DOCSLIB.ORG

Arp58546 P050

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Arp58546 P050 Aviva Systems Biology TUFM antibody - middle region (ARP58546_P050) Product Number ARP58546_P050 Product Page http://www.avivasysbio.com/tufm-antibody-middle-region-arp58546-p050.html Product Name TUFM antibody - middle region (ARP58546_P050) Size 100 ul Gene Symbol TUFM Alias Symbols COXPD4, EF-TuMT, EFTU, P43 Protein Size (# AA) 455 amino acids Molecular Weight 50kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 7284 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Tu translation elongation factor, mitochondrial Name Description This is a rabbit polyclonal antibody against TUFM. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM Target Reference Valente,L., (2007) Am. J. Hum. Genet. 80 (1), 44-58 Description of TUFM is a protein which participates in protein translation in mitochondria. Mutations in Target this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. Protein Interactions FAM9B; FUNDC1; CMTM5; ARL6IP1; HUWE1; FUS; SUMO2; SUMO3; SPRTN; UBC; MDM2; ASB12; ASB14; ASB10; ASB17; SUZ12; BMI1; RNF2; TUBB2A; XPO1; TUBB6; CAMK1D; NSFL1C; IPO9; UBXN1; DCPS; PROSC; PDIA4; PLAA; GTF3C4; NAE1; PPP5C; PPP1R2; PAFAH1B2; HK1; HEXB; GAPDH; Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Blocking Peptide For anti-TUFM (ARP58546_P050) antibody is Catalog # AAP58546 (Previous Catalog # AAPP34728) Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TUFM Complete Anti-TUFM (ARP58546_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TUFM. Swissprot Id P49411 Protein Name Elongation factor Tu, mitochondrial Publications Clemente, P. et al. hCOA3 stabilizes cytochrome c oxidase 1 (COX1) and promotes cytochrome c oxidase assembly in human mitochondria. J. Biol. Chem. 288, 8321-31 (2013). WB, Dog, Human, Pig, Horse, Rabbit, Rat, Guinea pig, Bovine, Mouse, Zebrafish, Yeast 23362268 Sample Type TUFM is supported by BioGPS gene expression data to be expressed in HeLa Confirmation Protein Accession NP_003312 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TUFM. Nucleotide NM_003321 Accession # Replacement Item This antibody may replace item sc-105322 from Santa Cruz Biotechnology. Conjugation ARP58546_P050-FITC Conjugated Options ARP58546_P050-HRP Conjugated ARP58546_P050-Biotin Conjugated CB Replacement sc-105322; sc-12990; sc-12991; sc-21758; sc-35266; sc-367739; sc-393924 Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish Application WB Predicted Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Homology Based Rabbit: 93%; Rat: 93%; Yeast: 77%; Zebrafish: 86% on Immunogen Sequence Image 1: Human Fetal Lung Host: Rabbit Target Name: TUFM Sample Type: Human Fetal Lung Antibody Dilution: 1.0ug/ml Image 2: Human HeLa WB Suggested Anti-TUFM Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Hela cell lysate TUFM is supported by BioGPS gene expression data to be expressed in HeLa AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2.
Load more

Recommended publications
  • Microdeletions in 16P11.2 and 13Q31.3 Associated with Developmental Delay and Generalized Overgrowth
    Microdeletions in 16p11.2 and 13q31.3 associated with developmental delay and generalized overgrowth A.M. George1, J. Taylor2 and D.R. Love1 1Diagnostic Genetics, LabPlus, Auckland City Hospital, Auckland, New Zealand 2Northern Regional Genetic Service, Auckland City Hospital, Auckland, New Zealand Corresponding author: D.R. Love E-mail: [email protected] Genet. Mol. Res. 11 (3): 3133-3137 (2012) Received November 28, 2011 Accepted July 18, 2012 Published September 3, 2012 DOI http://dx.doi.org/10.4238/2012.September.3.1 ABSTRACT. Chromosome microarray analysis of patients with developmental delay has provided evidence of small deletions or duplications associated with this clinical phenotype. In this context, a 7.1- to 8.7-Mb interstitial deletion of chromosome 16 is well documented, but within this interval a rare 200-kb deletion has recently been defined that appears to be associated with obesity, or developmental delay together with overgrowth. We report a patient carrying this rare deletion, who falls into the latter clinical category, but who also carries a second very rare deletion in 13q31.3. It remains unclear if this maternally inherited deletion acts as a second copy number variation leading to pathogenic variation, or is non-causal and the true modifiers are yet to be determined. Key words: Developmental delay; Obesity; Overgrowth; GPC5; SH2B1 Genetics and Molecular Research 11 (3): 3133-3137 (2012) ©FUNPEC-RP www.funpecrp.com.br A.M. George et al. 3134 INTRODUCTION Current referrals for chromosome microarray analysis (CMA) are primarily for de- termining the molecular basis of developmental delay and autistic spectrum disorder in child- hood.
    [Show full text]
  • Autism Multiplex Family with 16P11.2P12.2 Microduplication Syndrome in Monozygotic Twins and Distal 16P11.2 Deletion in Their Brother
    European Journal of Human Genetics (2012) 20, 540–546 & 2012 Macmillan Publishers Limited All rights reserved 1018-4813/12 www.nature.com/ejhg ARTICLE Autism multiplex family with 16p11.2p12.2 microduplication syndrome in monozygotic twins and distal 16p11.2 deletion in their brother Anne-Claude Tabet1,2,3,4, Marion Pilorge2,3,4, Richard Delorme5,6,Fre´de´rique Amsellem5,6, Jean-Marc Pinard7, Marion Leboyer6,8,9, Alain Verloes10, Brigitte Benzacken1,11,12 and Catalina Betancur*,2,3,4 The pericentromeric region of chromosome 16p is rich in segmental duplications that predispose to rearrangements through non-allelic homologous recombination. Several recurrent copy number variations have been described recently in chromosome 16p. 16p11.2 rearrangements (29.5–30.1 Mb) are associated with autism, intellectual disability (ID) and other neurodevelopmental disorders. Another recognizable but less common microdeletion syndrome in 16p11.2p12.2 (21.4 to 28.5–30.1 Mb) has been described in six individuals with ID, whereas apparently reciprocal duplications, studied by standard cytogenetic and fluorescence in situ hybridization techniques, have been reported in three patients with autism spectrum disorders. Here, we report a multiplex family with three boys affected with autism, including two monozygotic twins carrying a de novo 16p11.2p12.2 duplication of 8.95 Mb (21.28–30.23 Mb) characterized by single-nucleotide polymorphism array, encompassing both the 16p11.2 and 16p11.2p12.2 regions. The twins exhibited autism, severe ID, and dysmorphic features, including a triangular face, deep-set eyes, large and prominent nasal bridge, and tall, slender build. The eldest brother presented with autism, mild ID, early-onset obesity and normal craniofacial features, and carried a smaller, overlapping 16p11.2 microdeletion of 847 kb (28.40–29.25 Mb), inherited from his apparently healthy father.
    [Show full text]
  • DNA Topoisomerases and Cancer Topoisomerases and TOP Genes in Humans Humans Vs
    DNA Topoisomerases Review DNA Topoisomerases And Cancer Topoisomerases and TOP Genes in Humans Humans vs. Escherichia Coli Topoisomerase differences Comparisons Topoisomerase and genomes Top 1 Top1 and Top2 differences Relaxation of DNA Top1 DNA supercoiling DNA supercoiling In the context of chromatin, where the rotation of DNA is constrained, DNA supercoiling (over- and under-twisting and writhe) is readily generated. TOP1 and TOP1mt remove supercoiling by DNA untwisting, acting as “swivelases”, whereas TOP2a and TOP2b remove writhe, acting as “writhases” at DNA crossovers (see TOP2 section). Here are some basic facts concerning DNA supercoiling that are relevant to topoisomerase activity: • Positive supercoiling (Sc+) tightens the DNA helix whereas negative supercoiling (Sc-) facilitates the opening of the duplex and the generation of single-stranded segments. • Nucleosome formation and disassembly absorbs and releases Sc-, respectively. • Polymerases generate Sc+ ahead and Sc- behind their tracks. • Excess of Sc+ arrests DNA tracking enzymes (helicases and polymerases), suppresses transcription elongation and initiation, and destabilizes nucleosomes. • Sc- facilitates DNA melting during the initiation of replication and transcription, D-loop formation and homologous recombination and nucleosome formation. • Excess of Sc- favors the formation of alternative DNA structures (R-loops, guanine quadruplexes, right-handed DNA (Z-DNA), plectonemic structures), which then absorb Sc- upon their formation and attract regulatory proteins. The
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Deoxyguanosine Depurination and Yield DNA–Protein Cross-Links in Nucleosome Core Particles and Cells
    Histone tails decrease N7-methyl-2′-deoxyguanosine depurination and yield DNA–protein cross-links in nucleosome core particles and cells Kun Yanga, Daeyoon Parkb, Natalia Y. Tretyakovac, and Marc M. Greenberga,1 aDepartment of Chemistry, Johns Hopkins University, Baltimore, MD 21218; bDepartment of Biochemistry, Molecular Biology and Biophysics, University of Minnesota, Twin Cities, Minneapolis, MN 55417; and cDepartment of Medicinal Chemistry, University of Minnesota, Twin Cities, Minneapolis, MN 55417 Edited by Cynthia J. Burrows, University of Utah, Salt Lake City, UT, and approved October 18, 2018 (received for review August 6, 2018) Monofunctional alkylating agents preferentially react at the adducts. DPC formation between histone proteins and MdG was N7 position of 2′-deoxyguanosine in duplex DNA. Methylated also observed in MMS-treated V79 Chinese hamster lung cells. DNA, such as that produced by methyl methanesulfonate (MMS) Intracellular DPC formation from MdG could have significant and temozolomide, exists for days in organisms. The predominant biological effects. consequence of N7-methyl-2′-deoxyguanosine (MdG) is widely be- Compared with other DNA lesions, MdG minimally perturbs lieved to be abasic site (AP) formation via hydrolysis, a process duplex structure (12). The steric effects of N7-methylation within that is slow in free DNA. Examination of MdG reactivity within the major groove are minimal, and the aromatic planar structure nucleosome core particles (NCPs) provided two general observa- is maintained. Although the Watson–Crick hydrogen bonding tions. MdG depurination rate constants are reduced in NCPs com- pattern of dG is retained, recent structural studies raise the pared with when the identical DNA sequence is free in solution.
    [Show full text]
  • Table SI. Genes Upregulated ≥ 2-Fold by MIH 2.4Bl Treatment Affymetrix ID
    Table SI. Genes upregulated 2-fold by MIH 2.4Bl treatment Fold UniGene ID Description Affymetrix ID Entrez Gene Change 1558048_x_at 28.84 Hs.551290 231597_x_at 17.02 Hs.720692 238825_at 10.19 93953 Hs.135167 acidic repeat containing (ACRC) 203821_at 9.82 1839 Hs.799 heparin binding EGF like growth factor (HBEGF) 1559509_at 9.41 Hs.656636 202957_at 9.06 3059 Hs.14601 hematopoietic cell-specific Lyn substrate 1 (HCLS1) 202388_at 8.11 5997 Hs.78944 regulator of G-protein signaling 2 (RGS2) 213649_at 7.9 6432 Hs.309090 serine and arginine rich splicing factor 7 (SRSF7) 228262_at 7.83 256714 Hs.127951 MAP7 domain containing 2 (MAP7D2) 38037_at 7.75 1839 Hs.799 heparin binding EGF like growth factor (HBEGF) 224549_x_at 7.6 202672_s_at 7.53 467 Hs.460 activating transcription factor 3 (ATF3) 243581_at 6.94 Hs.659284 239203_at 6.9 286006 Hs.396189 leucine rich single-pass membrane protein 1 (LSMEM1) 210800_at 6.7 1678 translocase of inner mitochondrial membrane 8 homolog A (yeast) (TIMM8A) 238956_at 6.48 1943 Hs.741510 ephrin A2 (EFNA2) 242918_at 6.22 4678 Hs.319334 nuclear autoantigenic sperm protein (NASP) 224254_x_at 6.06 243509_at 6 236832_at 5.89 221442 Hs.374076 adenylate cyclase 10, soluble pseudogene 1 (ADCY10P1) 234562_x_at 5.89 Hs.675414 214093_s_at 5.88 8880 Hs.567380; far upstream element binding protein 1 (FUBP1) Hs.707742 223774_at 5.59 677825 Hs.632377 small nucleolar RNA, H/ACA box 44 (SNORA44) 234723_x_at 5.48 Hs.677287 226419_s_at 5.41 6426 Hs.710026; serine and arginine rich splicing factor 1 (SRSF1) Hs.744140 228967_at 5.37
    [Show full text]
  • Associated 16P11.2 Deletion in Drosophila Melanogaster
    ARTICLE DOI: 10.1038/s41467-018-04882-6 OPEN Pervasive genetic interactions modulate neurodevelopmental defects of the autism- associated 16p11.2 deletion in Drosophila melanogaster Janani Iyer1, Mayanglambam Dhruba Singh1, Matthew Jensen1,2, Payal Patel 1, Lucilla Pizzo1, Emily Huber1, Haley Koerselman3, Alexis T. Weiner 1, Paola Lepanto4, Komal Vadodaria1, Alexis Kubina1, Qingyu Wang 1,2, Abigail Talbert1, Sneha Yennawar1, Jose Badano 4, J. Robert Manak3,5, Melissa M. Rolls1, Arjun Krishnan6,7 & 1234567890():,; Santhosh Girirajan 1,2,8 As opposed to syndromic CNVs caused by single genes, extensive phenotypic heterogeneity in variably-expressive CNVs complicates disease gene discovery and functional evaluation. Here, we propose a complex interaction model for pathogenicity of the autism-associated 16p11.2 deletion, where CNV genes interact with each other in conserved pathways to modulate expression of the phenotype. Using multiple quantitative methods in Drosophila RNAi lines, we identify a range of neurodevelopmental phenotypes for knockdown of indi- vidual 16p11.2 homologs in different tissues. We test 565 pairwise knockdowns in the developing eye, and identify 24 interactions between pairs of 16p11.2 homologs and 46 interactions between 16p11.2 homologs and neurodevelopmental genes that suppress or enhance cell proliferation phenotypes compared to one-hit knockdowns. These interac- tions within cell proliferation pathways are also enriched in a human brain-specific network, providing translational relevance in humans. Our study indicates a role for pervasive genetic interactions within CNVs towards cellular and developmental phenotypes. 1 Department of Biochemistry and Molecular Biology, The Pennsylvania State University, University Park, PA 16802, USA. 2 Bioinformatics and Genomics Program, The Huck Institutes of the Life Sciences, The Pennsylvania State University, University Park, PA 16802, USA.
    [Show full text]
  • Ubiquitin and Ubiquitin-Like Proteins Are Essential Regulators of DNA Damage Bypass
    cancers Review Ubiquitin and Ubiquitin-Like Proteins Are Essential Regulators of DNA Damage Bypass Nicole A. Wilkinson y, Katherine S. Mnuskin y, Nicholas W. Ashton * and Roger Woodgate * Laboratory of Genomic Integrity, National Institute of Child Health and Human Development, National Institutes of Health, 9800 Medical Center Drive, Rockville, MD 20850, USA; [email protected] (N.A.W.); [email protected] (K.S.M.) * Correspondence: [email protected] (N.W.A.); [email protected] (R.W.); Tel.: +1-301-435-1115 (N.W.A.); +1-301-435-0740 (R.W.) Co-first authors. y Received: 29 August 2020; Accepted: 29 September 2020; Published: 2 October 2020 Simple Summary: Ubiquitin and ubiquitin-like proteins are conjugated to many other proteins within the cell, to regulate their stability, localization, and activity. These modifications are essential for normal cellular function and the disruption of these processes contributes to numerous cancer types. In this review, we discuss how ubiquitin and ubiquitin-like proteins regulate the specialized replication pathways of DNA damage bypass, as well as how the disruption of these processes can contribute to cancer development. We also discuss how cancer cell survival relies on DNA damage bypass, and how targeting the regulation of these pathways by ubiquitin and ubiquitin-like proteins might be an effective strategy in anti-cancer therapies. Abstract: Many endogenous and exogenous factors can induce genomic instability in human cells, in the form of DNA damage and mutations, that predispose them to cancer development. Normal cells rely on DNA damage bypass pathways such as translesion synthesis (TLS) and template switching (TS) to replicate past lesions that might otherwise result in prolonged replication stress and lethal double-strand breaks (DSBs).
    [Show full text]
  • Characterization of SPRTN, the First Mammalian Metalloprotease That Repairs DNA-Protein-Crosslinks
    Aus dem Fachbereich Medizin der Johann Wolfgang Goethe-Universität Frankfurt am Main betreut am Gustav Embden-Zentrum der Biochemie Institut für Biochemie II (Kardiovaskuläre Biochemie) Direktor: Prof. Dr. Ivan Dikic Characterization of SPRTN, the first mammalian metalloprotease that repairs DNA-protein-crosslinks Dissertation zur Erlangung des Doktorgrades der Medizin des Fachbereichs Medizin der Johann Wolfgang Goethe-Universität Frankfurt am Main vorgelegt von Stefan Prgomet, dr. med. aus Düsseldorf Frankfurt am Main, 2019 1 Dekan: Prof. Dr. Stefan Zeuzem Referent/in: Prof. Dr. Ivan Dikic Korreferent/in: Prof. Dr. Jörg Trojan Tag der mündlichen Prüfung: 12.05.2020 2 Contents 1 Summary / Zusammenfassung .................................................................... 6 / 8 2 Introduction ...................................................................................................... 10 2.1 SPRTN regulates a progeria and tumorigenesis axis ............................ 10 2.1.1 RJALS-syndrome as the clinical manifestation of SPRTN malfunction 10 2.1.2 SPRTN acts in DNA damage repair ..................................................... 11 2.1.3 SPRTN’s essential function remains unknown ..................................... 13 2.2 DNA damage response (DDR) .................................................................. 16 2.2.1 Types of DNA-lesions ........................................................................... 16 2.2.2 DNA damage repair mechanisms ......................................................... 18 2.2.3
    [Show full text]
  • 1 USP11 Deubiquitinates Monoubiquitinated SPRTN to Repair DNA-Protein Crosslinks Megan Perry,1 Sai Sundeep Kollala,1 Meghan Bieg
    bioRxiv preprint doi: https://doi.org/10.1101/2020.06.30.180471; this version posted July 1, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. USP11 deubiquitinates monoubiquitinated SPRTN to repair DNA-protein crosslinks Megan Perry,1 Sai Sundeep Kollala,1 Meghan Biegert,1 Grace Su,2 Manohar Kodavati,3 Halle Mallard,1 Natasha Kreiling,1 Alexander Holbrook,1 and Gargi Ghosal1,4* 1Department of Genetics, Cell Biology and Anatomy, University of Nebraska Medical Center, Omaha, NE 68198 2Department of Biology, Doane University, Crete, NE 68333 3Department of Radiation Oncology, Houston Methodist Research Institute, Houston, TX 77030 4Fred and Pamela Buffett Cancer Center, Omaha NE 68105 *Correspondence: [email protected] SUMMARY DNA-protein crosslinks (DPCs) are toxic DNA lesions that interfere with DNA metabolic processes such as replication, transcription and recombination. SPRTN is a replication-coupled DNA-dependent metalloprotease that cleaves proteins crosslinked to DNA to promote DPC repair. SPRTN function is tightly regulated by a monoubiquitin switch that controls SPRTN chromatin accessibility during DPC repair. The deubiquitinase regulating SPRTN function in DPC repair is unknown. Here, we identify USP11 as a SPRTN deubiquitinase. USP11 interacts with SPRTN and cleaves monoubiquitinated SPRTN in cells and in vitro. USP11 depletion impairs SPRTN deubiquitination in response to formaldehyde-induced DPCs. Loss of USP11 causes an accumulation of unrepaired DPCs and cellular hypersensitivity to treatment with DPC- inducing agents. Our findings elucidate the function of USP11 in the regulation of SPRTN monoubiquitination and SPRTN-mediated DPC repair.
    [Show full text]
  • Mechanism and Regulation of DNA-Protein Crosslink Repair by the DNA-Dependent Metalloprotease SPRTN
    Lawrence Berkeley National Laboratory Recent Work Title Mechanism and Regulation of DNA-Protein Crosslink Repair by the DNA-Dependent Metalloprotease SPRTN. Permalink https://escholarship.org/uc/item/01s2z6gk Journal Molecular cell, 64(4) ISSN 1097-2765 Authors Stingele, Julian Bellelli, Roberto Alte, Ferdinand et al. Publication Date 2016-11-01 DOI 10.1016/j.molcel.2016.09.031 Peer reviewed eScholarship.org Powered by the California Digital Library University of California Article Mechanism and Regulation of DNA-Protein Crosslink Repair by the DNA-Dependent Metalloprotease SPRTN Graphical Abstract Authors Julian Stingele, Roberto Bellelli, Ferdinand Alte, ..., J. Mark Skehel, Michael Groll, Simon J. Boulton Correspondence [email protected] In Brief Stingele et al. discover the SPRTN metalloprotease to be crucial for DNA- protein crosslink repair in higher eukaryotes. In addition, several regulatory principles constraining SPRTN’s potentially toxic activity are described: a ubiquitin switch controlling chromatin access, a DNA switch triggering protease activity, and a negative feedback loop based on autocatalytic cleavage. Highlights Accession Numbers d The SPRTN metalloprotease repairs DNA-protein crosslinks 5JIG 5LN5 d A DNA switch controls SPRTN’s protease activity d A ubiquitin switch controls chromatin access of SPRTN d Structural insights reveal unique features of the SPRTN/Wss1 protease family Stingele et al., 2016, Molecular Cell 64, 688–703 November 17, 2016 ª 2016 The Author(s). Published by Elsevier Inc. http://dx.doi.org/10.1016/j.molcel.2016.09.031 Molecular Cell Article Mechanism and Regulation of DNA-Protein Crosslink Repair by the DNA-Dependent Metalloprotease SPRTN Julian Stingele,1 Roberto Bellelli,1 Ferdinand Alte,2 Graeme Hewitt,1 Grzegorz Sarek,1 Sarah L.
    [Show full text]
  • Identification of Hub Prognosis-Associated Oxidative Stress Genes in Skin Cutaneous Melanoma Using Integrated Bioinformatic Analysis
    European Review for Medical and Pharmacological Sciences 2021; 25: 2927-2940 Identification of hub prognosis-associated oxidative stress genes in skin cutaneous melanoma using integrated bioinformatic analysis T.-Y. REN1, Y.-X. ZHANG2, W. HU1 1Department of Spine and Joint Surgery, Guilin Peoples’ Hospital, Guilin, China 2Department of Anesthesia, Guilin Peoples’ Hospital, Guilin, China Tianyu Ren and Yuxuan Zhang contributed equally to this manuscript 1 Abstract. – OBJECTIVE: Oxidative stress threat to health . In 2018, 287,723 new patients (OS) significantly correlates with cancer pro- were diagnosed with melanoma around the world gression. However, targeting OS has not been and 21.1% of these patients passed away from the considered as a therapeutic strategy in skin cu- disease2. Metastatic SKCM results in the greater taneous melanoma (SKCM) due to a lack of sys- 3 tematical studies on validated biomarkers. The number of deaths related to skin tumors . Patients work presented here aimed to identify hub prog- diagnosed with SKCM in stages I and II have a nosis-associated OS genes in SKCM and gener- 10-year overall survival rate of 75 to 98%4. How- ated an effective predictive model. ever, one-third of these patients develop metastat- PATIENTS AND METHODS: Gene expression ic melanoma. In contrast, for SKCM patients di- profiles of SKCM samples and normal skin tis- agnosed in stages IIIA to IIID, the 10-year overall sues were obtained from the Genotype-Tissue Expression (GTEx) and The Cancer Genome At- survival rate is decreased and ranges between las (TCGA) databases to identify differentially 24-88%. These data suggest that early diagnosis expressed OS genes.
    [Show full text]