The Novel Rho-Gtpase Activating Gene MEGAP Srgap3 Has A

Total Page:16

File Type:pdf, Size:1020Kb

Load more

The novel Rho-GTPase activating gene MEGAP͞ srGAP3 has a putative role in severe mental retardation Volker Endris*, Birgit Wogatzky*, Uwe Leimer†, Dusan Bartsch†, Malgorzata Zatyka‡, Farida Latif‡, Eamonn R. Maher‡, Gholamali Tariverdian*, Stefan Kirsch*, Dieter Karch§, and Gudrun A. Rappold*¶ *Institut fu¨r Humangenetik, Universita¨t Heidelberg, Im Neuenheimer Feld 328, 69120 Heidelberg, Germany; †Zentralinstitut fu¨r Seelische Gesundheit, J5, 68159 Mannheim, Germany; ‡Section of Medical and Molecular Genetics, Department of Paediatrics and Child Health, University of Birmingham Medical School, Edgbaston, Birmingham B15 2TT, United Kingdom; and §Klinik fu¨r Kinderneurologie und Sozialpaediatrie, Kinderzentrum Maulbronn, 75433 Maulbronn, Germany Edited by Martha Vaughan, National Institutes of Health, Rockville, MD, and approved June 10, 2002 (received for review April 23, 2002) In the last few years, several genes involved in X-specific mental In the present study, we analyzed a patient with a balanced de retardation (MR) have been identified by using genetic analysis. novo translocation t(X;3)(p11.2;p25) with one of its breakpoints Although it is likely that additional genes responsible for idiopathic mapping within the 3pϪ syndrome deleted region (9–12). This MR are also localized on the autosomes, cloning and characteriza- young woman shows hypotonia and severe MR, features char- Ϫ tion of such genes have been elusive so far. Here, we report the acteristic for 3p patients, but not microcephaly, growth failure, Ϫ isolation of a previously uncharacterized gene, MEGAP, which is heart and renal defects, and the 3p typical facial abnormalities disrupted and functionally inactivated by a translocation break- (13, 14). The translocation breakpoint on chromosome X is point in a patient who shares some characteristic clinical features, located outside of any coding region. However, the breakpoint such as hypotonia and severe MR, with the 3p؊ syndrome. By on chromosome 3 interrupts a previously unknown gene, which fluorescence in situ hybridization and loss of heterozygosity anal- we initially termed MEGAP (MEntal disorder-associated GAP ysis, we demonstrated that this gene resides on chromosome 3p25 protein). MEGAP shares structural and functional similarities and is deleted in 3p؊ patients that present MR. MEGAP͞srGAP3 with other members of the RhoGAP protein family and is highly mRNA is predominantly and highly expressed in fetal and adult expressed in fetal and adult brain tissue. The C-terminal part of brain, specifically in the neurons of the hippocampus and cortex, MEGAP corresponds to srGAP3, which recently has been shown structures known to play a pivotal role in higher cognitive function, to play a critical role in the Slit-Robo signal-transduction path- learning, and memory. We describe several MEGAP͞srGAP3 tran- way (15). We suggest that the phenotype observed in our patient script isoforms and show that MEGAP͞srGAP3a and -b represent is caused by a misregulation of a neuronal signal-transduction functional GTPase-activating proteins (GAP) by an in vitro GAP machinery controlling the correct migration of neurons and their axonal connectivity. assay. MEGAP͞srGAP3 has recently been shown to be part of the Slit-Robo pathway regulating neuronal migration and axonal Methods branching, highlighting the important role of MEGAP͞srGAP3 in Case Report. The proband is a 16-year-old female, the second mental development. We propose that haploinsufficiency of ͞ child of healthy nonconsanguineous parents (father, 47 years; MEGAP srGAP3 leads to the abnormal development of neuronal mother, 45 years). Her brother of 26 years is not affected, and structures that are important for normal cognitive function. there are no further affected individuals in this family. Pregnancy was reported to be uneventful. Delivery occurred at 40 weeks of emarkable progress in understanding the genetic traits of gestation by breech presentation. Birth weight was 3,720 g, Ridiopathic mental retardation (MR) has occurred in recent length was 55 cm, and head circumference was 35 cm. Her height years. Several genes could be identified on the human X is 163 cm (25.pc) and head circumference is 55 cm (75.pc). chromosome by using positional cloning strategies, and their Mental and motor developmental delay was evident in the early contribution to the mental handicap was revealed by mutation stages of life. She could stand freely at the age of 4 years and walk detection (1, 2). These analyses showed for most of these genes only at the age of 5.5 years. Clinical findings at the age of 16 years an apparent common molecular mechanism in contributing to included an extremely psychomotoric retardation with an atactic the same intracellular pathways involving the Rho-class of small gait, jerky arm movements, very low mental performance, GTP-coupled proteins. This family of ras-homologous proteins periodical autoaggressive behavior, and absence of speech. She is composed of several members, with RhoA, Rac1, and Cdc42 shows a triangular face with a high nasal bridge, micrognathia, the best studied examples. Their functions are diverse but have short philtrum, high and narrow palate, slender hands, muscle been ascribed roles in outgrowth of axons and dendrites in vivo hypotonia, and scoliosis. In the last 3 years, three epileptic and the activation of the MAP kinase cascades and cytoskeleton seizures occurred. The patient presents severe attention deficits; organization (3–5). The correct temporal and spatial activity is therefore, intelligence quotient (IQ) testing was not possible. accomplished by the tight regulation of the active GTP-bound and the inactive GDP state. This situation is achieved by the This paper was submitted directly (Track II) to the PNAS office. mutual function of GEF (guanine exchange factors) and GAP Abbreviations: MR, mental retardation; GAP, GTPase-activating protein; MEGAP, mental (GTPase-activating proteins) proteins. It has become evident disorder-associated GAP protein; FISH, fluorescence in situ hybridization; RT-PCR, reverse that MR seems to be a consequence of the improper regulation transcription–PCR; UTR, untranslated region. of the small GTPases or their downstream targets. For example, Data deposition: The sequences reported in this paper have been deposited in the GenBank ARHGEF6 represents a GEF for Rac1 and Cdc42 and was database (accession nos. for: MEGAPa, AF427144; KIAA0411, AB007871; KIAA1156, AL032982; RP3–339A18, Z97054; RP5–1036D20, AL109851; RP11–203C04, AC066583; RP11– identified by the molecular analysis of an X;21 reciprocal trans- 334L22, AC037193; RP11–19E08, AC034186; RP11–380O24, AC026191; CTC-334F04, location (6). In a similar way, oligophrenin1, a GAP for RhoA, AC055745; srGAP1, XM࿝051143; and srGAP2, XM࿝051949). was found to be interrupted in a female patient carrying a ¶To whom reprint requests should be addressed. E-mail: gudrun࿝[email protected] balanced X;12 translocation associated with MR (7, 8). heidelberg.de. 11754–11759 ͉ PNAS ͉ September 3, 2002 ͉ vol. 99 ͉ no. 18 www.pnas.org͞cgi͞doi͞10.1073͞pnas.162241099 Downloaded by guest on October 1, 2021 Magnetic resonance imagery scan or further imaging diagnostics tial denaturation step of 94°C for 2 min, 33 cycles of 94°C for 30 s, have been rejected by the parents. 60°C for 30 s, 72°C for 30 s, and a final 3-min extension step at Case 150500 is a 3-year-old male diagnosed with psychomotor 72°C. PCR products were analyzed on an agarose gel, re-eluted retardation and epicanthus. Cytogenetically, a terminal deletion from the gel, and cloned into pCR2.1 vector by using the of chromosome 3p was diagnosed, with the breakpoint residing TOPO-TA cloning kit (Invitrogen). Clones were sequenced and in band 3p25. Cases P1–P10 have been described (10, 12). Case compared with the published genomic sequence. P11 is an adult without intellectual impairment, who has a cytogenetically visible deletion of chromosome 3p and a normal GAP Assay. MEGAP͞srGAP3b-GST fusion protein was gener- phenotype. ated by subcloning a SalI fragment of KIAA0411 (residues 1–1468, corresponding to bp 1,377–2,849 of MEGAP͞srGAP3b) Genomic Clones and Deletion Mapping. YAC clones from Xp11.2 containing the GAP and SH3 domain into the pGEX4T3 vector and 3p25 were chosen from the Whitehead radiation hybrid (Amersham Pharmacia). Isoform a was generated by replace- maps WCX.11 and WC3.1 and purchased from the German ment of the PsyI͞Eco81I fragment (bases 1323–1813). After Resource Center (RZPD). PAC and BAC clones were obtained transfection into Escherichia coli BL21, protein expression was from the Resource Center, Oakland, (RPCI 1, 3, 11) or from induced with 1 mM isopropyl ␤-D-thiogalactoside. Recombinant Research Genetics, Huntsville (CIT-B, -C). Cosmids were pur- proteins were purified by using glutathione beads in NETN- chased from the RZPD after screening the LL03NC01 ‘‘AC’’ buffer (20 mM Tris⅐HCl, pH 8.0͞100 mM NaCl͞1 mM EDTA͞ chromosome 3 and LL0XNC01 ‘‘U’’ chromosome X-specific 0.5% Nonidet P-40͞1 mM DTT) and washed with 20 mM human cosmid libraries (Lawrence Livermore National Labo- Tris⅐HCl͞0.1 mM DTT. Vectors containing the full-length cod- ratory, Livermore, CA). Overlapping clones were confirmed by PCR and hybridization analysis. Fluorescence in situ hybridiza- ing sequence for the three small GTPases RhoA, Rac1, and tion (FISH) was performed as described. Loss of heterozygosity Cdc42Hs were obtained from the Guthrie cDNA Resource (LOH) analysis was performed as described by Green et al. (12). Center (Sayre, PA) and subcloned into pQE30 vectors (Qiagen). Proteins were prepared under native conditions as recom- Rapid Amplification of cDNA Ends (RACE) Analysis. Human total mended, but included 5 mM MgCl2 in each of the buffers (16). RNA of adult brain (Invitrogen) was reverse transcribed by using Purified proteins were dialyzed overnight against 10 mM ⅐ ͞ ͞ the gene-specific primer Ex5.1 (5Ј-GAGCAGGTTCATGCT- Tris HCl, pH 7.5 2 mM MgCl2 0.1 mM DTT. Protein concen- ͞ GAGGT-3Ј) and Superscript II reverse transcriptase (GIBCO͞ trations were determined by SDS PAGE and bicinchoninic acid BRL).
Recommended publications
  • Supplemental Information

    Supplemental Information

    Supplemental information Dissection of the genomic structure of the miR-183/96/182 gene. Previously, we showed that the miR-183/96/182 cluster is an intergenic miRNA cluster, located in a ~60-kb interval between the genes encoding nuclear respiratory factor-1 (Nrf1) and ubiquitin-conjugating enzyme E2H (Ube2h) on mouse chr6qA3.3 (1). To start to uncover the genomic structure of the miR- 183/96/182 gene, we first studied genomic features around miR-183/96/182 in the UCSC genome browser (http://genome.UCSC.edu/), and identified two CpG islands 3.4-6.5 kb 5’ of pre-miR-183, the most 5’ miRNA of the cluster (Fig. 1A; Fig. S1 and Seq. S1). A cDNA clone, AK044220, located at 3.2-4.6 kb 5’ to pre-miR-183, encompasses the second CpG island (Fig. 1A; Fig. S1). We hypothesized that this cDNA clone was derived from 5’ exon(s) of the primary transcript of the miR-183/96/182 gene, as CpG islands are often associated with promoters (2). Supporting this hypothesis, multiple expressed sequences detected by gene-trap clones, including clone D016D06 (3, 4), were co-localized with the cDNA clone AK044220 (Fig. 1A; Fig. S1). Clone D016D06, deposited by the German GeneTrap Consortium (GGTC) (http://tikus.gsf.de) (3, 4), was derived from insertion of a retroviral construct, rFlpROSAβgeo in 129S2 ES cells (Fig. 1A and C). The rFlpROSAβgeo construct carries a promoterless reporter gene, the β−geo cassette - an in-frame fusion of the β-galactosidase and neomycin resistance (Neor) gene (5), with a splicing acceptor (SA) immediately upstream, and a polyA signal downstream of the β−geo cassette (Fig.
  • Free PDF Download

    Free PDF Download

    Eur opean Rev iew for Med ical and Pharmacol ogical Sci ences 2013; 17: 2318-2322 Molecular changes of mesenchymal stromal cells in response to dexamethasone treatment J.- M. CHEN, X.-P. CUI 1, X.-D. YAO, L .-H. HUANG, H. XU Department of Orthopedics, Fuzhou General Hospital of Nanjing Command, PLA, Clinical Medical College of Fujian Medical University, Fuzhou, People’s Republic of China 1Department of Neurology, Fuzhou General Hospital of Nanjing Command, PLA Clinical Medical College of Fujian Medical University, Fuzhou, People’s Republic of China Jian-Mei Chen and Xiao-Ping Cui should be regarded as co-first authors Abstract. – BACKGROUND: Mesenchymal stem such as repair of impairment of bone, cartilage, cells (MSCs) are multipotent stromal cells that can tendons and other tissues 3. Research on the MSCs differentiate into a variety of cell types. The MSCs culture, proliferation and differentiation under canAbIMe a: ctivated and mobilized if needed. This study aimed to investigate the re - regulation was critical . sponse mechanism of MSCs under Dexametha - Dexamethasone (Dex) is a potent synthetic sone (Dex) treatment by combining MSCs mi - member of the glucocorticoid class of steroid drugs croMarAraTyERaInAdLbSioAiNnfDorMmaEtTicHsOmDSet:hods. that has immunosuppressant and anti-inflammato - We downloaded ry properties 4. It has been widely used as anti-in - the gene expression profile of ratʼs MSCs chal - flammatory and chemotherapeutic agents 5; howev - lenge with or without Dex (GSE3339) from Gene Expression Omnibus database, including 2 Dex er, prolonged use of Dex enhances direct respon - treated samples and 3 untreated samples. The dif - siveness of osteoblasts and ultimately impairs bone ferentially expressed genes (DEGs) were identi - formation, leading to changes in cell number and fied by packages in R language.
  • Whole Exome Sequencing in Families at High Risk for Hodgkin Lymphoma: Identification of a Predisposing Mutation in the KDR Gene

    Whole Exome Sequencing in Families at High Risk for Hodgkin Lymphoma: Identification of a Predisposing Mutation in the KDR Gene

    Hodgkin Lymphoma SUPPLEMENTARY APPENDIX Whole exome sequencing in families at high risk for Hodgkin lymphoma: identification of a predisposing mutation in the KDR gene Melissa Rotunno, 1 Mary L. McMaster, 1 Joseph Boland, 2 Sara Bass, 2 Xijun Zhang, 2 Laurie Burdett, 2 Belynda Hicks, 2 Sarangan Ravichandran, 3 Brian T. Luke, 3 Meredith Yeager, 2 Laura Fontaine, 4 Paula L. Hyland, 1 Alisa M. Goldstein, 1 NCI DCEG Cancer Sequencing Working Group, NCI DCEG Cancer Genomics Research Laboratory, Stephen J. Chanock, 5 Neil E. Caporaso, 1 Margaret A. Tucker, 6 and Lynn R. Goldin 1 1Genetic Epidemiology Branch, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 2Cancer Genomics Research Laboratory, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 3Ad - vanced Biomedical Computing Center, Leidos Biomedical Research Inc.; Frederick National Laboratory for Cancer Research, Frederick, MD; 4Westat, Inc., Rockville MD; 5Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; and 6Human Genetics Program, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD, USA ©2016 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol.2015.135475 Received: August 19, 2015. Accepted: January 7, 2016. Pre-published: June 13, 2016. Correspondence: [email protected] Supplemental Author Information: NCI DCEG Cancer Sequencing Working Group: Mark H. Greene, Allan Hildesheim, Nan Hu, Maria Theresa Landi, Jennifer Loud, Phuong Mai, Lisa Mirabello, Lindsay Morton, Dilys Parry, Anand Pathak, Douglas R. Stewart, Philip R. Taylor, Geoffrey S. Tobias, Xiaohong R. Yang, Guoqin Yu NCI DCEG Cancer Genomics Research Laboratory: Salma Chowdhury, Michael Cullen, Casey Dagnall, Herbert Higson, Amy A.
  • ARHGAP4 Purified Maxpab Rabbit Polyclonal Antibody (D01P)

    ARHGAP4 Purified Maxpab Rabbit Polyclonal Antibody (D01P)

    ARHGAP4 purified MaxPab rabbit polyclonal antibody (D01P) Catalog # : H00000393-D01P 規格 : [ 100 ug ] List All Specification Application Image Product Rabbit polyclonal antibody raised against a full-length human ARHGAP4 Western Blot (Tissue lysate) Description: protein. Immunogen: ARHGAP4 (AAH52303.1, 1 a.a. ~ 986 a.a) full-length human protein. Sequence: MAAHGKLRRERGLQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQ ELAEFMRRRAEVELEYSRGLEKLAERFSSRGGRLGSSREHQSFRKEPS enlarge LLSPLHCWAVLLQHTRQQSRESAALSEVLAGPLAQRLSHIAEDVGRLVK KSRDLEQQLQDELLEVVSELQTAKKTYQAYHMESVNAEAKLREAERQEE Western Blot (Transfected KRAGRSVPTTTAGATEAGPLRKSSLKKGGRLVEKLWPPQRPVAASSCA lysate) PVCWLQAGFLVHPPWWGAMCAPSTHQRQAKFMEHKLKCTKARNEYLL SLASVNAAVSNYYLHDVLDLMDCCDTGFHLALGQVLRSYTAAESRTQAS QVQGLGSLEEAVEALDPPGDKAKVLEVHATVFCPPLRFDYHPHDGDEV AEICVEMELRDEILPRAQNIQSRLDRQTIETEEVNKTLKATLQALLEVVAS DDGDVLDSFQTSPSTESLKSTSSDPGSRQAGRRRGQQQETETFYLTK LQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSWTQYTQRKFQKS RQPRPSSQYNQRLFGGDMEKFIQSSGQPVPLVVESCIRFINLNGLQHEGI FRVSGAQLRVSEIRDAFERGEDPLVEGCTAHDLDSVAGVLKLYFRSLEP enlarge PLFPPDLFGELLASSELEATAERVEHVSRLLWRLPAPVLVVLRYLFTFLN HLAQYSDENMMDPYNLAVCFGPTLLPVPAGQDPVALQGRVNQLVQTLIV QPDRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNEPELEAE MPAQEDDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWW RGEHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASEL VHRPEPCTSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKE LLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPA SPSASHPQGLDTTPKPH Host: Rabbit Reactivity: Human Quality Control Antibody reactive against mammalian transfected lysate. Testing: Storage Buffer: In 1x PBS, pH 7.4
  • ARHGAP4 (G-6): Sc-376251

    ARHGAP4 (G-6): Sc-376251

    SAN TA C RUZ BI OTEC HNOL OG Y, INC . ARHGAP4 (G-6): sc-376251 BACKGROUND APPLICATIONS ARHGAP4 (Rho GTPase activating protein 4), also known as RGC1 (Rho-GAP ARHGAP4 (G-6) is recommended for detection of ARHGAP4 of mouse, rat hematopoietic protein C1), C1, p115 or RhoGAP4, is a cytoplasmic protein and human origin by Western Blotting (starting dilution 1:100, dilution range belonging to the Rho GTPase activating protein family. ARHGAP4 contains 1:100-1:1000), immunoprecipitation [1-2 µg per 100-500 µg of total protein one Rho-GAP domain, one FCH (Fps/Fes/Fer/CIP4 homology) domain and one (1 ml of cell lysate)], immunofluorescence (starting dilution 1:50, dilution SH3 (Src homology 3) domain. Highest expression levels of ARHGAP4 are range 1:50-1:500), immunohistochemistry (including paraffin-embedded found in hematopoietic cells, however, it can also be found in lung, placenta sections) (starting dilution 1:50, dilution range 1:50-1:500) and solid phase and some fetal tissues. ARHGAP4 localizes to the leading edge in migrating ELISA (starting dilution 1:30, dilution range 1:30-1:3000). cells, axons and growth cones and is believed to participate as an inhibitor Suitable for use as control antibody for ARHGAP4 siRNA (h): sc-91158, of cell motility and axon outgrowth through its regulation of cytoskeletal ARHGAP4 siRNA (m): sc-141217, ARHGAP4 shRNA Plasmid (h): sc-91158-SH, dynamics. In addition, ARHGAP4 is capable of inhibiting the activity Rho ARHGAP4 shRNA Plasmid (m): sc-141217-SH, ARHGAP4 shRNA (h) Lentiviral GTPases, such as Cdc42 and Rac 1, that function to promote cell motility Particles: sc-91158-V and ARHGAP4 shRNA (m) Lentiviral Particles: and axon outgrowth.
  • ARHGAP4 Is a Novel Rhogap That Mediates Inhibition of Cell Motility and Axon Outgrowth ⁎ D.L

    ARHGAP4 Is a Novel Rhogap That Mediates Inhibition of Cell Motility and Axon Outgrowth ⁎ D.L

    www.elsevier.com/locate/ymcne Mol. Cell. Neurosci. 36 (2007) 332–342 ARHGAP4 is a novel RhoGAP that mediates inhibition of cell motility and axon outgrowth ⁎ D.L. Vogt,a C.D. Gray,a W.S. Young III,b S.A. Orellana,c,d and A.T. Malouf a,c, aDepartment of Neurosciences, Case Western Reserve University, 11100 Euclid Ave., Cleveland, OH 44106, USA bThe Section on Neural Gene Expression, NIMH, NIH, DHHS, Bethesda, MD 20892, USA cDepartment of Pediatrics, Case Western Reserve University, 11100 Euclid Ave., Cleveland, OH 44106, USA dDepartment of Physiology and Biophysics, Case Western Reserve University, 11100 Euclid Ave., Cleveland, OH 44106, USA Received 5 January 2007; revised 30 May 2007; accepted 3 July 2007 Available online 24 July 2007 This report examines the structure and function of ARHGAP4, a novel hydrolysis of GTP to GDP which switches the GTPases to their RhoGAP whose structural features make it ideally suited to regulate “off” state, thereby inhibiting the downstream signaling that the cytoskeletal dynamics that control cell motility and axon out- regulates actin filament dynamics and motility. This increase in growth. Our studies show that ARHGAP4 inhibits the migration of GTP hydrolysis is dependent on a highly conserved arginine residue NIH/3T3 cells and the outgrowth of hippocampal axons. ARHGAP4 in the GAP domain that directly interacts with the active region of contains an N-terminal FCH domain, a central GTPase activating GTPases (Moon and Zheng, 2003; Li et al., 1997; Nassar et al., 1998; (GAP) domain and a C-terminal SH3 domain. Our structure/function Wittmann et al., 2003; Gamblin and Smerdon, 1998).
  • Submicroscopic Duplication in Xq28 Causes Increased Expression of the MECP2 Gene in a Boy with Severe Mental Retardation And

    Submicroscopic Duplication in Xq28 Causes Increased Expression of the MECP2 Gene in a Boy with Severe Mental Retardation And

    1of6 ELECTRONIC LETTER J Med Genet: first published as 10.1136/jmg.2004.023804 on 2 February 2005. Downloaded from Submicroscopic duplication in Xq28 causes increased expression of the MECP2 gene in a boy with severe mental retardation and features of Rett syndrome M Meins, J Lehmann, F Gerresheim, J Herchenbach, M Hagedorn, K Hameister, J T Epplen ............................................................................................................................... J Med Genet 2005;42:e12 (http://www.jmedgenet.com/cgi/content/full/42/2/e12). doi: 10.1136/jmg.2004.023804 ett syndrome is an X linked mental retardation syndrome almost exclusively affecting girls, and has Key points long been regarded as an X linked dominant condition R 1 lethal in hemizygous males. Mutations in the gene encoding N Rett syndrome has been recognised as one of the major the methyl-CpG binding protein 2 (MECP2) were demon- causes of mental retardation in girls. Both point strated as the cause of Rett syndrome,2 and confirmed by a mutations and deletions affecting the MECP2 gene number of studies. The vast majority (95%) of MECP2 have been identified in girls with this neurodevelop- mutations occurs de novo. Girls affected by ‘‘classic’’ Rett mental disorder. Only a few boys with MECP2 syndrome show mental retardation and regression, with a mutations have been described, most of whom have typical pattern of symptoms including initially normal a severe neonatal encephalopathy. development, stagnation, loss of acquired abilities, stereo- N We describe a complete duplication of MECP2 due to typic hand movements, regression of speech, profound a submicroscopic duplication of approximately 430 kb psychomotor retardation, epilepsy, and autism, although within Xq28 in a boy with severe mental retardation molecular diagnostics has proven that variant clinical forms and features of Rett syndrome.
  • C Loning of Rat ARHGAP4/C1, a Rhogap Family Member Expressed in the Nervous System That Colocalizes with the Golgi Complex and Microtubules Victoria C

    C Loning of Rat ARHGAP4/C1, a Rhogap Family Member Expressed in the Nervous System That Colocalizes with the Golgi Complex and Microtubules Victoria C

    Molecular Brain Research 107 (2002) 65–79 www.elsevier.com/locate/molbrainres Research report C loning of rat ARHGAP4/C1, a RhoGAP family member expressed in the nervous system that colocalizes with the Golgi complex and microtubules Victoria C. Folettaa,1 , Fraser D. Brown b , W. Scott Young III a,* aSection on Neural Gene Expression, The National Institute of Mental Health, National Institutes of Health, Bethesda, MD 20892, USA bLaboratory of Cellular Biology, The National Heart, Lung and Blood Institute, National Institutes of Health, Bethesda, MD 20892, USA Accepted 27 August 2002 Abstract The Rho GTPase family of intracellular molecular switches control multiple cellular functions via the regulation of the actin cytoskeleton. Increasing evidence implicates a critical involvement of these molecules in the nervous system, particularly during neuronal migration and polarity, axon and growth cone guidance, dendritic arborization and synaptic formation. However, the molecules regulating Rho GTPase activities in the nervous system are less known. Here, we present the cloning of rat ARHGAP4, a member of the Rho GTPase activating protein family, and also demonstrate its close linkage to the vasopressin 2 receptor gene. In vitro, recombinant ARHGAP4 stimulated the GTPase activity of three members of Rho GTPases, Rac1, Cdc42 and RhoA. ARHGAP4 mRNA expression was observed in multiple tissues with marked expression throughout the developing and adult nervous systems. On closer analysis of protein levels, ARHGAP4 was significantly restricted to specific regions in the nervous system. These included the stratum lucidem in the CA3 area of the hippocampus, neuronal fibers in the ventral region of the brainstem and striatum, and in the cerebellar granule cells.
  • Integrated Bioinformatics Analysis Reveals Novel Key Biomarkers and Potential Candidate Small Molecule Drugs in Gestational Diabetes Mellitus

    Integrated Bioinformatics Analysis Reveals Novel Key Biomarkers and Potential Candidate Small Molecule Drugs in Gestational Diabetes Mellitus

    bioRxiv preprint doi: https://doi.org/10.1101/2021.03.09.434569; this version posted March 10, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Integrated bioinformatics analysis reveals novel key biomarkers and potential candidate small molecule drugs in gestational diabetes mellitus Basavaraj Vastrad1, Chanabasayya Vastrad*2, Anandkumar Tengli3 1. Department of Biochemistry, Basaveshwar College of Pharmacy, Gadag, Karnataka 582103, India. 2. Biostatistics and Bioinformatics, Chanabasava Nilaya, Bharthinagar, Dharwad 580001, Karnataka, India. 3. Department of Pharmaceutical Chemistry, JSS College of Pharmacy, Mysuru and JSS Academy of Higher Education & Research, Mysuru, Karnataka, 570015, India * Chanabasayya Vastrad [email protected] Ph: +919480073398 Chanabasava Nilaya, Bharthinagar, Dharwad 580001 , Karanataka, India bioRxiv preprint doi: https://doi.org/10.1101/2021.03.09.434569; this version posted March 10, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Gestational diabetes mellitus (GDM) is one of the metabolic diseases during pregnancy. The identification of the central molecular mechanisms liable for the disease pathogenesis might lead to the advancement of new therapeutic options. The current investigation aimed to identify central differentially expressed genes (DEGs) in GDM. The transcription profiling by array data (E-MTAB-6418) was obtained from the ArrayExpress database. The DEGs between GDM samples and non GDM samples were analyzed with limma package. Gene ontology (GO) and REACTOME enrichment analysis were performed using ToppGene. Then we constructed the protein-protein interaction (PPI) network of DEGs by the Search Tool for the Retrieval of Interacting Genes database (STRING) and module analysis was performed.
  • Supplementary Materials

    Supplementary Materials

    Supplementary Materials 1 Supplementary Figure S1. Expression of BPIFB4 in murine hearts. Representative immunohistochemistry images showing the expression of BPIFB4 in the left ventricle of non-diabetic mice (ND) and diabetic mice (Diab) given vehicle or LAV-BPIFB4. BPIFB4 is shown in green, nuclei are identified by the blue fluorescence of DAPI. Scale bars: 1 mm and 100 μm. 2 Supplementary Table S1 – List of PCR primers. Target gene Primer Sequence NCBI Accession number / Reference Forward AAGTCCCTCACCCTCCCAA Actb [1] Reverse AAGCAATGCTGTCACCTTC Forward TCTAGGCAATGCCGTTCAC Cpt1b [2] Reverse GAGCACATGGGCACCATAC Forward GGAAATGATCAACAAAAAAAGAAGTATTT Acadm (Mcad) [2] Reverse GCCGCCACATCAGA Forward TGATGGTTTGGAGGTTGGGG Acot1 NM_012006.2 Reverse TGAAACTCCATTCCCAGCCC Forward GGTGTCCCGTCTAATGGAGA Hmgcs2 NM_008256.4 Reverse ACACCCAGGATTCACAGAGG Forward CAAGCAGCAACATGGGAAGA Cs [2] Reverse GTCAGGATCAAGAACCGAAGTCT Forward GCCATTGTCAACTGTGCTGA Ucp3 NM_009464.3 Reverse TCCTGAGCCACCATCTTCAG Forward CGTGAGGGCAATGATTTATACCAT Atp5b [2] Reverse TCCTGGTCTCTGAAGTATTCAGCAA Pdk4 Forward CCGCTGTCCATGAAGCA [2] 3 Reverse GCAGAAAAGCAAAGGACGTT Forward AGAGTCCTATGCAGCCCAGA Tomm20 NM_024214.2 Reverse CAAAGCCCCACATCTGTCCT Forward GCCTCAGATCGTCGTAGTGG Drp1 NM_152816.3 Reverse TTCCATGTGGCAGGGTCATT Forward GGGAAGGTGAAGAAGCTTGGA Mfn2 NM_001285920.1 Reverse ACAACTGGAACAGAGGAGAAGTT Forward CGGAAATCATATCCAACCAG [2] Ppargc1a (Pgc1α) Reverse TGAGAACCGCTAGCAAGTTTG Forward AGGCTTGGAAAAATCTGTCTC [2] Tfam Reverse TGCTCTTCCCAAGACTTCATT Forward TGCCCCAGAGCTGTTAATGA Bcl2l1 NM_001289716.1
  • ARHGAP4 IS a SPATIALLY REGULATED RHOGAP THAT INHIBITS NIH/3T3 CELL MIGRATION and DENTATE GRANULE CELL AXON OUTGROWTH by DANIEL L

    ARHGAP4 IS a SPATIALLY REGULATED RHOGAP THAT INHIBITS NIH/3T3 CELL MIGRATION and DENTATE GRANULE CELL AXON OUTGROWTH by DANIEL L

    ARHGAP4 IS A SPATIALLY REGULATED RHOGAP THAT INHIBITS NIH/3T3 CELL MIGRATION AND DENTATE GRANULE CELL AXON OUTGROWTH By DANIEL LEE VOGT Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy Department of Neuroscience CASE WESTERN RESERVE UNIVERSITY August, 2007 CASE WESTERN RESERVE UNIVERSITY SCHOOL OF GRADUATE STUDIES We hereby approve the dissertation of Daniel Lee Vogt ______________________________________________________ candidate for the Ph.D. degree *. (signed) (chair of the committee)________________________________ Stefan Herlitze ________________________________________________Alfred Malouf Robert Miller ________________________________________________ ________________________________________________Thomas Egelhoff ________________________________________________Susann Brady-Kalnay ________________________________________________ (date) _______________________6-21-2007 *We also certify that written approval has been obtained for any proprietary material contained therein. ii Copyright © 2007 by Daniel Lee Vogt All rights reserved iii Table of contents Page # Title page i Table of contents iv List of figures vii Abstract 1 Chapter one: General introduction 2 Hippocampal axon pathways and development 3 Guidance cues in hippocampal axon outgrowth 6 Slit/Robo 7 Semaphorins, plexins and neuropilins 8 Ephrins and ephs 11 Other guidance cues in the hippocampus 13 GTPases: structure and function of ras superfamily members 15 Ras GTPases 17 Ran GTPases 18 Arf GTPases 18 Rab GTPases 19 Rho GTPases
  • X Chromosome Dosage Compensation and Gene Expression in the Sheep Kaleigh Flock Kaleigh.Flock@Uconn.Edu

    X Chromosome Dosage Compensation and Gene Expression in the Sheep Kaleigh Flock [email protected]

    University of Connecticut OpenCommons@UConn Master's Theses University of Connecticut Graduate School 8-29-2017 X Chromosome Dosage Compensation and Gene Expression in the Sheep Kaleigh Flock [email protected] Recommended Citation Flock, Kaleigh, "X Chromosome Dosage Compensation and Gene Expression in the Sheep" (2017). Master's Theses. 1144. https://opencommons.uconn.edu/gs_theses/1144 This work is brought to you for free and open access by the University of Connecticut Graduate School at OpenCommons@UConn. It has been accepted for inclusion in Master's Theses by an authorized administrator of OpenCommons@UConn. For more information, please contact [email protected]. X Chromosome Dosage Compensation and Gene Expression in the Sheep Kaleigh Flock B.S., University of Connecticut, 2014 A Thesis Submitted in Partial Fulfillment of the Requirements for the Degree of Masters of Science at the University of Connecticut 2017 i Copyright by Kaleigh Flock 2017 ii APPROVAL PAGE Masters of Science Thesis X Chromosome Dosage Compensation and Gene Expression in the Sheep Presented by Kaleigh Flock, B.S. Major Advisor___________________________________________________ Dr. Xiuchun (Cindy) Tian Associate Advisor_________________________________________________ Dr. David Magee Associate Advisor_________________________________________________ Dr. Sarah A. Reed Associate Advisor_________________________________________________ Dr. John Malone University of Connecticut 2017 iii Dedication This thesis is dedicated to my major advisor Dr. Xiuchun (Cindy) Tian, my lab mates Mingyuan Zhang and Ellie Duan, and my mother and father. This thesis would not be possible without your hard work, unwavering support, and guidance. Dr. Tian, I am so thankful for the opportunity to pursue a Master’s degree in your lab. The knowledge and technical skills that I have gained are invaluable and have opened many doors in my career as a scientist and future veterinarian.