 2008 FORD SPORT TRAC 4 dr, V6, Thomas the Tank EngineTM percent were recycled. all power, alloys, 73k, $22,500. Fair Meeting Sir Topham Hatt s OFPLASTICPACKAGINGWASRECYCLEDIN Bluff Ford 910-649-7531 Storytelling, Live Music, Build with Mega Bloks® and Much More! s )N !MERICANSRECYCLEDMILLIONTONSOFMETALS ELIMINATINGTHEEQUIVALENTOFNEARLY 2012 FORD ESCAPE limited, 4dr, million metric tons of carbon dioxide, or taking 4.5 million cars off the road for one year. heated leather, 18k, $21,900. Fair N.C. Transportation Museum s .EARLYOFALLCORRUGATEDBOXESWERERECYCLEDIN Bluff Ford 910-649-7531 411 S. Salisbury Avenue, Spencer, NC Sept. 21-23 & 28-30 s 2ECYCLINGTONOFMIXEDPAPERSAVESTHEENERGYEQUIVALENTOFGALLONSOFGASOLINE Tickets are $22 Fridays, $24 weekends, age 2 and up. Advance purchase s 2ECYCLINGTONOFALUMINUMCANSCONSERVESMORETHANMILLION"TUS WHICHISEQUALTO recommended. Ticket sales fnal. Events are rain or shine. 36 barrels of oil, or 1,665 gallons of gasoline. 1985 HARLEY DAVIDSON custom For tickets and information, visit s 4HERECYCLINGRATEOFPERCENTINSAVEDTHECARBONEMISSIONEQUIVALENTOFTAKING chopper $5,000, OBO. Call 910-642- www.ticketweb.com/dowt or call 866.468.7630 4046 MILLIONCARSOFFTHEROAD ANDTHEENERGYEQUIVALENTOFMILLIONHOUSEHOLDSANNUAL energy consumption, or 222.1 million barrels of oil. 2005 DYNA SUPER GLIDE, pearl s 4HEALUMINUMCANINDUSTRYCANMAKEUPTOCANSFROMRECYCLEDALUMINUMWITHTHESAME black, all factory 1 owner, barned Hel- mets incl. Also double barrel Stevens amount of energy it takes to make 1 completely new can. shotgun. 654-4440 s !LUMINUMCANBERECYCLEDFOREVERWITHNOLOSSOFQUALITY s 2ECYCLINGALUMINUMCREATESLESSWATERPOLLUTIONTHANMAKINGNEWMETALFROMORE For Sale By Owner s %VERYSECONDSABABYISBORN)NTHATTIME CANSAREBORN s %VERYTONOFGLASSCONTAINERSRECYCLEDSAVESOVERATONOFNATURALRESOURCES COLUMBUS CUSTOM FALL ATV specials. Now until end of Sept. Get s &OREVERYRECYCLEDGLASSUSEDTOMAKENEWGLASSCONTAINERS ENERGYCOSTSDROP PERCENT ready for Hunting season 212-7027 s 4HEENERGYSAVEDBYRECYCLINGONEGLASSBOTTLECANLIGHTA WATTLIGHTBULBFOR FOURHOURSORRUNACOMPUTERFORMINUTES s 3INCE THERATEOFOFlCEPAPERRECYCLINGHASMORETHANQUADRUPLED s PERCENTOFPAPERWASRECYCLEDIN ANALL TIMEHIGH ACCORDINGTOTHE!MERICAN SHORT &OREST0APER!SSOCIATIONWASTHElRSTYEARTHERATEWASOVERPERCENT s )FWERECYCLEDALLOFOURALUMINUMCANSFORONEYEAR WECOULDSAVEENOUGHENERGY BROS. to light Washington, D.C. for 3.7 years. s !RECYCLEDALUMINUMCANCANBEBACKONTHESHELFINDAYS RENT-A-CAR s 4HEAMOUNTOFALUMINUMCURRENTLYRECYCLEDINYEARISENOUGHTOREBUILDOUR entire airplane commercial fleet every 6 months. $ 95 s 0RODUCINGONEPOUNDOFRECYCLEDRUBBERREQUIRESONLYPERCENTASMUCHENERGY DAILY as producing one pound of new rubber. 19 s 4HEMILLIONTONSOFPAPERPRODUCTSRECYCLEDIN0ENNSYLVANIAINRESULTED Hwy. 701, South of Whiteville INFORESTCARBONSEQUESTRATIONBENElTSEQUALTONEARLYMILLIONTREESEEDLINGS 642-4175 Call 910-918-3528 grown for ten years. 6B - The News Reporter, Monday, September 3, 2012

1 BEDROOM APARTMENT in nice PRIVATE LOT - East of Whiteville. against the party or parties in posses- neighborhood area. No pets. Refer- Large 2 BR, 2 bath mobile home. No 441, Whiteville, NC 28472, will hold in the City of Tabor City, County of ences & deposit required. Call 640- pets. 918-4684 or 640-3896. a public sale to dispose of various Columbus, State of North Carolina, sion by the clerk of superior court of 8098. items of personal property, pursuant and being more particularly described the county in which the property is FOR SALE - 1 ACRE LOT well/septic to the assertion of a lien for rental at in the above referenced Deed of Trust. sold. Any person who occupies the EVANS POINTE APARTMENTS now tank 2.5 miles from Walmart 910-642- property pursuant to a rental agree- have 2 bedroom apartments avail- its storage facility. Address of property: 103 King St, 0344. ment entered into or renewed on able. Rent $380 per month. Certain The Sale will be conducted at the Tabor City, NC 28463 restrictions apply. Please call 1-910- VACATION RENTAL 2BR, 1 1/2 bath following Storage Facility locations: Tax Parcel ID: 10973 or after October 1, 2007, may, after 653-9560 for more info. condo N Myrtle Beach. In Bay Tree- The Storage Place Present Record Owners: Barbara receiving the notice of sale, terminate sleeps 6. Screened porch overlooking 325 Strawberry Blvd. Graham; Heirs of the Estate of Barba- the rental agreement upon 10 days’ 1 BR, 1 BATH upstairs apt. appli/ pool. $75 a night. Available Labor Day Chadbourn, NC 28431 ra Graham, deceased; Brenda Shaw; written notice to the landlord. Upon water incl. $425, available NOW. weekend. 910-625-6541 termination of a rental agreement, Whiteville City Limits. 840-0389. The Storage Place Saundra Martinez; Covell Jones Notice of Sale 210 7th Ave. The terms of the sale are that the real the tenant is liable for rent due under 2 BEDROOM APARTMENT. No pets. Chadbourn, NC 28431 property hereinbefore described will the rental agreement prorated to the Please call J.L. Powell & Co., Inc. Call Modern Self-Storage, PO Box 458, DATE OF SALE: be sold for cash to the highest bid- effective date of the termination. 642-4049. FOR LEASE - 1,200 sq. ft. office/retail Whiteville, NC 28472 will hold a pub- September 15, 2012 der. A deposit of five percent (5%) of Any person who occupies the prop- space. Powell Plaza. Contact Memo- FURNISHED APARTMENT IN WIL- lic sale to dispose of various items TIME OF SALE: the amount of the bid or Seven Hun- erty pursuant to a bona fide lease or ry Enterprises. 642-5824 LIAMSBURG. Call J. L. Powell 910- of personal property, pursuant to the 325 Strawberry Blvd: 10 a.m. dred Fifty Dollars ($750.00), which- tenancy may have additional rights 642-4049 FOR LEASE - Retail or office space, assertion of a lien for rental at Mod- 210 7th Ave: Immediately following ever is greater, is required and must pursuant to Title VII of 5.896 Protect- various sizes. Memory Plaza. Memory ern Self-Storage facility. Items will be Strawberry Blvd Sale be tendered in the form of certified ing Tenants at Foreclosure Act which Enterprises. 910-642-5824. sold individually and in bulk. Unit #098 Kathy Tart funds at the time of the sale. In the became effective on May 20, 2009. Sale will be conducted at storage Unit #103 Lashaun Antone event that the Owner and Holder or Posted: RETAIL SPACE AVAILABLE facility located at: Witness: 2 BEDROOM MOBILE HOME, East- Hill Plaza - Roses Shopping Center Unit #207 Michelle Mason its intended assignee is exempt from 10 West 6th Street Assistant/Deputy Clerk of Superi- over Park. Call J.L. Powell & Co Inc. S. Whiteville Village Shopping Center Unit #210 Ronald Gause paying the same, the successful bid- 642-4049. - Lake Waccamaw Shopping Center. Tabor City, NC Unit #213 Eric Smith der shall be required to pay revenue or Court Date of Sale: September 8, 2012 Rogers Townsend & Thomas, PC, 2 BEDROOM, 2 bath mobile home. N. High Traffic Areas With Competi- Unit #215 Kimberly Williams stamps on the Trustee’s Deed, and Time of sale: 10:00 a.m. Substitute Trustee Hallsboro area. No pets. References. tive Rates Unit #405 Ruth Mack any Land Transfer Tax. 642-5801 or 640-9435. Cheryl H. Ward 910-642-6044 Items to be sold: Personal belongings Unit #423 Venesia Chestnut The real property hereinabove By: and furnishings belonging to: Attorney at Law FOR RENT Downtown Commercial Posted this the 24th day of described is being offered for sale 3 BR MOBILE HOME for rent. Good 102 Marie Gaskin August, 2012. “AS IS, WHERE IS” and will be sold Rogers Townsend & Thomas, P.C. condition. $400 + deposit. Call 336- Building. Spacious parking. Call J.L. 105 Angel Scully J. Lionel Todd Investments, Inc. (Suc- subject to all superior liens, unpaid Substitute Trustee 315-3947. Powell & Co., Inc. (910) 642-4049. 111 Thomas Taylor cessor to The Storage Place) taxes, and special assessments. 2550 West Tyvola Road 4 BEDROOM DOUBLEWIDE, 2100 NEED MONEY FOR CHRISTMAS, 201 Holly Strickland By: Henrietta Todd Other conditions will be announced Suite 520 sell your unwanted items in the clas- sq. ft. country setting, central heat & 202 Samantha Buffkin September 3, 10, 2012 at the sale. The sale will be held open Charlotte, NC 28217 air, brick underpinning, 3/4 acre lot. sified. Call Wanda or Hanna 642- 205 Joseph Cokley (704)442-9500 4104 ext. 221 or 237 today! for ten (10) days for upset bids as by Deposit and 1st months rent required. 207 Michael English law required. If a third party is the August 27, September 3, 2012 910-612-8269. Notice of 212 Farron Nelson high bidder at the time of sale con- 216 Patty Strickland Substitute firmation, the third party will have Notice of Public 311A Milton Smith Trustee’s fifteen (15) days following the sale Hearing 313A Joanna Kernodle confirmation to remit the balance of BUNDLE & SAVE! 313B Janice Addison Foreclosure Sale of his/her bid to the Trustee. In the sole ON DIGITAL SERVICES FOR YOUR HOME 315A Andrea Dudney Real Property discretion of the Trustee, an extension The public will take notice of three 319A Delswa Washington may be granted, but in that instance, public hearings to be held by Bruns- DIGITAL TV 323A Derrick Vereen if required by the noteholder or loan wick Town Council on September 336 Jannette Hicks 20541 servicer, the bidder shall be required 17, 2012 at 7:30 PM in the Bruns- HIGH-SPEED INTERNET 402 Vanessa Keel 12-SP-161 to pay per diem interest at the current wick Town Hall. The hearings shall UNDER AND BY VIRTUE of the power DIGITAL PHONE 407 Almario Stephens rate on the note secured by the deed be conducted concerning the follow- MODERN SELF STORAGE and authority contained in that cer- of trust described herein until the day ing matters: Offers may be available now in your area from Acceller, Inc. for these top service providers: By: W.D. Brooks Jr. tain Deed of Trust executed and he/she remits the balance of his/her A. To consider adopting a Privilege        Time Warner Cable© Authorized Retailer Owner delivered by Barbara Graham, dated bid to the Trustee. License Ordinance that consolidates STARTING AT TO FIND OUT MORE CALL TOLL-FREE August 30, September 3, 2012 May 22, 2002 and recorded on May If for any reason the Trustee is unable previous Town Council resolutions * /mo. 22, 2002, in Book No. 691, at Page to convey title to this property or the governing Privilege Licenses into one $89 For frst 12 mo. 1-877-715-4515 901 in the Office of the Register of By Acceller, Inc., an authorized retailer. Notice of Sale sale is set aside, the sole remedy Ordinance. Deeds of Columbus County, North *Geographic and service restrictions apply to all services. Call to see if you qualify. of the purchaser is the return of the B. To consider adopting an “Aban- J. Lionel Todd Investments, Inc. Suc- Carolina; and because of default in deposit. Furthermore, if the validity of doned, Junked, and Nuisance Vehi- cessor to The Storage Place, P.O. Box the payment of the indeb\’c2tedness the sale is challenged by any party, cle” Ordinance. ™ A Safe Step Walk-In Tub will offer secured thereby and failure to carry never felt so good the Trustee, in it’s sole discretion, if it C. To consider adopting a “Public Safety independence to those seeking a safe out and perform the stipulations and and easy way to bathe right in the believes the challenge to have merit, Nuisance Conditions, Private Prop- convenience and comfort of their own agreements contained therein and, may declare the sale to be void and erty” Ordinance. home. Constructed and built right here pursuant to demand of the holder of in America for safety and durability from return the deposit. In either event Copies of these three draft ordinanc- the ground up, and with more standard Vineland the indebted\’c2ness secured by said the purchaser will have no further es are available for public inspection features than any other tub. Deed of Trust, the under\’c2signed recourse against the Mortgagor, the in the office of the Town Clerk during You’ll agree – there just isn’t a better walk- Substitute Trustee will place for sale, in tub on the market. Mortgagee, the Mortgagee’s attorney normal office hours. The public is So take your fi rst step towards feeling great Station at public auction, to the highest bid- or the Trustee. invited to attend these hearings, and and stay in the home you love. Give us a der for cash at the usual place of sale call today! Available for wedding Additional Notice Where the Real to provide comment. Call Today Toll-Free at Columbus County Courthouse, LIFETIME Cheryl N. Suggs LIMITED WARRANTY Property is Residential With Less 1-866-966-8564 receptions & other Whiteville, North Carolina on Sep- IN THE U.S E .A for FREE Information and for Town Clerk/Finance Officer D . Than 15 Rental Units: A M our Senior Discounts events tember 5, 2012 at 1:00 PM that par- Promo Code 4396 An order for possession of the prop- August 27, September 3, 2012 W E Safe Step Tubs are ITH PRID commended by the Financing available *On uninstalled tub, actual height may vary cel of land, including improvements Arthritis Foundation® with approved credit based upon installation 642-3157 erty may be issued pursuant to G.S. thereon, situated, lying and being 45-21.29 in favor of the purchaser and INTRODUCING 1949 North Roberts Avenue Phone: (866) 224-4481 End of Summer Rebate Bonanza Lumberton, NC 28358 LEASE THIS New Car rebates with approved credit from Nissan 2012 2012 2012 2012 ALL NEW Versa Rogue Sentra Maxima 2013 Nissan Altima $5000 $1750 $2500 $2500 REBATE REBATE REBATE REBATE Financed through NMAC 2012 2012 2012 2012 Altima Titan SV Quest Leaf For Only /mo. $219Plus Tax $2400 Down $3000 $5350 $2750 $9500 24 Month Lease REBATE REBATE REBATE REBATE Large seLeCtioN of Used Cars for every bUdget 09 Honda Accord EX 10 Hyundai Elantra 08 Nissan Versa 09 Nissan Rogue

$17,865 $14,990 $13,998 $19,990 11 Kia Soul 10 Ford Flex 08 GMC Acadia terry CHaPiN NissaN 1949 North Roberts Avenue Lumberton • (866) 224-4481 $18,064 $21,035 $17,980 www.chapinnissan.com The News Reporter, Monday, September 3, 2012 -- 7B SUMMER

These area businesses are here to take care of all your car care needs. DIRECTORY

13 Acres of Amazing Fun! Adults$8 4-12 $6 3 &UNDERFREE 372 Artesia Rd. Hallsboro For MoreInformationContact: Alma Galloway@910-520-8940 Or Visit www.ncmazecraze.com

WHITEVILLE NEW & USED SUMMER DRIVING SPECIALS TIRE BARGAINS See Us For Great Prices On Tires To Fit Any Just in Time For Car, Truck or SUV Including . . . SUMMER Get Ready for the Road with Black’s BIG TRUCK TIRES . . . SAVE! Your Go To Guys for Tires and Auto Service Single Used Tires DRIVING Starting At $ 50 Installed A/C Check 24 A/C Check Specializing in $ 95 AC Service & Used Tire Set $ 00Plus Computer & Service Starting Installed At $ 10 Freon Diagnostics Starting at 35 Offer29 expires Aug. 31, 2012 97 s#OMPUTER4UNE 5PS Tune Ups s'REAT4IRE"ARGAINSs'REAT3ERVICE s#HECK%NGINE,IGHTS s7E(AVE-ANY-AJOR"RANDS!VAILABLE s,ARGEST)NVENTORY/F5SED4IRES)N4HE!REA s%LECTRICAL7IRING $ 95 Radiator Starting 4 Cyl. See Us Today for Savings on - 24 HOUR TOWING - At 59 $ 95 Your Next Set of Tires Flush AUTOMOTIVE ELECTRIC Starting at WHITEVILLE NEW & USED Offer79 expires Aug. 31, 2012 South of Super Walmart, Whiteville TIRE BARGAINS 1615 S. Madison St., Whiteville • 642-3191 • www.blackstire.com 313 E. Columbus Street, Whiteville • 640-1772 DAYS 640-2577 • NIGHTS 642-0653

GET UP TO A At Car City... Our Professional Staff & Quality Pre-Owned $75 COOPER TIRES Vehicles Give You More For Your Money! VISA® PREPAID CARD AT THE TAKE THE MONEY & RIDE® NATIONAL EVENT From Aug. 24 - Nov. 6, 2012 When you buy a new set of four qualifying tires today, you’ll get more than tires built for you. You’ll get a Visa Prepaid Card Let Roland Wilson show you this worth up to $75 by mail. $75 Reward - A/T3, CTS $50 Reward - CS4, H/T, H/T Plus 2008 Dodge Ram SXT 4x4, 4 Door LIFE’S A ROAD TRIP. $ COME ON, LET’S GO. 54K Miles 20,595 Stop Shorter* with a MICHELIN® tire, and get a $70 MasterCard COASTAL TIRE & Prepaid Card after rebate with the purchase of four new MICHELIN® brand passenger or light truck tires. AUTOMOTIVE CENTER See michelinman.com for more details on the stop shorter benefts of specifc NC INSPECTION STATION MICHELIN® brand passenger or light truck tires. “We Sell ‘Em For Less So You Can Drive More!” Hwy. 130 - Just past John Donoghue Chevrolet SOUTHERN TIRE & MUFFLER Hwy. 701 South, Whiteville • www.carcitycentral.com Whiteville • 642-3693 1123 S. Madison St., Whiteville • 642-4519 Call now 642-3196 • Toll Free 1-800-380-4567

Best Prices!! Full Service Dept. BECKS EQUIPMENT TWIN STATE SERVICE MOTOR CO. AIR CONDITIONING OIL & FILTER DIAGNOSTICS LUBE CHANGE $ 95 $ 95

Pressure and leak test system. Must be presented at time of drop off. Included draining oil & flter change and up to 5 qts. 5W-30 oil. Includes74 up to 1 Lb. R134A freon and dye. Lube chassis21 if needed. Free multi-point inspection.

TIRE ALIGNMENT For Over 30 Years Specializing In $ 00 UÊ9 ,1 Ê 9 ,Ê, *,Ê $ 95 OFF UÊ ˆiÃiÊ,i«>ˆÀÊEÊ-iÀۈViÊ Any Service Over $39.95 UʏiiÌÊ >ˆ˜Ìi˜>˜ViÊUÊi`iÀ>Ê "/ʘëiV̈œ˜Ã 39 10 We Also • Build Hydraulic Hoses - Any Size • Boom Truck Repair • ECM Diagnostic Testing 843-756-5900 • Certifed Air Brake Repair • 24 Hour Road Service www.TwinStateMotors.com FAIR BLUFF FORD Èä£ÊÀœ˜Ì>}iÊ,`°]ÊœÀˆÃ]Ê- ÊUÊÜÞ°ÊÇä£ÊÕÃÌÊ œÀÌ ÊœvÊÜÞ°Ê™Ê Þ«>ÃÃʈ˜ÊœÀˆÃ Hwy. 76/Main St., Fair Bluff, NC (910) 649-7531 • (888) 870-FORD 201 MAGNOLIA ST., WHITEVILLE • 642-6902 8B - The News Reporter, Monday, September 3, 2012

Notice of receiving the notice of sale, terminate bus County, NC, this is to notify all estate of said decedent to present Beaverdam Creek Water Treatment IN THE GENERAL COURT OF JUS- the rental agreement upon 10 days’ persons having claims against said them to the undersigned within (3) Plant Wetland Restoration TICE Substitute written notice to the landlord. Upon Estate to present them to the under- months from the date of the first pub- This project includes opportunities SUPERIOR COURT DIVISION Trustee’s termination of a rental agreement, signed Administrator on or before lication, or this notice will be pleaded on, but is not limited to Hauling, Seed 12-E-247 the tenant is liable for rent due under November 15, 2012 at Powell & Pow- in bar of their recovery. All persons & Mulch, Silt Fence, Wetland plants, The undersigned, having qualified Foreclosure Sale the rental agreement prorated to the ell, Attorneys, PO Box 428, Whiteville, indebted to said estate will please Wetland Trees, Clearing and Grub- as Administrator of the Estate of of Real Property effective date of the termination. NC 28472, or this Notice will be pled make immediate payment. bing, Sheet pile, Coir Fiber Matting, Jane Howell Lewis deceased late of Any person who occupies the prop- in bar of their recovery. All persons This 13th day of August, 2012 All firms or persons interest in bidding Columbus County, this is to notify all erty pursuant to a bona fide lease or indebted to said Estate will please Bobby W. Graham on any applicable portions of these persons having claims against said UNDER AND BY VIRTUE of the power tenancy may have additional rights make immediate payment to the Co-Executor, of the estate of projects or supplying materials for any estate to present them to the under- and authority contained in that cer- pursuant to Title VII of 5.896 Protect- undersigned Administrator. Jessie F. Graham applicable portions of these projects, signed on or before the 20th day of tain Deed of Trust executed and ing Tenants at Foreclosure Act which This the 9th day of August, 2012. 1929 Blacksmith Road are invited to contact us direct or by November, 2012 or this notice will be delivered by Dwayne D. Williams and became effective on May 20, 2009. MICHAEL DEAN SHAW Bolton, NC 28423 phone (we accept collect calls). Plans pleaded in bar of their recovery. All Lisa Williams, dated October 1, 2007 Posted: Administrator Franklin L. Graham and Specifications are available for persons indebted to said estate will and recorded on October 5, 2007, in Witness: 7565 Clarendon Chadbourn Rd. Co-Executor of the estate of review at our Shallotte Office located please make immediate payment to Book No. RB 908, at Page 479 in the Assistant/Deputy Clerk of Superi- Chadbourn, NC 28431 Jessie F. Graham at 2284 Ocean Hwy N., Supply, NC, the undersigned. Office of the Register of Deeds of or Court c/o J. Coburn Powell 1899 Blacksmith Road 28462. Please call in advance to set This the 20th day of August, 2012. Columbus County, North Carolina; Rogers Townsend & Thomas, PC, Powell & Powell, Attorneys Bolton, NC 28423 up an appointment to review plans Richard M Lewis, Jr. Administrator and because of default in the pay- Substitute Trustee PO Box 428 Aug. 13, 20, 27, Sept. 3, 2012 and specifications. Estate of Jane Howell Lewis ment of the indebtedness secured By: Whiteville, NC 28472 Attn: Mr. Michael Griggs Lewis, Deese & Nance thereby and failure to carry out and Rogers Townsend & Thomas, P.C. Telephone: (910) 642-2728 Request for Bids Phone: (910) 755-9978 Attorneys for the Estate perform the stipulations and agree- Substitute Trustee August 13, 20, 27, Sept, 3, 2012 Fax: (910) 754-7179 330 Dick Street, Post Office Draw- ments contained therein and, pursu- 2550 West Tyvola Road Attention: MBE’s An EQUAL OPPORTUNITY EMPLOY- er 1358 Notice to Creditors ant to demand of the holder of the Suite 520 Barnhill Contracting Company will be Having qualified as Co-Executor ER Fayetteville, N.C. 28302 indebtedness secured by said Deed Charlotte, NC 28217 bidding on the following project on of the Estate of Jessie F. Graham, September 3, 2012 Telephone: (910) 323-35 of Trust, the undersigned Substitute (704)442-9500 September 11, 2012. We are most deceased, late of Columbus Coun- August 20, 27, Sept. 3, 10, 2012 Trustee will place for sale, at public August 27, September 3, 2012 interested in receiving quotes from ADMINISTRATOR NOTICE ty, the undersigned hereby notifies auction, to the highest bidder for cash your company on this project: NORTH CAROLINA NOTICE TO CREDITORS all person having claims against the at the usual place of sale at Colum- County: Brunswick COLUMBUS COUNTY Having qualified on the 22nd day of bus County Courthouse, Whiteville, August, 2012, as Administrator Of North Carolina on September 5, 2012 The Estate Of James Alton Jordan, at 1:00 PM that parcel of land, includ- deceased, of Columbus County, ing improvements thereon, situated, North Carolina, this is to notify all per- lying and being in the City of Tabor sons having claims against the dece- City, County of Columbus, State of dent or said Estate to present them North Carolina, and being more par- to the undersigned within three (3) ticularly described in the above refer- months from the date of the first pub- enced Deed of Trust. lication of this Notice, or this Notice Address of property: 104 Dorman will be pleaded in bar of any recovery. Street, Tabor City, NC 28463 Please direct all claims to the atten- Tax Parcel ID: 12484 tion of Laura J. Davis, Administrator, Present Record Owners: Dwayne D. Estate Of James Alton Jordan, 92 Williams a/k/a Dwayne Devon Wil- Candlewood Lane, Whiteville, North liams, Sr. Carolina 28472. The terms of the sale are that the real This the 23rd day of June, 2012 property hereinbefore described will LAURA J. DAVIS, Administrator be sold for cash to the highest bid- Of The Estate Of der. A deposit of five percent (5%) of James Alton Jordan the amount of the bid or Seven Hun- 92 Candlewood Lane dred Fifty Dollars ($750.00), which- Whiteville, North Carolina 28472 ever is greater, is required and must T. SCOTT SESSIONS, Attorney For be tendered in the form of certified The Estate Of James Alton Jordan funds at the time of the sale. In the The McGougan Law Firm event that the Owner and Holder or 130 Jefferson Street its intended assignee is exempt from Whiteville, North Carolina 28472 paying the same, the successful bid- August 27, Sept. 3, 10, 17, 2012 der shall be required to pay revenue stamps on the Trustee’s Deed, and NOTICE TO CREDITORS any Land Transfer Tax. North Carolina The real property hereinabove Columbus County described is being offered for sale The undersigned MICHAEL DEAN “AS IS, WHERE IS” and will be sold SHAW, having qualified as Admin- subject to all superior liens, unpaid istrator of the Estate of GARY ALVA taxes, and special assessments. SHAW, SR. deceased, late of Colum- Other conditions will be announced at the sale. The sale will be held open for ten (10) days for upset bids as by law required. If a third party is the high bidder at the time of sale con- firmation, the third party will have fifteen (15) days following the sale confirmation to remit the balance of his/her bid to the Trustee. In the sole 9/52 discretion of the Trustee, an extension may be granted, but in that instance, if required by the noteholder or loan servicer, the bidder shall be required 1860 CC w/70 hp, Galv. Trlr K16 CC w/40 hp Yamaha & Galv. Trlr to pay per diem interest at the current rate on the note secured by the deed Only $139.00/mo* Only $119.00/mo* of trust described herein until the day he/she remits the balance of his/her (/-% bid to the Trustee. Custom Rigged/Tournament Ready If for any reason the Trustee is unable to convey title to this property or the sale is set aside, the sole remedy of the purchaser is the return of the deposit. Furthermore, if the validity of the sale is challenged by any party, the Trustee, in it’s sole discretion, if it !7!9 believes the challenge to have merit, may declare the sale to be void and return the deposit. In either event the purchaser will have no further recourse against the Mortgagor, the Mortgagee, the Mortgagee’s attorney or the Trustee. Additional Notice Where the Real &2/- 1542 Duck Boat w/ 25 hp Yamaha & Galv. Trlr Sea Fox 256 CC w/twin 150s & Alum Trlr Property is Residential With Less Than 15 Rental Units: Only $95.00/mo* Only $519.00/mo* An order for possession of the prop- erty may be issued pursuant to G.S. 45-21.29 in favor of the purchaser and NC/SC Mobile Services • Fiberglass Repair • Bottom Painting against the party or parties in posses- sion by the clerk of superior court of the county in which the property is (/-% sold. Any person who occupies the property pursuant to a rental agree- ment entered into or renewed on or after October 1, 2007, may, after Whiteville.com

- 3x higher payments Ranked #1 - Free Insured Shipping on NBC’s Today Show 230CL w/ 90 hp Yamaha & Galv. Trlr 208 CC w/ 150 & Alum Trlr - 10% Referral Bonus “Our best offer was from SellYourGold” -NBC’s The Today Show Only $229.00/mo* Only $325.00/mo* Call to Request a Free Appraisal Custom Fishing Boats Rigged for Fishermen by Fishermen (877) 216-3316 We are a mail-order gold buyer Hours of Operation: Monday-Friday: 9AM-6PM, Saturday: 9AM-2PM EST

I live

alone 24XS w/twin 150s & Alum Trlr 1800CC w/90 hp Yamaha & Alum Trlr but I’m never alone. Only $632.00/mo* Only $199.00/mo* I have . Factory Authorized Service/Electronics Technicians *10% down, includes For a FREE brochure call: tax,with approved credit. 1-866-387-4196 www.anglersmarinenc.com