GTF2A1L Antibody Cat

Total Page:16

File Type:pdf, Size:1020Kb

Load more

GTF2A1L Antibody Cat. No.: 30-665 GTF2A1L Antibody Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Human Antibody produced in rabbits immunized with a synthetic peptide corresponding a region IMMUNOGEN: of human GTF2A1L. TESTED APPLICATIONS: ELISA, WB GTF2A1L antibody can be used for detection of GTF2A1L by ELISA at 1:1562500. GTF2A1L APPLICATIONS: antibody can be used for detection of GTF2A1L by western blot at 0.5 μg/mL, and HRP conjugated secondary antibody should be diluted 1:50,000 - 100,000. POSITIVE CONTROL: 1) Cat. No. 1211 - HepG2 Cell Lysate PREDICTED MOLECULAR 52 kDa WEIGHT: Properties PURIFICATION: Antibody is purified by peptide affinity chromatography method. CLONALITY: Polyclonal CONJUGATE: Unconjugated PHYSICAL STATE: Liquid September 30, 2021 1 https://www.prosci-inc.com/gtf2a1l-antibody-30-665.html Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% BUFFER: sucrose. CONCENTRATION: batch dependent For short periods of storage (days) store at 4˚C. For longer periods of storage, store STORAGE CONDITIONS: GTF2A1L antibody at -20˚C. As with any antibody avoid repeat freeze-thaw cycles. Additional Info OFFICIAL SYMBOL: GTF2A1L ALTERNATE NAMES: GTF2A1L, ALF, MGC26254 ACCESSION NO.: NP_006863 PROTEIN GI NO.: 26787968 GENE ID: 11036 USER NOTE: Optimal dilutions for each application to be determined by the researcher. Background and References The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA- BACKGROUND: binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. Alternative splicing for this locus has been observed and two variants, encoding distinct isoforms, have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. REFERENCES: 1) Kim, M., (2006) J. Biol. Chem. 281 (45), 34288-34298. ANTIBODIES FOR RESEARCH USE ONLY. For additional information, visit ProSci's Terms & Conditions Page. September 30, 2021 2 https://www.prosci-inc.com/gtf2a1l-antibody-30-665.html.
Recommended publications
  • Analysis of Trans Esnps Infers Regulatory Network Architecture

    Analysis of Trans Esnps Infers Regulatory Network Architecture

    Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2014 © 2014 Anat Kreimer All rights reserved ABSTRACT Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer eSNPs are genetic variants associated with transcript expression levels. The characteristics of such variants highlight their importance and present a unique opportunity for studying gene regulation. eSNPs affect most genes and their cell type specificity can shed light on different processes that are activated in each cell. They can identify functional variants by connecting SNPs that are implicated in disease to a molecular mechanism. Examining eSNPs that are associated with distal genes can provide insights regarding the inference of regulatory networks but also presents challenges due to the high statistical burden of multiple testing. Such association studies allow: simultaneous investigation of many gene expression phenotypes without assuming any prior knowledge and identification of unknown regulators of gene expression while uncovering directionality. This thesis will focus on such distal eSNPs to map regulatory interactions between different loci and expose the architecture of the regulatory network defined by such interactions. We develop novel computational approaches and apply them to genetics-genomics data in human. We go beyond pairwise interactions to define network motifs, including regulatory modules and bi-fan structures, showing them to be prevalent in real data and exposing distinct attributes of such arrangements. We project eSNP associations onto a protein-protein interaction network to expose topological properties of eSNPs and their targets and highlight different modes of distal regulation.
  • Noelia Díaz Blanco

    Noelia Díaz Blanco

    Effects of environmental factors on the gonadal transcriptome of European sea bass (Dicentrarchus labrax), juvenile growth and sex ratios Noelia Díaz Blanco Ph.D. thesis 2014 Submitted in partial fulfillment of the requirements for the Ph.D. degree from the Universitat Pompeu Fabra (UPF). This work has been carried out at the Group of Biology of Reproduction (GBR), at the Department of Renewable Marine Resources of the Institute of Marine Sciences (ICM-CSIC). Thesis supervisor: Dr. Francesc Piferrer Professor d’Investigació Institut de Ciències del Mar (ICM-CSIC) i ii A mis padres A Xavi iii iv Acknowledgements This thesis has been made possible by the support of many people who in one way or another, many times unknowingly, gave me the strength to overcome this "long and winding road". First of all, I would like to thank my supervisor, Dr. Francesc Piferrer, for his patience, guidance and wise advice throughout all this Ph.D. experience. But above all, for the trust he placed on me almost seven years ago when he offered me the opportunity to be part of his team. Thanks also for teaching me how to question always everything, for sharing with me your enthusiasm for science and for giving me the opportunity of learning from you by participating in many projects, collaborations and scientific meetings. I am also thankful to my colleagues (former and present Group of Biology of Reproduction members) for your support and encouragement throughout this journey. To the “exGBRs”, thanks for helping me with my first steps into this world. Working as an undergrad with you Dr.
  • Identification of the Active Constituents and Significant Pathways of Cangfu Daotan Decoction for the Treatment of PCOS Based on Network Pharmacology

    Identification of the Active Constituents and Significant Pathways of Cangfu Daotan Decoction for the Treatment of PCOS Based on Network Pharmacology

    Hindawi Evidence-Based Complementary and Alternative Medicine Volume 2020, Article ID 4086864, 15 pages https://doi.org/10.1155/2020/4086864 Research Article Identification of the Active Constituents and Significant Pathways of Cangfu Daotan Decoction for the Treatment of PCOS Based on Network Pharmacology Wenting Xu , Mengyu Tang , Jiahui Wang , and Lihong Wang Department of Reproduction, Zhangjiagang TCM Hospital Affiliated to Nanjing University of Chinese Medicine, Zhangjiagang, Suzhou, Jiangsu, China Correspondence should be addressed to Lihong Wang; [email protected] Received 18 December 2019; Accepted 27 January 2020; Published 22 February 2020 Academic Editor: Deborah A. Kennedy Copyright © 2020 Wenting Xu et al. ,is is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Background. Polycystic ovary syndrome (PCOS) is the most common female endocrine disease. Cangfu Daotan Decoction (CDD) can effectively relieve the clinical symptoms of PCOS patients. Methods. To explore the active ingredients and related pathways of CDD for treating PCOS, a network pharmacology-based analysis was carried out. ,e active ingredients of CDD and their potential targets were obtained from the TCM system pharmacology analysis platform. ,e obtained PCOS-related genes from OMIM and GeneCards were imported to establish protein-protein interaction networks in STRING. Finally, GO analysis and significant pathway analysis were conducted with the RStudio (Bioconductor) database. Results. A total of 111 active compounds were obtained from 1433 ingredients present in the CDD, related to 118 protein targets. In addition, 736 genes were found to be closely related to PCOS, of which 44 overlapped with CDD and were thus considered therapeutically relevant.
  • Nº Ref Uniprot Proteína Péptidos Identificados Por MS/MS 1 P01024

    Nº Ref Uniprot Proteína Péptidos Identificados Por MS/MS 1 P01024

    Document downloaded from http://www.elsevier.es, day 26/09/2021. This copy is for personal use. Any transmission of this document by any media or format is strictly prohibited. Nº Ref Uniprot Proteína Péptidos identificados 1 P01024 CO3_HUMAN Complement C3 OS=Homo sapiens GN=C3 PE=1 SV=2 por 162MS/MS 2 P02751 FINC_HUMAN Fibronectin OS=Homo sapiens GN=FN1 PE=1 SV=4 131 3 P01023 A2MG_HUMAN Alpha-2-macroglobulin OS=Homo sapiens GN=A2M PE=1 SV=3 128 4 P0C0L4 CO4A_HUMAN Complement C4-A OS=Homo sapiens GN=C4A PE=1 SV=1 95 5 P04275 VWF_HUMAN von Willebrand factor OS=Homo sapiens GN=VWF PE=1 SV=4 81 6 P02675 FIBB_HUMAN Fibrinogen beta chain OS=Homo sapiens GN=FGB PE=1 SV=2 78 7 P01031 CO5_HUMAN Complement C5 OS=Homo sapiens GN=C5 PE=1 SV=4 66 8 P02768 ALBU_HUMAN Serum albumin OS=Homo sapiens GN=ALB PE=1 SV=2 66 9 P00450 CERU_HUMAN Ceruloplasmin OS=Homo sapiens GN=CP PE=1 SV=1 64 10 P02671 FIBA_HUMAN Fibrinogen alpha chain OS=Homo sapiens GN=FGA PE=1 SV=2 58 11 P08603 CFAH_HUMAN Complement factor H OS=Homo sapiens GN=CFH PE=1 SV=4 56 12 P02787 TRFE_HUMAN Serotransferrin OS=Homo sapiens GN=TF PE=1 SV=3 54 13 P00747 PLMN_HUMAN Plasminogen OS=Homo sapiens GN=PLG PE=1 SV=2 48 14 P02679 FIBG_HUMAN Fibrinogen gamma chain OS=Homo sapiens GN=FGG PE=1 SV=3 47 15 P01871 IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 41 16 P04003 C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sapiens GN=C4BPA PE=1 SV=2 37 17 Q9Y6R7 FCGBP_HUMAN IgGFc-binding protein OS=Homo sapiens GN=FCGBP PE=1 SV=3 30 18 O43866 CD5L_HUMAN CD5 antigen-like OS=Homo
  • ALF (GTF2A1L) (NM 001193487) Human Tagged ORF Clone Product Data

    ALF (GTF2A1L) (NM 001193487) Human Tagged ORF Clone Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC231236L3 ALF (GTF2A1L) (NM_001193487) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: ALF (GTF2A1L) (NM_001193487) Human Tagged ORF Clone Tag: Myc-DDK Symbol: GTF2A1L Synonyms: ALF Vector: pLenti-C-Myc-DDK-P2A-Puro (PS100092) E. coli Selection: Chloramphenicol (34 ug/mL) Cell Selection: Puromycin ORF Nucleotide The ORF insert of this clone is exactly the same as(RC231236). Sequence: Restriction Sites: SgfI-MluI Cloning Scheme: ACCN: NM_001193487 ORF Size: 1332 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 ALF (GTF2A1L) (NM_001193487) Human Tagged ORF Clone – RC231236L3 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_001193487.1 RefSeq ORF: 1335 bp Locus ID: 11036 UniProt ID: Q9UNN4 Protein Families: Transcription Factors Protein Pathways: Basal transcription factors MW: 49 kDa Gene Summary: The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of transcription factor IIA (TFIIA) on the interaction between TATA-binding protein (TBP) and DNA.
  • Whole-Genome Linkage Scan Combined with Exome Sequencing Identifies Novel Candidate Genes for Carotid Intima-Media Thickness

    Whole-Genome Linkage Scan Combined with Exome Sequencing Identifies Novel Candidate Genes for Carotid Intima-Media Thickness

    fgene-09-00420 October 5, 2018 Time: 14:5 # 1 ORIGINAL RESEARCH published: 09 October 2018 doi: 10.3389/fgene.2018.00420 Whole-Genome Linkage Scan Combined With Exome Sequencing Identifies Novel Candidate Genes for Carotid Intima-Media Thickness Dina Vojinovic1, Maryam Kavousi1, Mohsen Ghanbari1,2, Rutger W. W. Brouwer3, Jeroen G. J. van Rooij4, Mirjam C. G. N. van den Hout3, Robert Kraaij4, Wilfred F. J. van Ijcken3, Andre G. Uitterlinden1,4, Cornelia M. van Duijn1,5 and Najaf Amin1* 1 Department of Epidemiology, Erasmus MC University Medical Center, Rotterdam, Netherlands, 2 Department of Genetics, School of Medicine, Mashhad University of Medical Sciences, Mashhad, Iran, 3 Department of Cell Biology, Center for Biomics, Erasmus MC University Medical Center, Rotterdam, Netherlands, 4 Department of Internal Medicine, Erasmus MC University Medical Center, Rotterdam, Netherlands, 5 Nuffield Department of Population Health, University of Oxford, Oxford, United Kingdom Carotid intima-media thickness (cIMT) is an established heritable marker for subclinical atherosclerosis. In this study, we aim to identify rare variants with large effects driving Edited by: differences in cIMT by performing genome-wide linkage analysis of individuals in the Robert Klein, extremes of cIMT trait distribution (>90th percentile) in a large family-based study from Icahn School of Medicine at Mount a genetically isolated population in the Netherlands. Linked regions were subsequently Sinai, United States explored by fine-mapping using exome sequencing. We observed significant evidence Reviewed by: Elizabeth Hauser, of linkage on chromosomes 2p16.3 [rs1017418, heterogeneity LOD (HLOD) = 3.35], Duke University, United States 19q13.43 (rs3499, HLOD = 9.09), 20p13 (rs1434789, HLOD = 4.10), and 21q22.12 Mark Z.
  • Rabbit Anti-ALF/FITC Conjugated Antibody

    Rabbit Anti-ALF/FITC Conjugated Antibody

    SunLong Biotech Co.,LTD Tel: 0086-571- 56623320 Fax:0086-571- 56623318 E-mail:[email protected] www.sunlongbiotech.com Rabbit Anti-ALF/FITC Conjugated antibody SL5139R-FITC Product Name: Anti-ALF/FITC Chinese Name: FITC标记的通用转录因子IIA样因子抗体 General transcription factor II A 1 like factor; GTF2A1LF; SALF; Stonin 1; TFIIA Alias: alpha and beta like factor; TF2AY_HUMAN; 1-like factor; General transcription factor II A; Gtf2a1l; TFIIA-alpha and beta-like factor. Organism Species: Rabbit Clonality: Polyclonal React Species: Human,Mouse,Rat,Dog,Cow,Rabbit, IF=1:50-200 Applications: not yet tested in other applications. optimal dilutions/concentrations should be determined by the end user. Molecular weight: 44kDa Form: Lyophilized or Liquid Concentration: 1mg/ml immunogen: KLH conjugated synthetic peptide derived from human ALF Lsotype: IgG Purification: affinity purified by Protein A Storage Buffer: 0.01Mwww.sunlongbiotech.com TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year Storage: when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C. background: The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involves the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. ALF is a germ cell-specific Product Detail: counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology.
  • Genetic Tools to Improve Reproduction Traits in Dairy Cattle

    Genetic Tools to Improve Reproduction Traits in Dairy Cattle

    Genetic tools to improve reproduction traits in dairy cattle Aurelien Capitan, Pauline Michot, Aurélia Baur, Romain Saintilan, Chris Hoze, Damien Valour, François Guillaume, D Boichon, Anne Barbat, Didier Boichard, et al. To cite this version: Aurelien Capitan, Pauline Michot, Aurélia Baur, Romain Saintilan, Chris Hoze, et al.. Genetic tools to improve reproduction traits in dairy cattle. Reproduction, Fertility and Development, CSIRO Publishing, 2015, 27 (1), pp.14-21. 10.1071/RD14379. hal-01194016 HAL Id: hal-01194016 https://hal.archives-ouvertes.fr/hal-01194016 Submitted on 28 May 2020 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. CSIRO PUBLISHING Reproduction, Fertility and Development, 2015, 27, 14–21 http://dx.doi.org/10.1071/RD14379 Genetic tools to improve reproduction traits in dairy cattle A. CapitanA,B,F, P. MichotA,B, A. BaurA,B, R. SaintilanA,B, C. Hoze´ A,B, D. ValourA,D, F. GuillaumeC, D. BoichonE, A. BarbatB, D. BoichardB, L. SchiblerA and S. FritzA,B AUNCEIA (Union Nationale des Coope´ratives d’Elevage et d’Inse´mination Animale), 149 rue de Bercy, 75012 Paris, France. BINRA (Institut National de la Recherche Agronomique), UMR1313 Ge´ne´tique Animale et Biologie Inte´grative, Domaine de Vilvert, 78352 Jouy-en-Josas, France.
  • GTF2A1L (Human) Matched Antibody Pair

    GTF2A1L (Human) Matched Antibody Pair

    Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic GTF2A1L (Human) Matched Antibody Pair Catalog # : H00011036-AP21 規格 : [ 1 Set ] List All Specification Application Image Product This antibody pair set comes with matched antibody pair to detect and ELISA Pair (Recombinant protein) Description: quantify protein level of human GTF2A1L. Reactivity: Human Quality Control Standard curve using recombinant protein ( H00011036-P01 ) as an Testing: analyte. Sandwich ELISA detection sensitivity ranging from 3 ng/ml to 100 ng/ml. Supplied Antibody pair set content: Product: 1. Capture antibody: rabbit MaxPab® affinity purified polyclonal anti- GTF2A1L (100 ug) 2. Detection antibody: mouse polyclonal anti-GTF2A1L (40 ul) *Reagents are sufficient for at least 3-5 x 96 well plates using recommended protocols. Storage Store reagents of the antibody pair set at -20°C or lower. Please aliquot Instruction: to avoid repeated freeze thaw cycle. Reagents should
  • ALF Monoclonal Antibody (M04), DNA

    ALF Monoclonal Antibody (M04), DNA

    ALF monoclonal antibody (M04), DNA. This gene encodes a germ cell-specific clone 5B9 counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the Catalog Number: H00011036-M04 binding of TBP to DNA and may be uniquely important to testis biology. Alternative splicing for this locus has been Regulatory Status: For research use only (RUO) observed and two variants, encoding distinct isoforms, have been identified. Co-transcription of this gene and Product Description: Mouse monoclonal antibody the neighboring upstream gene generates a rare raised against a partial recombinant ALF. transcript (SALF), which encodes a fusion protein comprised of sequence sharing identity with each Clone Name: 5B9 individual gene product. [provided by RefSeq] Immunogen: ALF (NP_006863, 251 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: PQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGAL HQHVTDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSE KDSNSQVDLSIRVTDDDIGEIIQ Host: Mouse Reactivity: Human,Rat Applications: ELISA, S-ELISA, WB-Ce, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Isotype: IgG2b Kappa Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 11036 Gene Symbol: GTF2A1L Gene Alias: ALF, MGC26254 Gene Summary: The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and Page 1/1 Powered by TCPDF (www.tcpdf.org).
  • Translational Profiling Reveals the Transcriptome of Leptin Receptor Neurons and Its Regulation by Leptin

    Translational Profiling Reveals the Transcriptome of Leptin Receptor Neurons and Its Regulation by Leptin

    TRANSLATIONAL PROFILING REVEALS THE TRANSCRIPTOME OF LEPTIN RECEPTOR NEURONS AND ITS REGULATION BY LEPTIN by Margaret B. Allison A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Molecular and Integrative Physiology) In the University of Michigan 2015 Doctoral Committee: Professor Martin G. Myers Jr., Chair Associate Professor Carol F. Elias Professor Malcolm J. Low Professor Suzanne Moenter Professor Audrey Seasholtz Before you leave these portals To meet less fortunate mortals There's just one final message I would give to you: You all have learned reliance On the sacred teachings of science So I hope, through life, you never will decline In spite of philistine defiance To do what all good scientists do: Experiment! -- Cole Porter There is no cure for curiosity. -- unknown © Margaret Brewster Allison 2015 ACKNOWLEDGEMENTS If it takes a village to raise a child, it takes a research university to raise a graduate student. There are many people who have supported me over the past six years at Michigan, and it is hard to imagine pursuing my PhD without them. First and foremost among all the people I need to thank is my mentor, Martin. Nothing I might say here would ever suffice to cover the depth and breadth of my gratitude to him. Without his patience, his insight, and his at times insufferably positive outlook, I don’t know where I would be today. Martin supported my intellectual curiosity, honed my scientific inquiry, and allowed me to do some really fun research in his lab. It was a privilege and a pleasure to work for him and with him.
  • Genetic Landscape of Nonobstructive Azoospermia and New Perspectives for the Clinic

    Genetic Landscape of Nonobstructive Azoospermia and New Perspectives for the Clinic

    Journal of Clinical Medicine Review Genetic Landscape of Nonobstructive Azoospermia and New Perspectives for the Clinic Miriam Cerván-Martín 1,2, José A. Castilla 2,3,4, Rogelio J. Palomino-Morales 2,5 and F. David Carmona 1,2,* 1 Departamento de Genética e Instituto de Biotecnología, Universidad de Granada, Centro de Investigación Biomédica (CIBM), Parque Tecnológico Ciencias de la Salud, Av. del Conocimiento, s/n, 18016 Granada, Spain; [email protected] 2 Instituto de Investigación Biosanitaria ibs.GRANADA, Av. de Madrid, 15, Pabellón de Consultas Externas 2, 2ª Planta, 18012 Granada, Spain; [email protected] (J.A.C.); [email protected] (R.J.P.-M.) 3 Unidad de Reproducción, UGC Obstetricia y Ginecología, HU Virgen de las Nieves, Av. de las Fuerzas Armadas 2, 18014 Granada, Spain 4 CEIFER Biobanco—NextClinics, Calle Maestro Bretón 1, 18004 Granada, Spain 5 Departamento de Bioquímica y Biología Molecular I, Universidad de Granada, Facultad de Ciencias, Av. de Fuente Nueva s/n, 18071 Granada, Spain * Correspondence: [email protected]; Tel.: +34-958-241-000 (ext 20170) Received: 29 December 2019; Accepted: 16 January 2020; Published: 21 January 2020 Abstract: Nonobstructive azoospermia (NOA) represents the most severe expression of male infertility, involving around 1% of the male population and 10% of infertile men. This condition is characterised by the inability of the testis to produce sperm cells, and it is considered to have an important genetic component. During the last two decades, different genetic anomalies, including microdeletions of the Y chromosome, karyotype defects, and missense mutations in genes involved in the reproductive function, have been described as the primary cause of NOA in many infertile men.