DOCSLIB.ORG

CGB2 Monoclonal Antibody (M02), Clone

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
CGB2 Monoclonal Antibody (M02), Clone CGB2 monoclonal antibody (M02), beta (LHB) subunit gene. The CGB genes are primarily clone 4F8 distinguished by differences in the 5' untranscribed region. This gene was originally thought to be one of the Catalog Number: H00114336-M02 two pseudogenes (CGB1 and CGB2) of CGB subunit, however, detection of CGB1 and CGB2 transcripts in Regulatory Status: For research use only (RUO) vivo, and their presence on the polysomes, suggested that these transcripts are translated. To date, a protein Product Description: Mouse monoclonal antibody product corresponding to CGB2 has not been isolated. raised against a partial recombinant CGB2. The deduced sequence of the hypothetical protein of 132 aa does not share any similarity with that of Clone Name: 4F8 functional CGB subunits (PMID:8954017). However, a 163 aa protein, translated from a different frame, is Immunogen: CGB2 (NP_203696, 1 a.a. ~ 56 a.a) about the same size, and shares 98% identity with other partial recombinant protein with GST tag. MW of the CGB subunits. [provided by RefSeq] GST tag alone is 26 KDa. Sequence: MSTSPVLAEDIPLRERHVKGAAAVAAAEHGRDMGIQG AASATVPPHQCHPGCGEGG Host: Mouse Reactivity: Human Applications: ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Isotype: IgG2a Kappa Storage Buffer: In 1x PBS, pH 7.4 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 114336 Gene Symbol: CGB2 Gene Alias: - Gene Summary: The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone Page 1/1 Powered by TCPDF (www.tcpdf.org).
Load more

Recommended publications
  • Sequence Overlap Between Autosomal and Sex-Linked Probes on the Illumina Humanmethylation27 Microarray
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Genomics 97 (2011) 214–222 Contents lists available at ScienceDirect Genomics journal homepage: www.elsevier.com/locate/ygeno Sequence overlap between autosomal and sex-linked probes on the Illumina HumanMethylation27 microarray Yi-an Chen a,b, Sanaa Choufani a, Jose Carlos Ferreira a,b, Daria Grafodatskaya a, Darci T. Butcher a, Rosanna Weksberg a,b,⁎ a Program in Genetics and Genome Biology, Hospital for Sick Children Research Institute, Toronto, Ontario, Canada b Institute of Medical Science, University of Toronto, Toronto, Ontario, Canada article info abstract Article history: The Illumina Infinium HumanMethylation27 BeadChip (Illumina 27k) microarray is a high-throughput Received 12 August 2010 platform capable of interrogating the human DNA methylome. In a search for autosomal sex-specific DNA Accepted 18 December 2010 methylation using this microarray, we discovered autosomal CpG loci showing significant methylation Available online 4 January 2011 differences between the sexes. However, we found that the majority of these probes cross-reacted with sequences from sex chromosomes. Moreover, we determined that 6–10% of the microarray probes are non- Keywords: specific and map to highly homologous genomic sequences. Using probes targeting different CpGs that are Illumina Infinium HumanMethylation 27 BeadChip exact duplicates of each other, we investigated the precision of these repeat measurements and concluded Non-specific cross-reactive probe that the overall precision of this microarray is excellent. In addition, we identified a small number of probes Sex-specific DNA methylation targeting CpGs that include single-nucleotide polymorphisms.
    [Show full text]
  • Radial Glia Reveal Complex Regulation by the Neuropeptide Secretoneurin
    Transcriptomic and proteomic characterizations of goldfish (Carassius auratus) radial glia reveal complex regulation by the neuropeptide secretoneurin Dillon Da Fonte Thesis submitted to the Faculty of Graduate and Postdoctoral Studies University of Ottawa in partial fulfillment of the requirements for the Master of Science degree in biology Department of Biology Faculty of Science University of Ottawa © Dillon Da Fonte, Ottawa, Canada, 2016 Acknowledgements Finishing this thesis has been both a challenging and rewarding experience. This accomplishment would not have been possible without the never-ending support of colleagues, friends, family. First, I would like to express my most sincere gratitude to my supervisor and mentor, Dr. Vance Trudeau. Thank you for the opportunities you have given me, this experience has truly solidified my passion for research. I appreciate our many conversations that were enjoyed over a beer – it was truly a memorable experience. I would also like to thank my M.Sc. advisory committee, Dr. Michael Jonz and Dr. Marc Ekker for your time and insightful comments. A special thank you to Dr. Chris Martynuik who taught me the bioinformatics needed to analyze both transcriptomic and proteomic data and for all your help during my time at the University of Florida. I would like to also acknowledge my funding support from University of Ottawa, NSERC, and the Michael Smith Foreign Study Award for supporting my research stay at the University of Florida. To all current and past members of TeamENDO, thank you for the sense of community you all instilled in the lab. Both inside and outside the lab, I have made memories with all of you that I will cherish forever.
    [Show full text]
  • Role of Amylase in Ovarian Cancer Mai Mohamed University of South Florida, [email protected]
    University of South Florida Scholar Commons Graduate Theses and Dissertations Graduate School July 2017 Role of Amylase in Ovarian Cancer Mai Mohamed University of South Florida, [email protected] Follow this and additional works at: http://scholarcommons.usf.edu/etd Part of the Pathology Commons Scholar Commons Citation Mohamed, Mai, "Role of Amylase in Ovarian Cancer" (2017). Graduate Theses and Dissertations. http://scholarcommons.usf.edu/etd/6907 This Dissertation is brought to you for free and open access by the Graduate School at Scholar Commons. It has been accepted for inclusion in Graduate Theses and Dissertations by an authorized administrator of Scholar Commons. For more information, please contact [email protected]. Role of Amylase in Ovarian Cancer by Mai Mohamed A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy Department of Pathology and Cell Biology Morsani College of Medicine University of South Florida Major Professor: Patricia Kruk, Ph.D. Paula C. Bickford, Ph.D. Meera Nanjundan, Ph.D. Marzenna Wiranowska, Ph.D. Lauri Wright, Ph.D. Date of Approval: June 29, 2017 Keywords: ovarian cancer, amylase, computational analyses, glycocalyx, cellular invasion Copyright © 2017, Mai Mohamed Dedication This dissertation is dedicated to my parents, Ahmed and Fatma, who have always stressed the importance of education, and, throughout my education, have been my strongest source of encouragement and support. They always believed in me and I am eternally grateful to them. I would also like to thank my brothers, Mohamed and Hussien, and my sister, Mariam. I would also like to thank my husband, Ahmed.
    [Show full text]
  • Human and Chimpanzee Chorionic Gonadotropin Beta Genes Pille Hallast1, Janna Saarela2, Aarno Palotie3,4,5 and Maris Laan*1
    BMC Evolutionary Biology BioMed Central Research article Open Access High divergence in primate-specific duplicated regions: Human and chimpanzee Chorionic Gonadotropin Beta genes Pille Hallast1, Janna Saarela2, Aarno Palotie3,4,5 and Maris Laan*1 Address: 1Department of Biotechnology, Institute of Molecular and Cell Biology, University of Tartu, Riia 23, 51010 Tartu, Estonia, 2Department of Molecular Medicine, National Public Health Institute, Haartmaninkatu 8, 00290 Helsinki, Finland, 3Finnish Genome Center, Biomedicum Helsinki, University of Helsinki, Haartmaninkatu 8, 00290 Helsinki, Finland, 4The Broad Institute of Harvard and MIT, Cambridge Center, Cambridge, MA 02142, USA and 5Wellcome Trust Sanger Institute, Hinxton, Cambridge, CB10 1SA, UK Email: Pille Hallast - [email protected]; Janna Saarela - [email protected]; Aarno Palotie - [email protected]; Maris Laan* - [email protected] * Corresponding author Published: 7 July 2008 Received: 29 August 2007 Accepted: 7 July 2008 BMC Evolutionary Biology 2008, 8:195 doi:10.1186/1471-2148-8-195 This article is available from: http://www.biomedcentral.com/1471-2148/8/195 © 2008 Hallast et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: Low nucleotide divergence between human and chimpanzee does not sufficiently explain the species-specific morphological, physiological and behavioral traits. As gene duplication is a major prerequisite for the emergence of new genes and novel biological processes, comparative studies of human and chimpanzee duplicated genes may assist in understanding the mechanisms behind primate evolution.
    [Show full text]
  • WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T (51) International Patent Classification: David [US/US]; 13539 N . 95th Way, Scottsdale, AZ C12Q 1/68 (2006.01) 85260 (US). (21) International Application Number: (74) Agent: AKHAVAN, Ramin; Caris Science, Inc., 6655 N . PCT/US20 12/0425 19 Macarthur Blvd., Irving, TX 75039 (US). (22) International Filing Date: (81) Designated States (unless otherwise indicated, for every 14 June 2012 (14.06.2012) kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BR, BW, BY, BZ, English (25) Filing Language: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, DO, Publication Language: English DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KN, KP, KR, (30) Priority Data: KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, 61/497,895 16 June 201 1 (16.06.201 1) US MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, 61/499,138 20 June 201 1 (20.06.201 1) US OM, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SC, SD, 61/501,680 27 June 201 1 (27.06.201 1) u s SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, 61/506,019 8 July 201 1(08.07.201 1) u s TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW.
    [Show full text]
  • The Study of the Expression of CGB1 and CGB2 in Human Cancer Tissues
    G C A T T A C G G C A T genes Article The Study of the Expression of CGB1 and CGB2 in Human Cancer Tissues Piotr Białas * , Aleksandra Sliwa´ y , Anna Szczerba y and Anna Jankowska Department of Cell Biology, Poznan University of Medical Sciences, Rokietnicka 5D, 60-806 Pozna´n,Poland; [email protected] (A.S.);´ [email protected] (A.S.); [email protected] (A.J.) * Correspondence: [email protected]; Tel.: +48-6185-4-71-89 These authors contributed equally to this work. y Received: 14 August 2020; Accepted: 15 September 2020; Published: 17 September 2020 Abstract: Human chorionic gonadotropin (hCG) is a well-known hormone produced by the trophoblast during pregnancy as well as by both trophoblastic and non-trophoblastic tumors. hCG is built from two subunits: α (hCGα) and β (hCGβ). The hormone-specific β subunit is encoded by six allelic genes: CGB3, CGB5, CGB6, CGB7, CGB8, and CGB9, mapped to the 19q13.32 locus. This gene cluster also encompasses the CGB1 and CGB2 genes, which were originally considered to be pseudogenes, but as documented by several studies are transcriptionally active. Even though the protein products of these genes have not yet been identified, based on The Cancer Genome Atlas (TCGA) database analysis we showed that the mutual presence of CGB1 and CGB2 transcripts is a characteristic feature of cancers of different origin, including bladder urothelial carcinoma, cervical squamous cell carcinoma, esophageal carcinoma, head and neck squamous cell carcinoma, ovarian serous cystadenocarcinoma, lung squamous cell carcinoma, pancreatic adenocarcinoma, rectum adenocacinoma, testis germ cell tumors, thymoma, uterine corpus endometrial carcinoma and uterine carcinosarcoma.
    [Show full text]
  • CGB2 (NM 033378) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG221679 CGB2 (NM_033378) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: CGB2 (NM_033378) Human Tagged ORF Clone Tag: TurboGFP Symbol: CGB2 Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG221679 representing NM_033378 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCAAAGGGGCTGCTGCTGTTGCTGCTGCTGAGCATGGGCGGGACATGGGCATCCAAGGAGCCGCTTC GGCCACGGTGCCGCCCCATCAATGCCACCCTGGCTGTGGAGAAGGAGGGCTGCCCCGTGTGCATCACCGT CAACACCACCATCTGTGCCGGCTACTGCCCCACCATGACCCGCGTGCTGCAGGGGGTCCTGCCGGCCCTG CCTCAGGTGGTGTGCAACTACCGCGATGTGCGCTTCGAGTCCATCCGGCTCCCTGGCTGCCCGCGCGGCG TGAACCCCGTGGTCTCCTACGCCGTGGCTCTCAGCTGTCAATGTGCACTCTGCCGCCGCAGCACCACTGA CTGCGGGGGTCCCAAGGACCACCCCTTGACCTGTGATGACCCCCGCTTCCAGGCCTCCTCTTCCTCAAAG GCCCCTCCCCCCAGCCTTCCAAGCCCATCCCGACTCCCGGGGCCCTCAGACACCCCGATCCTCCCACAA ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG221679 representing NM_033378 Red=Cloning site Green=Tags(s) MSKGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPAL PQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQASSSSK APPPSLPSPSRLPGPSDTPILPQ TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic
    [Show full text]
  • WO 2013/022995 A2 14 February 2013 (14.02.2013) P O P C T
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization I International Bureau (10) International Publication Number (43) International Publication Date WO 2013/022995 A2 14 February 2013 (14.02.2013) P O P C T (51) International Patent Classification: David [US/US]; 13539 N . 95th Way, Scottsdale, AZ G01N 33/53 (2006.01) 85260 (US). (21) International Application Number: (74) Agent: AKHAVAN, Ramin; Caris Science, Inc., 6655 N . PCT/US20 12/050030 Macarthur Blvd., Irving, TX 75039 (US). (22) International Filing Date: (81) Designated States (unless otherwise indicated, for every 8 August 2012 (08.08.2012) kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, English (25) Filing Language: BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, Publication Language: English DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KN, KP, (30) Priority Data: KR, KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, 61/521,333 8 August 201 1 (08.08.201 1) US ME, MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, 61/523,763 15 August 201 1 (15.08.201 1) US NO, NZ, OM, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, 61/526,623 23 August 201 1 (23.08.201 1) u s SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, 61/529,762 31 August 201 1 (3 1.08.201 1) u s TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, 61/534,352 13 September 201 1 (13.09.201 1) u s ZW.
    [Show full text]
  • A Novel Two-Promoter-One-Gene System of the Chorionic Gonadotropin B Gene Enables Tissue-Specific Expression
    285 A novel two-promoter-one-gene system of the chorionic gonadotropin b gene enables tissue-specific expression Christian Adams*, Alexander Henke* and Jo¨ rg Gromoll Institute of Reproductive and Regenerative Biology, Centre of Reproduction and Andrology, University Hospital Mu¨nster, Domagkstrasse 11, 48129 Mu¨nster, Germany (Correspondence should be addressed to J Gromoll; Email: [email protected]) *(C Adams and A Henke contributed equally to this work) (A Henke is now at Medical Research Council, Centre for Reproductive Health, The Queen’s Medical Research Institute, 47 Little France Crescent, Edinburgh EH16 4TJ, Scotland, UK) Abstract The New World monkey (NWM), Callithrix jacchus, a preferred model in medical research, displays an interesting endocrine regulation of reproduction: LH, the heterodimeric glycoprotein hormone, is functionally replaced by the chorionic gonadotropin (CG), a hormone indispensable for establishment of pregnancy in humans and normally expressed in the placenta. In the marmoset pituitary, the expression of the b-subunit (CGB) gene is regulated similar to human LH b-subunit, but its placental regulation is unknown. This study intended to decipher the underlying mechanism of tissue-specific expression of CGB in the marmoset placenta. We identified a new placental transcriptional start site, described a new, previously undiscovered exon, and define a novel placental core promoter in the marmoset CGB gene. This promoter contains a TATA box and binding sites for activating protein 2 and selective promoter factor 1, the latter acting synergistically by forming a regulation cassette. Differential first exon usage directed the tissue-specific expression. Methylation analyses revealed a tissue-specific pattern in the placental promoter indicating additional epigenetic regulation of gene expression.
    [Show full text]
  • CGB2 Antibody (N-Term) Blocking Peptide Synthetic Peptide Catalog # Bp17908a
    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 CGB2 Antibody (N-term) Blocking Peptide Synthetic peptide Catalog # BP17908a Specification CGB2 Antibody (N-term) Blocking Peptide CGB2 Antibody (N-term) Blocking Peptide - - Background Product Information RelevanceHuman chorionic gonadotropin Primary Accession Q6NT52 (hCG) is a glycoprotein hormone produced by trophoblastic cells of the placenta beginning 10 to 12 days after conception. Maintenance of CGB2 Antibody (N-term) Blocking Peptide - Additional Information the fetus in the first trimester of pregnancy requires the production of hCG, which binds to the corpus luteum of the ovary which is Gene ID 114336 stimulated to produce progesterone which in turn maintains the secretory endometrium. The Other Names beta subunit of chorionic gonadotropin (CG) is Choriogonadotropin subunit beta variant 2, encoded by 6 highly homologous genes which CGB2 are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the Format Peptides are lyophilized in a solid powder luteinizing hormone beta subunit gene. format. Peptides can be reconstituted in solution using the appropriate buffer as needed. Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C. Precautions This product is for research use only. Not for use in diagnostic or therapeutic procedures. CGB2 Antibody (N-term) Blocking Peptide - Protein Information Name CGB2 Cellular Location Secreted. Tissue Location Expressed in placenta, testis and pituitary. CGB2 Antibody (N-term) Blocking Peptide - Protocols Page 1/2 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 Provided below are standard protocols that you may find useful for product applications.
    [Show full text]
  • New Insights Into the Evolution of Chorionic Gonadotrophin Alexander Henke, Jörg Gromoll
    Mini-Review: New insights into the evolution of chorionic gonadotrophin Alexander Henke, Jörg Gromoll To cite this version: Alexander Henke, Jörg Gromoll. Mini-Review: New insights into the evolution of chori- onic gonadotrophin. Molecular and Cellular Endocrinology, Elsevier, 2008, 291 (1-2), pp.11. 10.1016/j.mce.2008.05.009. hal-00532027 HAL Id: hal-00532027 https://hal.archives-ouvertes.fr/hal-00532027 Submitted on 4 Nov 2010 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Accepted Manuscript Title: Mini-Review: New insights into the evolution of chorionic gonadotrophin Authors: Alexander Henke, Jorg¨ Gromoll PII: S0303-7207(08)00225-6 DOI: doi:10.1016/j.mce.2008.05.009 Reference: MCE 6881 To appear in: Molecular and Cellular Endocrinology Received date: 12-2-2008 Revised date: 17-5-2008 Accepted date: 19-5-2008 Please cite this article as: Henke, A., Gromoll, J., Mini-Review: New insights into the evolution of chorionic gonadotrophin, Molecular and Cellular Endocrinology (2007), doi:10.1016/j.mce.2008.05.009 This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript.
    [Show full text]
  • The Correlation Between CGB Gene Splice Variants in Women with Re- Current Spontaneous Abortions
    Psarris A, et al., J Reprod Med Gynecol Obstet 2019, 4: 027 DOI: 10.24966/RMGO-2574/100027 HSOA Journal of Reproductive Medicine, Gynaecology & Obstetrics Original Research variant (627bp) was expressed in all the women of the study (both The Correlation between CGB study group and control group). Gene Splice Variants in Women Keywords: CGB splice variants; HCG genes; Recurrent miscar- with Recurrent Spontaneous riage; Recurrent spontaneous abortions Abortions Introduction Human Chorionic Gonadotrophin (hCG) is a heterodimer glyco- Alexandros Psarris*, Chrisa Lourida, Sofoklis Stavrou, Despi- protein which is mainly produced by the syncytiotrophoblast cells of na Mavrogianni, Dimitris Loutradis and Peter Drakakis the placenta during pregnancy and it is involved in a variety of bio- 1st Department of Obstetrics and Gynecology, “Alexandra” General Hospital, logical procedures [1]. The synthesis of the β-subunit of Human Cho- National and Kapodistrian University of Athens, Athens, Greece rionic Gonadotropin (βhCG) begins shortly after fertilization (βhCG been detected in the 2-cell stage embryo [2]) and it reaches its peak in the maternal blood stream at 9-10 weeks of pregnancy. HCG has many functions during normal pregnancy as it is involved in delaying Abstract the apoptosis of the corpus luteum [3], modulating the implantation Background: Human Chorionic Gonadotrophin (hCG) is a heterod- of the blastocyst [4,5], regulating the placentation and angiogenesis imer glycoprotein which is mainly produced by the syncytiotropho- [6-8] and developing maternal immunotolerance [9]. blast cells of the placenta during pregnancy and it is involved in a variety of biological procedures. The β-subunit of hCG is coded by HCG is composed of two subunits α and β.
    [Show full text]