CGB2 monoclonal antibody (M02), beta (LHB) subunit gene. The CGB genes are primarily clone 4F8 distinguished by differences in the 5' untranscribed region. This gene was originally thought to be one of the Catalog Number: H00114336-M02 two pseudogenes (CGB1 and CGB2) of CGB subunit, however, detection of CGB1 and CGB2 transcripts in Regulatory Status: For research use only (RUO) vivo, and their presence on the polysomes, suggested that these transcripts are translated. To date, a protein Product Description: Mouse monoclonal antibody product corresponding to CGB2 has not been isolated. raised against a partial recombinant CGB2. The deduced sequence of the hypothetical protein of 132 aa does not share any similarity with that of Clone Name: 4F8 functional CGB subunits (PMID:8954017). However, a 163 aa protein, translated from a different frame, is Immunogen: CGB2 (NP_203696, 1 a.a. ~ 56 a.a) about the same size, and shares 98% identity with other partial recombinant protein with GST tag. MW of the CGB subunits. [provided by RefSeq] GST tag alone is 26 KDa.
Sequence: MSTSPVLAEDIPLRERHVKGAAAVAAAEHGRDMGIQG AASATVPPHQCHPGCGEGG
Host: Mouse
Reactivity: Human
Applications: ELISA, WB-Re (See our web site product page for detailed applications information)
Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols
Isotype: IgG2a Kappa
Storage Buffer: In 1x PBS, pH 7.4
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Entrez GeneID: 114336
Gene Symbol: CGB2
Gene Alias: -
Gene Summary: The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone
Page 1/1
Powered by TCPDF (www.tcpdf.org)