OR7A17 (Human) Recombinant Protein

Total Page:16

File Type:pdf, Size:1020Kb

Load more

OR7A17 (Human) Recombinant Gene Symbol: OR7A17 Protein Gene Alias: BC85395_4, HTPCRX19, MGC126636 Catalog Number: H00026333-G01 Gene Summary: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal Regulation Status: For research use only (RUO) response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family Product Description: Human OR7A17 full-length ORF of G-protein-coupled receptors (GPCR) arising from (NP_112163.1) recombinant protein without tag. single coding-exon genes. Olfactory receptors share a Sequence: 7-transmembrane domain structure with many MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVT neurotransmitter and hormone receptors and are VLGNLLIILATISDSHLHTPMYFFLSNLSFADICFISTTIPK responsible for the recognition and G protein-mediated MLINIQTQSRVITYAGCITQMCFFVLFGGLDSLLLAVMA transduction of odorant signals. The olfactory receptor YDRFVAICHPLHYTVIMNPRLCGLLVLASWMIAALNSLS gene family is the largest in the genome. The QSLMVLWLSFCTDLEIPHFFCELNQVIHLACSDTFLND nomenclature assigned to the olfactory receptor genes MGMYFAAGLLAGGPLVGILCSYSKIVSSIRAISSAQGKY and proteins for this organism is independent of other KAFSTCASHLSVVSLFCCTGLGVYLTSAATHNSHTSAT organisms. [provided by RefSeq] ASVMYTVATPMLNPFIYSLRNKDIKRALKMSFRGKQ Host: Wheat Germ (in vitro) Theoretical MW (kDa): 34 Applications: AP (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Preparation Method: in vitro wheat germ expression system with proprietary liposome technology Purification: None Recommend Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 26333 Page 1/1 Powered by TCPDF (www.tcpdf.org).
Recommended publications
  • An Evolutionary Based Strategy for Predicting Rational Mutations in G Protein-Coupled Receptors

    An Evolutionary Based Strategy for Predicting Rational Mutations in G Protein-Coupled Receptors

    Ecology and Evolutionary Biology 2021; 6(3): 53-77 http://www.sciencepublishinggroup.com/j/eeb doi: 10.11648/j.eeb.20210603.11 ISSN: 2575-3789 (Print); ISSN: 2575-3762 (Online) An Evolutionary Based Strategy for Predicting Rational Mutations in G Protein-Coupled Receptors Miguel Angel Fuertes*, Carlos Alonso Department of Microbiology, Centre for Molecular Biology “Severo Ochoa”, Spanish National Research Council and Autonomous University, Madrid, Spain Email address: *Corresponding author To cite this article: Miguel Angel Fuertes, Carlos Alonso. An Evolutionary Based Strategy for Predicting Rational Mutations in G Protein-Coupled Receptors. Ecology and Evolutionary Biology. Vol. 6, No. 3, 2021, pp. 53-77. doi: 10.11648/j.eeb.20210603.11 Received: April 24, 2021; Accepted: May 11, 2021; Published: July 13, 2021 Abstract: Capturing conserved patterns in genes and proteins is important for inferring phenotype prediction and evolutionary analysis. The study is focused on the conserved patterns of the G protein-coupled receptors, an important superfamily of receptors. Olfactory receptors represent more than 2% of our genome and constitute the largest family of G protein-coupled receptors, a key class of drug targets. As no crystallographic structures are available, mechanistic studies rely on the use of molecular dynamic modelling combined with site-directed mutagenesis data. In this paper, we hypothesized that human-mouse orthologs coding for G protein-coupled receptors maintain, at speciation events, shared compositional structures independent, to some extent, of their percent identity as reveals a method based in the categorization of nucleotide triplets by their gross composition. The data support the consistency of the hypothesis, showing in ortholog G protein-coupled receptors the presence of emergent shared compositional structures preserved at speciation events.
  • Olfactory Receptors in Non-Chemosensory Tissues

    Olfactory Receptors in Non-Chemosensory Tissues

    BMB Reports Invited Mini Review Olfactory receptors in non-chemosensory tissues NaNa Kang & JaeHyung Koo* Department of Brain Science, Daegu Gyeongbuk Institute of Science and Technology (DGIST), Daegu 711-873, Korea Olfactory receptors (ORs) detect volatile chemicals that lead to freezing behavior (3-5). the initial perception of smell in the brain. The olfactory re- ORs are localized in the cilia of olfactory sensory neurons ceptor (OR) is the first protein that recognizes odorants in the (OSNs) in the olfactory epithelium (OE) and are activated by olfactory signal pathway and it is present in over 1,000 genes chemical cues, typically odorants at the molecular level, in mice. It is also the largest member of the G protein-coupled which lead to the perception of smell in the brain (6). receptors (GPCRs). Most ORs are extensively expressed in the Tremendous research was conducted since Buck and Axel iso- nasal olfactory epithelium where they perform the appropriate lated ORs as an OE-specific expression in 1991 (7). OR genes, physiological functions that fit their location. However, recent the largest family among the G protein-coupled receptors whole-genome sequencing shows that ORs have been found (GPCRs) (8), constitute more than 1,000 genes on the mouse outside of the olfactory system, suggesting that ORs may play chromosome (9, 10) and more than 450 genes in the human an important role in the ectopic expression of non-chemo- genome (11, 12). sensory tissues. The ectopic expressions of ORs and their phys- Odorant activation shows a distinct signal transduction iological functions have attracted more attention recently since pathway for odorant perception.
  • Sean Raspet – Molecules

    Sean Raspet – Molecules

    1. Commercial name: Fructaplex© IUPAC Name: 2-(3,3-dimethylcyclohexyl)-2,5,5-trimethyl-1,3-dioxane SMILES: CC1(C)CCCC(C1)C2(C)OCC(C)(C)CO2 Molecular weight: 240.39 g/mol Volume (cubic Angstroems): 258.88 Atoms number (non-hydrogen): 17 miLogP: 4.43 Structure: Biological Properties: Predicted Druglikenessi: GPCR ligand -0.23 Ion channel modulator -0.03 Kinase inhibitor -0.6 Nuclear receptor ligand 0.15 Protease inhibitor -0.28 Enzyme inhibitor 0.15 Commercial name: Fructaplex© IUPAC Name: 2-(3,3-dimethylcyclohexyl)-2,5,5-trimethyl-1,3-dioxane SMILES: CC1(C)CCCC(C1)C2(C)OCC(C)(C)CO2 Predicted Olfactory Receptor Activityii: OR2L13 83.715% OR1G1 82.761% OR10J5 80.569% OR2W1 78.180% OR7A2 77.696% 2. Commercial name: Sylvoxime© IUPAC Name: N-[4-(1-ethoxyethenyl)-3,3,5,5tetramethylcyclohexylidene]hydroxylamine SMILES: CCOC(=C)C1C(C)(C)CC(CC1(C)C)=NO Molecular weight: 239.36 Volume (cubic Angstroems): 252.83 Atoms number (non-hydrogen): 17 miLogP: 4.33 Structure: Biological Properties: Predicted Druglikeness: GPCR ligand -0.6 Ion channel modulator -0.41 Kinase inhibitor -0.93 Nuclear receptor ligand -0.17 Protease inhibitor -0.39 Enzyme inhibitor 0.01 Commercial name: Sylvoxime© IUPAC Name: N-[4-(1-ethoxyethenyl)-3,3,5,5tetramethylcyclohexylidene]hydroxylamine SMILES: CCOC(=C)C1C(C)(C)CC(CC1(C)C)=NO Predicted Olfactory Receptor Activity: OR52D1 71.900% OR1G1 70.394% 0R52I2 70.392% OR52I1 70.390% OR2Y1 70.378% 3. Commercial name: Hyperflor© IUPAC Name: 2-benzyl-1,3-dioxan-5-one SMILES: O=C1COC(CC2=CC=CC=C2)OC1 Molecular weight: 192.21 g/mol Volume
  • 1 Novel Expression Signatures Identified by Transcriptional Analysis

    1 Novel Expression Signatures Identified by Transcriptional Analysis

    ARD Online First, published on October 7, 2009 as 10.1136/ard.2009.108043 Ann Rheum Dis: first published as 10.1136/ard.2009.108043 on 7 October 2009. Downloaded from Novel expression signatures identified by transcriptional analysis of separated leukocyte subsets in SLE and vasculitis 1Paul A Lyons, 1Eoin F McKinney, 1Tim F Rayner, 1Alexander Hatton, 1Hayley B Woffendin, 1Maria Koukoulaki, 2Thomas C Freeman, 1David RW Jayne, 1Afzal N Chaudhry, and 1Kenneth GC Smith. 1Cambridge Institute for Medical Research and Department of Medicine, Addenbrooke’s Hospital, Hills Road, Cambridge, CB2 0XY, UK 2Roslin Institute, University of Edinburgh, Roslin, Midlothian, EH25 9PS, UK Correspondence should be addressed to Dr Paul Lyons or Prof Kenneth Smith, Department of Medicine, Cambridge Institute for Medical Research, Addenbrooke’s Hospital, Hills Road, Cambridge, CB2 0XY, UK. Telephone: +44 1223 762642, Fax: +44 1223 762640, E-mail: [email protected] or [email protected] Key words: Gene expression, autoimmune disease, SLE, vasculitis Word count: 2,906 The Corresponding Author has the right to grant on behalf of all authors and does grant on behalf of all authors, an exclusive licence (or non-exclusive for government employees) on a worldwide basis to the BMJ Publishing Group Ltd and its Licensees to permit this article (if accepted) to be published in Annals of the Rheumatic Diseases and any other BMJPGL products to exploit all subsidiary rights, as set out in their licence (http://ard.bmj.com/ifora/licence.pdf). http://ard.bmj.com/ on September 29, 2021 by guest. Protected copyright. 1 Copyright Article author (or their employer) 2009.
  • A Novel Chromosome 19P13.12 Deletion in a Child with Multiple Congenital Anomalies Daniel R

    A Novel Chromosome 19P13.12 Deletion in a Child with Multiple Congenital Anomalies Daniel R

    RESEARCH ARTICLE A Novel Chromosome 19p13.12 Deletion in a Child With Multiple Congenital Anomalies Daniel R. Jensen,1 Donna M. Martin,2,3 Stephen Gebarski,4 Trilochan Sahoo,5 Ellen K. Brundage,5 A. Craig Chinault,5 Edgar A. Otto,2 Moumita Chaki,2 Friedhelm Hildebrandt,2,3,6 Sau Wai Cheung,5 and Marci M. Lesperance1* 1Division of Pediatric Otolaryngology, Department of Otolaryngology-Head and Neck Surgery, University of Michigan Health System, Ann Arbor, Michigan 2Department of Pediatrics and Communicable Diseases, University of Michigan Health System, Ann Arbor, Michigan 3Department of Human Genetics, University of Michigan Health System, Ann Arbor, Michigan 4Division of Neuroradiology, Department of Radiology, University of Michigan Health System, Ann Arbor, Michigan 5Department of Molecular and Human Genetics, Baylor College of Medicine, Houston, Texas 6Howard Hughes Medical Institute, University of Michigan Health System, Ann Arbor, Michigan Received 17 March 2008; Accepted 21 November 2008 We describe a patient with multiple congenital anomalies in- cluding deafness, lacrimal duct stenosis, strabismus, bilateral How to Cite this Article: cervical sinuses, congenital cardiac defects, hypoplasia of the Jensen DR, Martin DM, Gebarski S, Sahoo T, corpus callosum, and hypoplasia of the cerebellar vermis. Muta- Brundage EK, Chinault AC, Otto EA, Chaki M, tion analysis of EYA1, SIX1, and SIX5, genes that underlie Hildebrandt F, Cheung SW, Lesperance MM. otofaciocervical and/or branchio-oto-renal syndrome, was neg- 2009. A novel chromosome 19p13.12 deletion ative. Pathologic diagnosis of the excised cervical sinus tracts was in a child with multiple congenital anomalies. revised on re-examination to heterotopic salivary gland tissue.
  • Us 2018 / 0305689 A1

    Us 2018 / 0305689 A1

    US 20180305689A1 ( 19 ) United States (12 ) Patent Application Publication ( 10) Pub . No. : US 2018 /0305689 A1 Sætrom et al. ( 43 ) Pub . Date: Oct. 25 , 2018 ( 54 ) SARNA COMPOSITIONS AND METHODS OF plication No . 62 /150 , 895 , filed on Apr. 22 , 2015 , USE provisional application No . 62/ 150 ,904 , filed on Apr. 22 , 2015 , provisional application No. 62 / 150 , 908 , (71 ) Applicant: MINA THERAPEUTICS LIMITED , filed on Apr. 22 , 2015 , provisional application No. LONDON (GB ) 62 / 150 , 900 , filed on Apr. 22 , 2015 . (72 ) Inventors : Pål Sætrom , Trondheim (NO ) ; Endre Publication Classification Bakken Stovner , Trondheim (NO ) (51 ) Int . CI. C12N 15 / 113 (2006 .01 ) (21 ) Appl. No. : 15 /568 , 046 (52 ) U . S . CI. (22 ) PCT Filed : Apr. 21 , 2016 CPC .. .. .. C12N 15 / 113 ( 2013 .01 ) ; C12N 2310 / 34 ( 2013. 01 ) ; C12N 2310 /14 (2013 . 01 ) ; C12N ( 86 ) PCT No .: PCT/ GB2016 /051116 2310 / 11 (2013 .01 ) $ 371 ( c ) ( 1 ) , ( 2 ) Date : Oct . 20 , 2017 (57 ) ABSTRACT The invention relates to oligonucleotides , e . g . , saRNAS Related U . S . Application Data useful in upregulating the expression of a target gene and (60 ) Provisional application No . 62 / 150 ,892 , filed on Apr. therapeutic compositions comprising such oligonucleotides . 22 , 2015 , provisional application No . 62 / 150 ,893 , Methods of using the oligonucleotides and the therapeutic filed on Apr. 22 , 2015 , provisional application No . compositions are also provided . 62 / 150 ,897 , filed on Apr. 22 , 2015 , provisional ap Specification includes a Sequence Listing . SARNA sense strand (Fessenger 3 ' SARNA antisense strand (Guide ) Mathew, Si Target antisense RNA transcript, e . g . NAT Target Coding strand Gene Transcription start site ( T55 ) TY{ { ? ? Targeted Target transcript , e .
  • Explorations in Olfactory Receptor Structure and Function by Jianghai

    Explorations in Olfactory Receptor Structure and Function by Jianghai Ho Department of Neurobiology Duke University Date:_______________________ Approved: ___________________________ Hiroaki Matsunami, Supervisor ___________________________ Jorg Grandl, Chair ___________________________ Marc Caron ___________________________ Sid Simon ___________________________ [Committee Member Name] Dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Neurobiology in the Graduate School of Duke University 2014 ABSTRACT Explorations in Olfactory Receptor Structure and Function by Jianghai Ho Department of Neurobiology Duke University Date:_______________________ Approved: ___________________________ Hiroaki Matsunami, Supervisor ___________________________ Jorg Grandl, Chair ___________________________ Marc Caron ___________________________ Sid Simon ___________________________ [Committee Member Name] An abstract of a dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Department of Neurobiology in the Graduate School of Duke University 2014 Copyright by Jianghai Ho 2014 Abstract Olfaction is one of the most primitive of our senses, and the olfactory receptors that mediate this very important chemical sense comprise the largest family of genes in the mammalian genome. It is therefore surprising that we understand so little of how olfactory receptors work. In particular we have a poor idea of what chemicals are detected by most of the olfactory receptors in the genome, and for those receptors which we have paired with ligands, we know relatively little about how the structure of these ligands can either activate or inhibit the activation of these receptors. Furthermore the large repertoire of olfactory receptors, which belong to the G protein coupled receptor (GPCR) superfamily, can serve as a model to contribute to our broader understanding of GPCR-ligand binding, especially since GPCRs are important pharmaceutical targets.
  • Online Supporting Information S2: Proteins in Each Negative Pathway

    Online Supporting Information S2: Proteins in Each Negative Pathway

    Online Supporting Information S2: Proteins in each negative pathway Index Proteins ADO,ACTA1,DEGS2,EPHA3,EPHB4,EPHX2,EPOR,EREG,FTH1,GAD1,HTR6, IGF1R,KIR2DL4,NCR3,NME7,NOTCH1,OR10S1,OR2T33,OR56B4,OR7A10, Negative_1 OR8G1,PDGFC,PLCZ1,PROC,PRPS2,PTAFR,SGPP2,STMN1,VDAC3,ATP6V0 A1,MAPKAPK2 DCC,IDS,VTN,ACTN2,AKR1B10,CACNA1A,CHIA,DAAM2,FUT5,GCLM,GNAZ Negative_2 ,ITPA,NEU4,NTF3,OR10A3,PAPSS1,PARD3,PLOD1,RGS3,SCLY,SHC1,TN FRSF4,TP53 Negative_3 DAO,CACNA1D,HMGCS2,LAMB4,OR56A3,PRKCQ,SLC25A5 IL5,LHB,PGD,ADCY3,ALDH1A3,ATP13A2,BUB3,CD244,CYFIP2,EPHX2,F CER1G,FGD1,FGF4,FZD9,HSD17B7,IL6R,ITGAV,LEFTY1,LIPG,MAN1C1, Negative_4 MPDZ,PGM1,PGM3,PIGM,PLD1,PPP3CC,TBXAS1,TKTL2,TPH2,YWHAQ,PPP 1R12A HK2,MOS,TKT,TNN,B3GALT4,B3GAT3,CASP7,CDH1,CYFIP1,EFNA5,EXTL 1,FCGR3B,FGF20,GSTA5,GUK1,HSD3B7,ITGB4,MCM6,MYH3,NOD1,OR10H Negative_5 1,OR1C1,OR1E1,OR4C11,OR56A3,PPA1,PRKAA1,PRKAB2,RDH5,SLC27A1 ,SLC2A4,SMPD2,STK36,THBS1,SERPINC1 TNR,ATP5A1,CNGB1,CX3CL1,DEGS1,DNMT3B,EFNB2,FMO2,GUCY1B3,JAG Negative_6 2,LARS2,NUMB,PCCB,PGAM1,PLA2G1B,PLOD2,PRDX6,PRPS1,RFXANK FER,MVD,PAH,ACTC1,ADCY4,ADCY8,CBR3,CLDN16,CPT1A,DDOST,DDX56 ,DKK1,EFNB1,EPHA8,FCGR3A,GLS2,GSTM1,GZMB,HADHA,IL13RA2,KIR2 Negative_7 DS4,KLRK1,LAMB4,LGMN,MAGI1,NUDT2,OR13A1,OR1I1,OR4D11,OR4X2, OR6K2,OR8B4,OXCT1,PIK3R4,PPM1A,PRKAG3,SELP,SPHK2,SUCLG1,TAS 1R2,TAS1R3,THY1,TUBA1C,ZIC2,AASDHPPT,SERPIND1 MTR,ACAT2,ADCY2,ATP5D,BMPR1A,CACNA1E,CD38,CYP2A7,DDIT4,EXTL Negative_8 1,FCER1G,FGD3,FZD5,ITGAM,MAPK8,NR4A1,OR10V1,OR4F17,OR52D1,O R8J3,PLD1,PPA1,PSEN2,SKP1,TACR3,VNN1,CTNNBIP1 APAF1,APOA1,CARD11,CCDC6,CSF3R,CYP4F2,DAPK1,FLOT1,GSTM1,IL2
  • The Genomic Variation in the Aosta Cattle Breeds Raised in an Extensive Alpine Farming System

    The Genomic Variation in the Aosta Cattle Breeds Raised in an Extensive Alpine Farming System

    animals Article The Genomic Variation in the Aosta Cattle Breeds Raised in an Extensive Alpine Farming System Maria Giuseppina Strillacci 1 , Mario Vevey 2, Veruska Blanchet 2, Roberto Mantovani 3 , Cristina Sartori 3 and Alessandro Bagnato 1,* 1 Department of Veterinary Medicine, Università degli Studi di Milano, Via dell’Università 6, 20133 Milano, Italy; [email protected] 2 Associazione Nazionale Bovini di Razza Valdostana, Fraz. Favret, 5, 11020 Gressan, Italy; [email protected] (M.V.); [email protected] (V.B.) 3 Department of Agronomy, Food, Natural Resources, Animals and Environment (DAFNAE), Università degli Studi di Padova, Viale dell’Università 16, 35020 Legnaro, Italy; [email protected] (R.M.); [email protected] (C.S.) * Correspondence: [email protected]; Tel.: +39-02-5033-4583 Received: 6 November 2020; Accepted: 10 December 2020; Published: 12 December 2020 Simple Summary: Genetic variability among native cattle breeds can disclose the important features that make a population adapted to harsh environments. The Aosta cattle breeds have been raised and selected for centuries to be farmed in a mountain environment, characterized by a semi-intensive system, i.e., summer pasture with winter recovery on the farms. To disclose the genomic variation and its association with known genes, it is important to genetically characterize these breeds. Abstract: The Aosta Red Pied (Valdostana Pezzata Rossa (VRP)), the Aosta Black Pied (Valdostana Pezzata Nera (VBP)) and the Aosta Chestnut (Valdostana Castana (CAS)) are dual-purpose cattle breeds (meat and milk), very well adapted to the harsh environmental conditions of alpine territories: their farming is in fact characterized by summer pasture at very high altitude.
  • Table S2. Primers and Probes Used for Qpcr
  • Supplementary Methods

    Supplementary Methods

    doi: 10.1038/nature06162 SUPPLEMENTARY INFORMATION Supplementary Methods Cloning of human odorant receptors 423 human odorant receptors were cloned with sequence information from The Olfactory Receptor Database (http://senselab.med.yale.edu/senselab/ORDB/default.asp). Of these, 335 were predicted to encode functional receptors, 45 were predicted to encode pseudogenes, 29 were putative variant pairs of the same genes, and 14 were duplicates. We adopted the nomenclature proposed by Doron Lancet 1. OR7D4 and the six intact odorant receptor genes in the OR7D4 gene cluster (OR1M1, OR7G2, OR7G1, OR7G3, OR7D2, and OR7E24) were used for functional analyses. SNPs in these odorant receptors were identified from the NCBI dbSNP database (http://www.ncbi.nlm.nih.gov/projects/SNP) or through genotyping. OR7D4 single nucleotide variants were generated by cloning the reference sequence from a subject or by inducing polymorphic SNPs by site-directed mutagenesis using overlap extension PCR. Single nucleotide and frameshift variants for the six intact odorant receptors in the same gene cluster as OR7D4 were generated by cloning the respective genes from the genomic DNA of each subject. The chimpanzee OR7D4 orthologue was amplified from chimpanzee genomic DNA (Coriell Cell Repositories). Odorant receptors that contain the first 20 amino acids of human rhodopsin tag 2 in pCI (Promega) were expressed in the Hana3A cell line along with a short form of mRTP1 called RTP1S, (M37 to the C-terminal end), which enhances functional expression of the odorant receptors 3. For experiments with untagged odorant receptors, OR7D4 RT and S84N variants without the Rho tag were cloned into pCI.
  • Research/0018.1

    Research/0018.1

    http://genomebiology.com/2001/2/6/research/0018.1 Research The human olfactory receptor repertoire comment Sergey Zozulya, ernando Echeverri and Trieu Nguyen Address: Senomyx Inc., 11099 North Torrey Pines Road, La Jolla, CA 92037, USA. Correspondence: Sergey Zozulya. E-mail: [email protected] reviews Published: 1 June 2001 Received: 8 March 2001 Revised: 12 April 2001 Genome Biology 2001, 2(6):research0018.1–0018.12 Accepted: 18 April 2001 The electronic version of this article is the complete one and can be found online at http://genomebiology.com/2001/2/6/research/0018 © 2001 Zozulya et al., licensee BioMed Central Ltd (Print ISSN 1465-6906; Online ISSN 1465-6914) reports Abstract Background: The mammalian olfactory apparatus is able to recognize and distinguish thousands of structurally diverse volatile chemicals. This chemosensory function is mediated by a very large family of seven-transmembrane olfactory (odorant) receptors encoded by approximately 1,000 genes, the majority of which are believed to be pseudogenes in humans. deposited research Results: The strategy of our sequence database mining for full-length, functional candidate odorant receptor genes was based on the high overall sequence similarity and presence of a number of conserved sequence motifs in all known mammalian odorant receptors as well as the absence of introns in their coding sequences. We report here the identification and physical cloning of 347 putative human full-length odorant receptor genes. Comparative sequence analysis of the predicted gene products allowed us to identify and define a number of consensus sequence motifs and structural features of this vast family of receptors.