Aviva Systems Biology TUFM antibody - middle region (ARP58546_P050) Product Number ARP58546_P050 Product Page http://www.avivasysbio.com/tufm-antibody-middle-region-arp58546-p050.html Product Name TUFM antibody - middle region (ARP58546_P050) Size 100 ul Gene Symbol TUFM Alias Symbols COXPD4, EF-TuMT, EFTU, P43 Protein Size (# AA) 455 amino acids Molecular Weight 50kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 7284 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Tu translation elongation factor, mitochondrial Name Description This is a rabbit polyclonal antibody against TUFM. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM Target Reference Valente,L., (2007) Am. J. Hum. Genet. 80 (1), 44-58 Description of TUFM is a protein which participates in protein translation in mitochondria. Mutations in Target this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. Protein Interactions FAM9B; FUNDC1; CMTM5; ARL6IP1; HUWE1; FUS; SUMO2; SUMO3; SPRTN; UBC; MDM2; ASB12; ASB14; ASB10; ASB17; SUZ12; BMI1; RNF2; TUBB2A; XPO1; TUBB6; CAMK1D; NSFL1C; IPO9; UBXN1; DCPS; PROSC; PDIA4; PLAA; GTF3C4; NAE1; PPP5C; PPP1R2; PAFAH1B2; HK1; HEXB; GAPDH; Reconstitution and For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in Storage small aliquots to prevent freeze-thaw cycles. Lead Time Domestic: within 6-8 weeks delivery International: 6-8 weeks *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 1 Blocking Peptide For anti-TUFM (ARP58546_P050) antibody is Catalog # AAP58546 (Previous Catalog # AAPP34728) Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TUFM Complete Anti-TUFM (ARP58546_P050) computational species homology data Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TUFM. Swissprot Id P49411 Protein Name Elongation factor Tu, mitochondrial Publications Clemente, P. et al. hCOA3 stabilizes cytochrome c oxidase 1 (COX1) and promotes cytochrome c oxidase assembly in human mitochondria. J. Biol. Chem. 288, 8321-31 (2013). WB, Dog, Human, Pig, Horse, Rabbit, Rat, Guinea pig, Bovine, Mouse, Zebrafish, Yeast 23362268 Sample Type TUFM is supported by BioGPS gene expression data to be expressed in HeLa Confirmation Protein Accession NP_003312 # Purification Affinity Purified RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TUFM. Nucleotide NM_003321 Accession # Replacement Item This antibody may replace item sc-105322 from Santa Cruz Biotechnology. Conjugation ARP58546_P050-FITC Conjugated Options ARP58546_P050-HRP Conjugated ARP58546_P050-Biotin Conjugated CB Replacement sc-105322; sc-12990; sc-12991; sc-21758; sc-35266; sc-367739; sc-393924 Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish Application WB Predicted Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Homology Based Rabbit: 93%; Rat: 93%; Yeast: 77%; Zebrafish: 86% on Immunogen Sequence Image 1: Human Fetal Lung Host: Rabbit Target Name: TUFM Sample Type: Human Fetal Lung Antibody Dilution: 1.0ug/ml Image 2: Human HeLa WB Suggested Anti-TUFM Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Hela cell lysate TUFM is supported by BioGPS gene expression data to be expressed in HeLa AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins. This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users. 5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | [email protected] 2.
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-