CGB2 Antibody (N-Term) Blocking Peptide Synthetic Peptide Catalog # Bp17908a

Total Page:16

File Type:pdf, Size:1020Kb

Load more

10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 CGB2 Antibody (N-term) Blocking Peptide Synthetic peptide Catalog # BP17908a Specification CGB2 Antibody (N-term) Blocking Peptide CGB2 Antibody (N-term) Blocking Peptide - - Background Product Information RelevanceHuman chorionic gonadotropin Primary Accession Q6NT52 (hCG) is a glycoprotein hormone produced by trophoblastic cells of the placenta beginning 10 to 12 days after conception. Maintenance of CGB2 Antibody (N-term) Blocking Peptide - Additional Information the fetus in the first trimester of pregnancy requires the production of hCG, which binds to the corpus luteum of the ovary which is Gene ID 114336 stimulated to produce progesterone which in turn maintains the secretory endometrium. The Other Names beta subunit of chorionic gonadotropin (CG) is Choriogonadotropin subunit beta variant 2, encoded by 6 highly homologous genes which CGB2 are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the Format Peptides are lyophilized in a solid powder luteinizing hormone beta subunit gene. format. Peptides can be reconstituted in solution using the appropriate buffer as needed. Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. Precautions This product is for research use only. Not for use in diagnostic or therapeutic procedures. CGB2 Antibody (N-term) Blocking Peptide - Protein Information Name CGB2 Cellular Location Secreted. Tissue Location Expressed in placenta, testis and pituitary. CGB2 Antibody (N-term) Blocking Peptide - Protocols Page 1/2 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 Provided below are standard protocols that you may find useful for product applications. • Blocking Peptides Page 2/2 Powered by TCPDF (www.tcpdf.org).
Recommended publications
  • Role of Amylase in Ovarian Cancer Mai Mohamed University of South Florida, Mmohamed@Health.Usf.Edu

    Role of Amylase in Ovarian Cancer Mai Mohamed University of South Florida, [email protected]

    University of South Florida Scholar Commons Graduate Theses and Dissertations Graduate School July 2017 Role of Amylase in Ovarian Cancer Mai Mohamed University of South Florida, [email protected] Follow this and additional works at: http://scholarcommons.usf.edu/etd Part of the Pathology Commons Scholar Commons Citation Mohamed, Mai, "Role of Amylase in Ovarian Cancer" (2017). Graduate Theses and Dissertations. http://scholarcommons.usf.edu/etd/6907 This Dissertation is brought to you for free and open access by the Graduate School at Scholar Commons. It has been accepted for inclusion in Graduate Theses and Dissertations by an authorized administrator of Scholar Commons. For more information, please contact [email protected]. Role of Amylase in Ovarian Cancer by Mai Mohamed A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy Department of Pathology and Cell Biology Morsani College of Medicine University of South Florida Major Professor: Patricia Kruk, Ph.D. Paula C. Bickford, Ph.D. Meera Nanjundan, Ph.D. Marzenna Wiranowska, Ph.D. Lauri Wright, Ph.D. Date of Approval: June 29, 2017 Keywords: ovarian cancer, amylase, computational analyses, glycocalyx, cellular invasion Copyright © 2017, Mai Mohamed Dedication This dissertation is dedicated to my parents, Ahmed and Fatma, who have always stressed the importance of education, and, throughout my education, have been my strongest source of encouragement and support. They always believed in me and I am eternally grateful to them. I would also like to thank my brothers, Mohamed and Hussien, and my sister, Mariam. I would also like to thank my husband, Ahmed.
  • The Study of the Expression of CGB1 and CGB2 in Human Cancer Tissues

    The Study of the Expression of CGB1 and CGB2 in Human Cancer Tissues

    G C A T T A C G G C A T genes Article The Study of the Expression of CGB1 and CGB2 in Human Cancer Tissues Piotr Białas * , Aleksandra Sliwa´ y , Anna Szczerba y and Anna Jankowska Department of Cell Biology, Poznan University of Medical Sciences, Rokietnicka 5D, 60-806 Pozna´n,Poland; [email protected] (A.S.);´ [email protected] (A.S.); [email protected] (A.J.) * Correspondence: [email protected]; Tel.: +48-6185-4-71-89 These authors contributed equally to this work. y Received: 14 August 2020; Accepted: 15 September 2020; Published: 17 September 2020 Abstract: Human chorionic gonadotropin (hCG) is a well-known hormone produced by the trophoblast during pregnancy as well as by both trophoblastic and non-trophoblastic tumors. hCG is built from two subunits: α (hCGα) and β (hCGβ). The hormone-specific β subunit is encoded by six allelic genes: CGB3, CGB5, CGB6, CGB7, CGB8, and CGB9, mapped to the 19q13.32 locus. This gene cluster also encompasses the CGB1 and CGB2 genes, which were originally considered to be pseudogenes, but as documented by several studies are transcriptionally active. Even though the protein products of these genes have not yet been identified, based on The Cancer Genome Atlas (TCGA) database analysis we showed that the mutual presence of CGB1 and CGB2 transcripts is a characteristic feature of cancers of different origin, including bladder urothelial carcinoma, cervical squamous cell carcinoma, esophageal carcinoma, head and neck squamous cell carcinoma, ovarian serous cystadenocarcinoma, lung squamous cell carcinoma, pancreatic adenocarcinoma, rectum adenocacinoma, testis germ cell tumors, thymoma, uterine corpus endometrial carcinoma and uterine carcinosarcoma.
  • CGB2 (NM 033378) Human Tagged ORF Clone Product Data

    CGB2 (NM 033378) Human Tagged ORF Clone Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG221679 CGB2 (NM_033378) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: CGB2 (NM_033378) Human Tagged ORF Clone Tag: TurboGFP Symbol: CGB2 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG221679 representing NM_033378 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCAAAGGGGCTGCTGCTGTTGCTGCTGCTGAGCATGGGCGGGACATGGGCATCCAAGGAGCCGCTTC GGCCACGGTGCCGCCCCATCAATGCCACCCTGGCTGTGGAGAAGGAGGGCTGCCCCGTGTGCATCACCGT CAACACCACCATCTGTGCCGGCTACTGCCCCACCATGACCCGCGTGCTGCAGGGGGTCCTGCCGGCCCTG CCTCAGGTGGTGTGCAACTACCGCGATGTGCGCTTCGAGTCCATCCGGCTCCCTGGCTGCCCGCGCGGCG TGAACCCCGTGGTCTCCTACGCCGTGGCTCTCAGCTGTCAATGTGCACTCTGCCGCCGCAGCACCACTGA CTGCGGGGGTCCCAAGGACCACCCCTTGACCTGTGATGACCCCCGCTTCCAGGCCTCCTCTTCCTCAAAG GCCCCTCCCCCCAGCCTTCCAAGCCCATCCCGACTCCCGGGGCCCTCAGACACCCCGATCCTCCCACAA ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG221679 representing NM_033378 Red=Cloning site Green=Tags(s) MSKGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPAL PQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSK APPPSLPSPSRLPGPSDTPILPQ TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic
  • New Insights Into the Evolution of Chorionic Gonadotrophin Alexander Henke, Jörg Gromoll

    New Insights Into the Evolution of Chorionic Gonadotrophin Alexander Henke, Jörg Gromoll

    Mini-Review: New insights into the evolution of chorionic gonadotrophin Alexander Henke, Jörg Gromoll To cite this version: Alexander Henke, Jörg Gromoll. Mini-Review: New insights into the evolution of chori- onic gonadotrophin. Molecular and Cellular Endocrinology, Elsevier, 2008, 291 (1-2), pp.11. 10.1016/j.mce.2008.05.009. hal-00532027 HAL Id: hal-00532027 https://hal.archives-ouvertes.fr/hal-00532027 Submitted on 4 Nov 2010 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Accepted Manuscript Title: Mini-Review: New insights into the evolution of chorionic gonadotrophin Authors: Alexander Henke, Jorg¨ Gromoll PII: S0303-7207(08)00225-6 DOI: doi:10.1016/j.mce.2008.05.009 Reference: MCE 6881 To appear in: Molecular and Cellular Endocrinology Received date: 12-2-2008 Revised date: 17-5-2008 Accepted date: 19-5-2008 Please cite this article as: Henke, A., Gromoll, J., Mini-Review: New insights into the evolution of chorionic gonadotrophin, Molecular and Cellular Endocrinology (2007), doi:10.1016/j.mce.2008.05.009 This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript.
  • The Correlation Between CGB Gene Splice Variants in Women with Re- Current Spontaneous Abortions

    The Correlation Between CGB Gene Splice Variants in Women with Re- Current Spontaneous Abortions

    Psarris A, et al., J Reprod Med Gynecol Obstet 2019, 4: 027 DOI: 10.24966/RMGO-2574/100027 HSOA Journal of Reproductive Medicine, Gynaecology & Obstetrics Original Research variant (627bp) was expressed in all the women of the study (both The Correlation between CGB study group and control group). Gene Splice Variants in Women Keywords: CGB splice variants; HCG genes; Recurrent miscar- with Recurrent Spontaneous riage; Recurrent spontaneous abortions Abortions Introduction Human Chorionic Gonadotrophin (hCG) is a heterodimer glyco- Alexandros Psarris*, Chrisa Lourida, Sofoklis Stavrou, Despi- protein which is mainly produced by the syncytiotrophoblast cells of na Mavrogianni, Dimitris Loutradis and Peter Drakakis the placenta during pregnancy and it is involved in a variety of bio- 1st Department of Obstetrics and Gynecology, “Alexandra” General Hospital, logical procedures [1]. The synthesis of the β-subunit of Human Cho- National and Kapodistrian University of Athens, Athens, Greece rionic Gonadotropin (βhCG) begins shortly after fertilization (βhCG been detected in the 2-cell stage embryo [2]) and it reaches its peak in the maternal blood stream at 9-10 weeks of pregnancy. HCG has many functions during normal pregnancy as it is involved in delaying Abstract the apoptosis of the corpus luteum [3], modulating the implantation Background: Human Chorionic Gonadotrophin (hCG) is a heterod- of the blastocyst [4,5], regulating the placentation and angiogenesis imer glycoprotein which is mainly produced by the syncytiotropho- [6-8] and developing maternal immunotolerance [9]. blast cells of the placenta during pregnancy and it is involved in a variety of biological procedures. The β-subunit of hCG is coded by HCG is composed of two subunits α and β.
  • Human Chorionic Gonadotropin Beta Subunit Genes CGB1 and CGB2 Are Transcriptionally Active in Ovarian Cancer

    Human Chorionic Gonadotropin Beta Subunit Genes CGB1 and CGB2 Are Transcriptionally Active in Ovarian Cancer

    Int. J. Mol. Sci. 2013, 14, 12650-12660; doi:10.3390/ijms140612650 OPEN ACCESS International Journal of Molecular Sciences ISSN 1422-0067 www.mdpi.com/journal/ijms Article Human Chorionic Gonadotropin Beta Subunit Genes CGB1 and CGB2 are Transcriptionally Active in Ovarian Cancer Marta Kubiczak 1, Grzegorz P. Walkowiak 1, Ewa Nowak-Markwitz 2 and Anna Jankowska 1,* 1 Department of Cell Biology, Poznan University of Medical Sciences, Rokietnicka 5D, 60-806 Poznan, Poland; E-Mails: [email protected] (M.K.); [email protected] (G.P.W.) 2 Department of Gynecologic Oncology, Poznan University of Medical Sciences, Polna 33, 60-535 Poznan, Poland; E-Mail: [email protected] * Author to whom correspondence should be addressed; E-Mail: [email protected]; Tel.: +48-61-8547-190; Fax: +48-61-8547-169. Received: 1 March 2013; in revised form: 28 March 2013 / Accepted: 9 May 2013 / Published: 17 June 2013 Abstract: Human chorionic gonadotropin beta subunit (CGB) is a marker of pregnancy as well as trophoblastic and nontrophoblastic tumors. CGB is encoded by a cluster of six genes, of which type II genes (CGB3/9, 5 and 8) have been shown to be upregulated in relation to type I genes (CGB6/7) in both placentas and tumors. Recent studies revealed that CGB1 and CGB2, originally considered as pseudogenes, might also be active, however, the protein products of these genes have not yet been identified. Our study demonstrates the presence of CGB1 and CGB2 transcripts in ovarian carcinomas. While CGB1 and CGB2 gene activation was not detected in normal ovaries lacking cancerous development, our study demonstrates the presence of CGB1 and CGB2 transcripts in 41% of analyzed ovarian cancer cases.
  • The Evolution and Genomic Landscape of CGB1 and CGB2 Genes

    The Evolution and Genomic Landscape of CGB1 and CGB2 Genes

    Molecular and Cellular Endocrinology 260–262 (2007) 2–11 The evolution and genomic landscape of CGB1 and CGB2 genes Pille Hallast a, Kristiina Rull a,b, Maris Laan a,∗ a Department of Biotechnology, Institute of Molecular and Cell Biology, University of Tartu, Riia 23, 51010 Tartu, Estonia b Department of Obstetrics and Gynecology, University of Tartu, Estonia Received 12 August 2005; accepted 28 November 2005 Abstract The origin of completely novel proteins is a significant question in evolution. The luteinizing hormone (LHB)/chorionic gonadotropin (CGB) gene cluster in humans contains a candidate example of this process. Two genes in this cluster (CGB1 and CGB2) exhibit nucleotide sequence similarity with the other LHB/CGB genes, but as a result of frameshifting are predicted to encode a completely novel protein. Our analysis of these genes from humans and related primates indicates a recent origin in the lineage specific to humans and African great apes. While the function of these genes is not yet known, they are strongly conserved between human and chimpanzee and exhibit three-fold lower diversity than LHB across human populations with no mutations that would disrupt the coding sequence. The 5-upstream region of CGB1/2 contains most of the promoter sequence of hCG␤ plus a novel region proximal to the putative transcription start site. In silico prediction of putative transcription factor binding sites supports the hypothesis that CGB1 and CGB2 gene products are expressed in, and may contribute to, implantation and placental development. © 2006 Elsevier Ireland Ltd. All rights reserved. Keywords: Chorionic gonadotropin beta 1 and 2; Gene evolution; Polymorphism patterns; Putative promoter region; In silico transcription factor binding site prediction 1.
  • Segmental Duplications and Gene Conversion: Human Luteinizing Hormone/Chorionic Gonadotropin ␤ Gene Cluster

    Segmental Duplications and Gene Conversion: Human Luteinizing Hormone/Chorionic Gonadotropin ␤ Gene Cluster

    Downloaded from genome.cshlp.org on September 25, 2021 - Published by Cold Spring Harbor Laboratory Press Letter Segmental duplications and gene conversion: Human luteinizing hormone/chorionic gonadotropin ␤ gene cluster Pille Hallast, Liina Nagirnaja, Tõnu Margus, and Maris Laan1 Institute of Molecular and Cell Biology, University of Tartu, Riia 23, 51010 Tartu, Estonia Segmental duplicons (>1 kb) of high sequence similarity (>90%) covering >5% of the human genome are characterized by complex sequence variation. Apart from a few well-characterized regions (MHC, ␤-globin), the diversity and linkage disequilibrium (LD) patterns of duplicons and the role of gene conversion in shaping them have been poorly studied. To shed light on these issues, we have re-sequenced the human Luteinizing Hormone/Chorionic Gonadotropin ␤ (LHB/CGB) cluster (19q13.32) of three population samples (Estonians, Mandenka, and Han). The LHB/CGB cluster consists of seven duplicated genes critical in human reproduction. In the LHB/CGB region, high sequence diversity, concentration of gene-conversion acceptor sites, and strong LD colocalize with peripheral genes, whereas central loci are characterized by lower variation, gene-conversion donor activity, and breakdown of LD between close markers. The data highlight an important role of gene conversion in spreading polymorphisms among duplicon copies and generating LD around them. The directionality of gene-conversion events seems to be determined by the localization of a predicted recombination “hotspot” and “warm spot” in the vicinity of the most active acceptor genes at the periphery of the cluster. The data suggest that enriched crossover activity in direct and inverted segmental repeats is in accordance with the formation of palindromic secondary structures promoting double-strand breaks rather than fixed DNA sequence motifs.
  • Novel Insights Into the Expression of CGB1 & 2 Genes by Epithelial

    Novel Insights Into the Expression of CGB1 & 2 Genes by Epithelial

    Middlesex University Research Repository An open access repository of Middlesex University research http://eprints.mdx.ac.uk Burczynska, Beata ORCID: https://orcid.org/0000-0003-4101-8525, Kobrouly, Latifa, Butler, Stephen A., Naase, Mahmoud and Iles, Ray K. (2014) Novel insights into the expression of CGB1 & 2 genes by epithelial cancer cell lines secreting ectopic free hCG. Anticancer Research, 34 (5) . pp. 2239-2248. ISSN 0250-7005 [Article] Published version (with publisher’s formatting) This version is available at: https://eprints.mdx.ac.uk/25831/ Copyright: Middlesex University Research Repository makes the University’s research available electronically. Copyright and moral rights to this work are retained by the author and/or other copyright owners unless otherwise stated. The work is supplied on the understanding that any use for commercial gain is strictly forbidden. A copy may be downloaded for personal, non-commercial, research or study without prior permission and without charge. Works, including theses and research projects, may not be reproduced in any format or medium, or extensive quotations taken from them, or their content changed in any way, without first obtaining permission in writing from the copyright holder(s). They may not be sold or exploited commercially in any format or medium without the prior written permission of the copyright holder(s). Full bibliographic details must be given when referring to, or quoting from full items including the author’s name, the title of the work, publication details where relevant (place, publisher, date), pag- ination, and for theses or dissertations the awarding institution, the degree type awarded, and the date of the award.
  • Novel Rapidly Evolving Hominid Rnas Bind Nuclear Factor 90 and Display Tissue-Restricted Distribution Andrew M

    Published online 13 September 2007 Nucleic Acids Research, 2007, Vol. 35, No. 18 6249–6258 doi:10.1093/nar/gkm668 Novel rapidly evolving hominid RNAs bind nuclear factor 90 and display tissue-restricted distribution Andrew M. Parrott and Michael B. Mathews* Department of Biochemistry and Molecular Biology, New Jersey Medical School, UMDNJ, 185 South Orange Ave., P. O. Box 1709, Newark, NJ 07101-1709, USA Received June 27, 2007; Revised August 13, 2007; Accepted August 13, 2007 ABSTRACT distinct protein, NF45 (D. Guan et al., manuscript in preparation; 13). Nuclear factor 90 (NF90) is a double-stranded Proteins in the NF90 family possess two double- RNA-binding protein implicated in multiple cellular stranded RNA binding motifs (dsRBMs) (14) as well as functions, but with few identified RNA partners. RGG (9) and GQSY (1) nucleic acid binding motifs. Using in vivo cross-linking followed by immuno- Through in vitro reconstitution experiments, the proteins precipitation, we discovered a family of small have been found to interact with coding and non-coding NF90-associated RNAs (snaR). These highly struc- RNAs of cellular (2,3,15–18) and viral origin (5,6,19). tured non-coding RNAs of »117 nucleotides are Most of these RNA species are not abundant in cells, yet expressed in immortalized human cell lines of our earlier work demonstrated that the dsRBMs of NF90 diverse lineages. In human tissues, they are abun- and NF110 are almost completely occupied by cellular dant in testis, with minor distribution in brain, RNA throughout the cell cycle (20). We, therefore, sought placenta and some other organs.
  • You Can Check If Genes Are Captured by the Agilent Sureselect V5 Exome

    You Can Check If Genes Are Captured by the Agilent Sureselect V5 Exome

    IIHG Clinical Exome Sequencing Test Gene Coverage • Whole Exome Sequencing is a targeted capture platform which does not capture the entire exome. Regions not captured by the exome will not be analyzed. o Please note, it is important to understand the absence of a reportable variant in a given gene does not mean there are not pathogenic variants in that gene. • Data sensitivity and specificity for exome testing is variable as gene coverage is not uniform throughout the exome. • The Agilent SureSelect XT Human All Exon v5 kit captures ~98% of Refseq coding base pairs, and >94% of the captured coding bases in the exome are covered at our depth-of-coverage minimum threshold (30 reads). • All test reports include the following information: o Regions of the Symptom Candidate Gene List which were not captured by the current exome capture platform. o Regions of the Symptom Candidate Gene List which were not sequenced to a sufficient depth of coverage to make a clinical diagnosis. • You can check if genes are captured by the Agilent Agilent SureSelect v5 exome capture, and how well those genes are typically covered here. • Explanations for the headings; • Symbol: Gene symbol • Chr: Chromosome • % Captured: the minimum portion of the gene captured by the Agilent SureSelect XT Human All Exon v5 kit. This includes all transcripts for a given gene. o 100.00% = the entire gene is captured o 0.00% = none of the gene is captured • % Covered: the minimum portion of the gene that has at least 30x average coverage when sequenced on the Illumina HiSeq2000 with 100 base pair (bp) paired-end reads for eight CEPH samples.
  • Luteinizing Hormone and Human Chorionic Gonadotropin: Origins Of

    Luteinizing Hormone and Human Chorionic Gonadotropin: Origins Of

    Molecular and Cellular Endocrinology 383 (2014) 203–213 Contents lists available at ScienceDirect Molecular and Cellular Endocrinology journal homepage: www.elsevier.com/locate/mce Review Luteinizing hormone and human chorionic gonadotropin: Origins of difference q ⇑ Janet Choi a, , Johan Smitz b,1 a The Center for Women’s Reproductive Care at Columbia University, New York, NY, United States b UZ Brussel, Vrije Universiteit Brussel, Brussels, Belgium article info abstract Article history: Luteinizing hormone (LH) and human chorionic gonadotropin (hCG) are widely recognized for their roles Received 25 September 2013 in ovulation and the support of early pregnancy. Aside from the timing of expression, however, the dif- Received in revised form 6 December 2013 ferences between LH and hCG have largely been overlooked in the clinical realm because of their similar Accepted 12 December 2013 molecular structures and shared receptor. With technologic advancements, including the development of Available online 21 December 2013 highly purified and recombinant gonadotropins, researchers now appreciate that these hormones are not as interchangeable as once believed. Although they bind to a common receptor, emerging evidence sug- Keywords: gests that LH and hCG have disparate effects on downstream signaling cascades. Increased understanding Gonadotropin of the inherent differences between LH and hCG will foster more effective diagnostic and prognostic Lutropin Luteinizing hormone assays for use in a variety of clinical contexts and support the individualization of treatment strategies Human chorionic gonadotropin for conditions such as infertility. Luteinizing hormone/choriogonadotropin Ó 2013 The Authors. Published by Elsevier Ireland Ltd. All rights reserved. receptor Luteinizing hormone receptor Contents 1. Introduction . ...................................................................................................... 204 2.