DOCSLIB.ORG

The Evaluation of Factor VIII Binding Activity of Von Willebrand Factor by Means of an ELISA Method Significance and Practical Implications

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
The Evaluation of Factor VIII Binding Activity of Von Willebrand Factor by Means of an ELISA Method Significance and Practical Implications COAGULATION AND TRANSFUSION MEDICINE Original Article The Evaluation of Factor VIII Binding Activity of von Willebrand Factor by Means of an ELISA Method Significance and Practical Implications ALESSANDRA CASONATO, PhD, ELENA PONTARA, PhD, PATRIZIA ZERBINATI, PhD, ALESSANDRO ZUCCHETTO, MD, AND ANTONIO GIROLAMI, MD Downloaded from https://academic.oup.com/ajcp/article/109/3/347/1758043 by guest on 28 September 2021 One of the functions of von Willebrand factor (vWF) is to serve as chromogenic assay and our ELISA. A patient who was homozy­ a carrier of clotting factor VIII (FVIII). Deficiency of this function gous for the R53W mutation and had no FVIII binding capacity results in the von Willebrand disease (vWD) variant type 2N, according to the chromogenic method showed undetectable FVIII which resembles hemophilia A. We describe a new sandwich binding by ELISA. The remaining two patients, one who was enzyme-linked immunosorbent assay (ELISA) to study the abil­ homozygous for the R91Q mutation and one with compound het­ ity of vWF to bind exogenous recombinant FVIII (rFVIII), in erozygosity for the R91Q and R53W mutations, showed which anti-vWF-coated plates are incubated with plasma vWF, markedly decreased FVIII binding by the chromogenic method followed by exogenous FVIII and a peroxidase-coupled anti- and yielded ELISA values ranging from 4 to 8 U/dL. Therefore, FVIII antibody. Dose-response curves obtained using normal although the two methods produce qualitatively similar results, plasma vWF and purified normal vWF revealed a hyperbolic rela­ the ELISA method offers the advantage of allowing quantifica­ tionship between the optical density and the vWF concentration. tion of the FVIII binding function. FVIII binding was also ana­ The assay allows the quantification of FVIII binding with values lyzed in 20 patients with type 1 vWD; we found a decrease of expressed in U/dL; 100 U/dL was the amount present in normal FVIII binding that was proportionate to the decrease in vWF lev­ plasma. The sensitivity and specificity of the method are demon­ els, showing a normal FVIII binding activity/vWF molecule ratio. strated by its ability to measure binding levels as low as 1 to 2 We define the binding activity measured by this assay as U/dL and the fact that no FVIII binding was observed using vWF:FVIII binding activity and propose its use in the functional plasma known to contain less than 1 U/dL vWF. To verify the analysis of vWF. (Key words: Factor VIII; von Willebrand factor; accuracy of the assay, three patients with type 2N vWD with char­ FVIII binding activity; von Willebrand disease; Type 2N vWD) acterized vWF gene mutations were studied using an existing Am J Clin Pathol 1998;109:347-352. Von Willebrand factor (vWF) is a high-molecular- includes vWF abnormalities characterized by defec­ weight glycoprotein that fulfills a crucial role in tive functions independent of multimer representa­ hemostasis by promoting platelet adhesion at the site tion. This group includes type 2N vWD, a variant of vascular injury1 and by serving as a carrier for clot­ previously called type Normandy vWD. Type 2N ting factor VIII (FVIII) in the plasma,2 thereby pro­ vWD is characterized by defective binding of vWF to tecting FVIII from proteolytic degradation.3'4 FVIII9-10 that is associated with normal platelet adhe­ Deficiency of vWF is responsible for the most fre­ sion. The phenotypic expression is characterized by quent inherited bleeding disorder, von Willebrand levels of FVIII that are substantially lower than the disease (vWD),5 in which quantitative defects (type 1 levels of vWF Although the condition is similar to and type 3) and molecular abnormalities (type 2) mild hemophilia A, its inheritance is not X-linked; have been described.6'7 According to the most recent nevertheless, misdiagnosis of hemophilia A has been proposed classification of vWD,8 the type 2 group described in type 2N vWD.11'12 Point mutations resulting in the amino acid substitutions Argl9Trp, Thr28Met, Arg53Trp, His54Gln and Arg91Gln have 13 16 From the University of Padua Medical School, Institute of Medical been reported in type 2N vWD. " Semeiotics, Padua, Italy. The FVIII-vWF interaction has been studied in This work was supported by grants from Ministero Universita' vitro using a chromogenic assay that estimates the Ricerca Scientifica e Tecnologica, Rome, Italy, and from Veneto exogenous FVIII binding to vWF immunoisolated Region, Venice, Italy. from plasma.4,5'8 We describe a new quantitative Manuscript received March 7,1997; revision accepted June 26,1997. Address reprint requests to Dr Casonato: Istituto di Semeiotica method that measures the binding of FVIII to Medica, Via Ospedale Civile 105, Padova, Italia. immobilized vWF. 347 348 COAGULATION AND TRANSFUSION MEDICINE Original Article MATERIALS AND METHODS RESULTS Patients and healthy volunteers were studied. Demonstration of the Specific Binding Informed consent was obtained in accordance with of Recombinant FVIII to Immobilized vWF the declaration of Helsinki. Fifty healthy volunteers (30 women and 20 men), 21 to 65 years of age, who A sandwich immunoassay was developed to had not taken medication for at least 2 weeks before quantify the capability of plasma vWF to bind to the study served as controls. Nineteen patients with exogenous rFVIII. As described in the "Materials and type 1 subtype platelet-normal, 1 patient with type 1 Methods" section, the assay used microtiter plates platelet-low, and 1 patient with type 3 vWD were coated with anti-vWF antibody, which were incu­ Downloaded from https://academic.oup.com/ajcp/article/109/3/347/1758043 by guest on 28 September 2021 studied. Blood was drawn from the antecubital vein bated with plasma samples followed by rFVIII and and anticoagulated using 3.8% sodium citrate (1:10 horseradish peroxidase-conjugated anti-FVIII anti­ vol/vol). Platelet-poor plasma was prepared and body. Figure 1 shows the dose-response curves bleeding time was measured as previously obtained with serial dilutions of purified vWF and described.17 Assays measuring vWF ristocetin cofac- vWF present in NP at a constant concentration of tor activity (vWF:RCo), vWF antigen (vWF:Ag), and exogenous rFVIII (1.0 U/mL). Results showed that FVIII activity (FVIILC) were previously reported.18-20 the binding of rFVIII was a function of the amount of The vWF was purified from human cryoprecipitates according to the method of De Marco and Shapiro.21 Binding Assay of Recombinant FVIII to Immobilized vWF Purified normal von Willebrand factor Microtiter wells in 96-well plates were coated 1,500 Normal pooled plasma overnight at 4°C with 200 uL of polyclonal anti-vWF Type 3 von Willebrand disease antibody (Dako, Amsterdam, the Netherlands), 1.5 ug/mL in 0.05 mol/L sodium carbonate-bicarbonate buffer, pH 9.6. After extensive washing, the wells were incubated with phosphate-buffered saline (PBS) en 1,000 containing 2% bovine serum albumin (BSA) for 1 c hour at room temperature. The following steps were D then performed at room temperature. After washing, 200 uL of selected plasma dilutions, prepared in PBS 8 containing 0.05% polysorbate (Tween) and 2% BSA, were incubated in the wells for 1 hour. Endogenous FVIII was then removed from the immobilized vWF by incubation with buffered 0.4 mol/L calcium chlo­ ride for 30 minutes. After washing selected dilutions of recombinant FVIII (rFVIII; Baxter, Deerfield, 111), prepared in a PBS-Tween-BSA mixture were added and incubated for different times. After washing, the 1:100 1:400 1:800 1:1,600 bound rFVIII molecule was detected by incubation with horseradish peroxidase-conjugated polyclonal Plasma Dilution anti-FVIII antibodies (Enzymes Research, South Bend, FIG 1. Binding of recombinant factor VIII (rFVIII) to immobilized von Ind). The color was developed by addition of ortho- Willebrand factor (vWF) from normal pooled plasma (NP), purified normal vWF, and type 3 von Willebrand disease (vWD) plasma. The phenylenediamine dihydrochloride. The values were dose-response curves were obtained by incubating immobilized vWF plotted against plasma vWF dilutions and were with a constant amount of rFVIII (1 U/mL) for 30 minutes at 22°C. expressed as U/dL, with 100 U/dL the value The bound rFVIII was detected and quantified using horseradish per­ obtained with a 1:25 dilution of normal pooled oxidase-conjugated anti-FVIII antibody. The color was developed by plasma (NP). The ratio of FVIII binding activity to addition of o-phenylenediamine dihydrochloride. The NP was serially diluted starting from 1:25, and purified normal vWF was serially vWF:Ag was also calculated to normalize the binding diluted starting at a concentration of 0.4 |ig/mL, which corresponds to function to the vWF levels. the amount of vWF present in a 1:25 dilution of NP. AJCP • March 1W8 CASONATO ET AL 349 FVIII Binding to v\ Evaluated by ELISA immobilized vWF molecule and that the decrease in Binding of FVIII to Plasma vWFFrom Healthy FVIII binding had a hyperbolic relationship to the Persons and Patients With Type 1 vWD decrease in vWF. The specificity of rFVIII binding to vWF was demonstrated by the dose-response curve Fifty healthy subjects were studied to define a nor­ obtained with normal purified vWF, which showed a mal range of FVIII-vWF binding; three dilutions (1:25, relationship similar to that obtained using NP at sim­ 1:50, 1:100) were performed for each sample. ilar concentrations (see Fig 1). As a further test for Moreover, vWF:Ag was also evaluated by using an possible nonspecific binding of rFVIII to plasma pro­ ELISA method that uses the same coated anti-vWF teins other than vWF, plasma from a patient with antibody at a similar concentration.
Load more

Recommended publications
  • MONONINE (“Difficulty ® Monoclonal Antibody Purified in Concentrating”; Subject Recovered)
    CSL Behring IU/kg (n=38), 0.98 ± 0.45 K at doses >95-115 IU/kg (n=21), 0.70 ± 0.38 K at doses >115-135 IU/kg (n=2), 0.67 K at doses >135-155 IU/kg (n=1), and 0.73 ± 0.34 K at doses >155 IU/kg (n=5). Among the 36 subjects who received these high doses, only one (2.8%) Coagulation Factor IX (Human) reported an adverse experience with a possible relationship to MONONINE (“difficulty ® Monoclonal Antibody Purified in concentrating”; subject recovered). In no subjects were thrombo genic complications MONONINE observed or reported.4 only The manufacturing procedure for MONONINE includes multiple processing steps that DESCRIPTION have been designed to reduce the risk of virus transmission. Validation studies of the Coagulation Factor IX (Human), MONONINE® is a sterile, stable, lyophilized concentrate monoclonal antibody (MAb) immunoaffinity chromatography/chemical treatment step and of Factor IX prepared from pooled human plasma and is intended for use in therapy nanofiltration step used in the production of MONONINE doc ument the virus reduction of Factor IX deficiency, known as Hemophilia B or Christmas disease. MONONINE is capacity of the processes employed. These studies were conducted using the rel evant purified of extraneous plasma-derived proteins, including Factors II, VII and X, by use of enveloped and non-enveloped viruses. The results of these virus validation studies utilizing immunoaffinity chromatography. A murine monoclonal antibody to Factor IX is used as an a wide range of viruses with different physicochemical properties are summarized in Table affinity ligand to isolate Factor IX from the source material.
    [Show full text]
  • Clinical Commissioning Policy: Susoctocog Alfa for Treating Bleeding Episodes in People with Acquired Haemophilia a (All Ages)
    Clinical Commissioning Policy: Susoctocog alfa for treating bleeding episodes in people with acquired haemophilia A (all ages) NHS England Reference: 170061P 1 NHS England INFORMATION READER BOX Directorate Medical Operations and Information Specialised Commissioning Nursing Trans. & Corp. Ops. Commissioning Strategy Finance Publications Gateway Reference: 07603 Document Purpose Policy Clinical commissioning policy: Susoctocog alfa for treating bleeding Document Name episodes in people with acquired haemophilia A (all ages) Author Specialised Commissioning Team Publication Date 29 June 2018 Target Audience CCG Clinical Leaders, Care Trust CEs, Foundation Trust CEs , Medical Directors, Directors of PH, Directors of Nursing, NHS England Regional Directors, NHS England Directors of Commissioning Operations, Directors of Finance, NHS Trust CEs Additional Circulation #VALUE! List Description Routinely Commissioned - NHS England will routinely commission this specialised treatment in accordance with the criteria described in this policy. Cross Reference 0 Superseded Docs 0 (if applicable) Action Required 0 Timing / Deadlines By 00 January 1900 (if applicable) Contact Details for [email protected] further information 0 0 0 0 0 0 Document Status This is a controlled document. Whilst this document may be printed, the electronic version posted on the intranet is the controlled copy. Any printed copies of this document are not controlled. As a controlled document, this document should not be saved onto local or network drives but should always be accessed from the intranet. 2 Standard Operating Procedure: Clinical Commissioning Policy: Susoctocog alfa for treating bleeding episodes in people with acquired haemophilia A (all ages) First published: June 2018 Prepared by the National Institute for Health and Care Excellence (NICE) Commissioning Support Programme Published by NHS England, in electronic format only.
    [Show full text]
  • Urokinase, a Promising Candidate for Fibrinolytic Therapy for Intracerebral Hemorrhage
    LABORATORY INVESTIGATION J Neurosurg 126:548–557, 2017 Urokinase, a promising candidate for fibrinolytic therapy for intracerebral hemorrhage *Qiang Tan, MD,1 Qianwei Chen, MD1 Yin Niu, MD,1 Zhou Feng, MD,1 Lin Li, MD,1 Yihao Tao, MD,1 Jun Tang, MD,1 Liming Yang, MD,1 Jing Guo, MD,2 Hua Feng, MD, PhD,1 Gang Zhu, MD, PhD,1 and Zhi Chen, MD, PhD1 1Department of Neurosurgery, Southwest Hospital, Third Military Medical University, Chongqing; and 2Department of Neurosurgery, 211st Hospital of PLA, Harbin, People’s Republic of China OBJECTIVE Intracerebral hemorrhage (ICH) is associated with a high rate of mortality and severe disability, while fi- brinolysis for ICH evacuation is a possible treatment. However, reported adverse effects can counteract the benefits of fibrinolysis and limit the use of tissue-type plasminogen activator (tPA). Identifying appropriate fibrinolytics is still needed. Therefore, the authors here compared the use of urokinase-type plasminogen activator (uPA), an alternate thrombolytic, with that of tPA in a preclinical study. METHODS Intracerebral hemorrhage was induced in adult male Sprague-Dawley rats by injecting autologous blood into the caudate, followed by intraclot fibrinolysis without drainage. Rats were randomized to receive uPA, tPA, or saline within the clot. Hematoma and perihematomal edema, brain water content, Evans blue fluorescence and neurological scores, matrix metalloproteinases (MMPs), MMP mRNA, blood-brain barrier (BBB) tight junction proteins, and nuclear factor–κB (NF-κB) activation were measured to evaluate the effects of these 2 drugs in ICH. RESULTS In comparison with tPA, uPA better ameliorated brain edema and promoted an improved outcome after ICH.
    [Show full text]
  • Coagulation Factor IX (Recombinant) - Drugbank
    12/7/2017 Coagulation Factor IX (Recombinant) - DrugBank Coagulation Factor IX (Recombinant) Targets (7) Biointeractions (4) IDENTIFICATION Name Coagulation Factor IX (Recombinant) Accession Number DB00100 (BTD00038, BIOD00038) Type Biotech Groups Approved Biologic Classification Protein Based Therapies Blood factors Description Recombinant Coagulation Factor IX is a purified Factor IX glycoprotein produced by recombinant DNA technology. It has a primary amino acid sequence that is identical to the Ala148 allelic form of human factor IX, and has structural and functional characteristics similar to those of endogenous factor IX. It is not derived from human blood (unlike human Factor IX complex), and is instead produced by a genetically engineered Chinese hamster ovary (CHO) cell line that secretes recombinant Factor IX into cell medium that is then processed and purified for use as a pharmaceutical agent. Recombinant Factor IX is indicated for the control and prevention of bleeding episodes in adult and pediatric patients with congenital factor IX deficiency (Hemophilia B). Protein structure Protein chemical formula C2041H3136N558O641S25 Protein average weight 46548.2 Da https://www.drugbank.ca/drugs/DB00100 1/13 12/7/2017 Coagulation Factor IX (Recombinant) - DrugBank 46548.2 Da Sequences >DB00100 sequence YNSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGG SCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAEN QKSCEPAVPFPCGRVSVSQTSKLTRAEAVFPDVDYVNSTEAETILDNITQSTQSFNDFTR VVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEE
    [Show full text]
  • Familial Multiple Coagulation Factor Deficiencies
    Journal of Clinical Medicine Article Familial Multiple Coagulation Factor Deficiencies (FMCFDs) in a Large Cohort of Patients—A Single-Center Experience in Genetic Diagnosis Barbara Preisler 1,†, Behnaz Pezeshkpoor 1,† , Atanas Banchev 2 , Ronald Fischer 3, Barbara Zieger 4, Ute Scholz 5, Heiko Rühl 1, Bettina Kemkes-Matthes 6, Ursula Schmitt 7, Antje Redlich 8 , Sule Unal 9 , Hans-Jürgen Laws 10, Martin Olivieri 11 , Johannes Oldenburg 1 and Anna Pavlova 1,* 1 Institute of Experimental Hematology and Transfusion Medicine, University Clinic Bonn, 53127 Bonn, Germany; [email protected] (B.P.); [email protected] (B.P.); [email protected] (H.R.); [email protected] (J.O.) 2 Department of Paediatric Haematology and Oncology, University Hospital “Tzaritza Giovanna—ISUL”, 1527 Sofia, Bulgaria; [email protected] 3 Hemophilia Care Center, SRH Kurpfalzkrankenhaus Heidelberg, 69123 Heidelberg, Germany; ronald.fi[email protected] 4 Department of Pediatrics and Adolescent Medicine, University Medical Center–University of Freiburg, 79106 Freiburg, Germany; [email protected] 5 Center of Hemostasis, MVZ Labor Leipzig, 04289 Leipzig, Germany; [email protected] 6 Hemostasis Center, Justus Liebig University Giessen, 35392 Giessen, Germany; [email protected] 7 Center of Hemostasis Berlin, 10789 Berlin-Schöneberg, Germany; [email protected] 8 Pediatric Oncology Department, Otto von Guericke University Children’s Hospital Magdeburg, 39120 Magdeburg, Germany; [email protected] 9 Division of Pediatric Hematology Ankara, Hacettepe University, 06100 Ankara, Turkey; Citation: Preisler, B.; Pezeshkpoor, [email protected] B.; Banchev, A.; Fischer, R.; Zieger, B.; 10 Department of Pediatric Oncology, Hematology and Clinical Immunology, University of Duesseldorf, Scholz, U.; Rühl, H.; Kemkes-Matthes, 40225 Duesseldorf, Germany; [email protected] B.; Schmitt, U.; Redlich, A.; et al.
    [Show full text]
  • A Guide for People Living with Von Willebrand Disorder CONTENTS
    A guide for people living with von Willebrand disorder CONTENTS What is von Willebrand disorder (VWD)?................................... 3 Symptoms............................................................................................... 5 Types of VWD...................................................................................... 6 How do you get VWD?...................................................................... 7 VWD and blood clotting.................................................................... 11 Diagnosis................................................................................................. 13 Treatment............................................................................................... 15 Taking care of yourself or your child.............................................. 19 (Education, information, first aid/medical emergencies, medication to avoid) Living well with VWD......................................................................... 26 (Sport, travel, school, telling others, work) Special issues for women and girls.................................................. 33 Connecting with others..................................................................... 36 Can I live a normal life with von Willebrand disorder?............. 37 More information................................................................................. 38 2 WHAT IS VON WILLEBRAND DISORDER (VWD)? Von Willebrand disorder (VWD) is an inherited bleeding disorder. People with VWD have a problem with a protein
    [Show full text]
  • Fibrin Induces Release of Von Willebrand Factor from Endothelial Cells
    Fibrin induces release of von Willebrand factor from endothelial cells. J A Ribes, … , C W Francis, D D Wagner J Clin Invest. 1987;79(1):117-123. https://doi.org/10.1172/JCI112771. Research Article Addition of fibrinogen to human umbilical vein endothelial cells in culture resulted in release of von Willebrand factor (vWf) from Weibel-Palade bodies that was temporally related to formation of fibrin in the medium. Whereas no release occurred before gelation, the formation of fibrin was associated with disappearance of Weibel-Palade bodies and development of extracellular patches of immunofluorescence typical of vWf release. Release also occurred within 10 min of exposure to preformed fibrin but did not occur after exposure to washed red cells, clot liquor, or structurally different fibrin prepared with reptilase. Metabolically labeled vWf was immunopurified from the medium after release by fibrin and shown to consist of highly processed protein lacking pro-vWf subunits. The contribution of residual thrombin to release stimulated by fibrin was minimized by preparing fibrin clots with nonstimulatory concentrations of thrombin and by inhibiting residual thrombin with hirudin or heating. We conclude that fibrin formed at sites of vessel injury may function as a physiologic secretagogue for endothelial cells causing rapid release of stored vWf. Find the latest version: https://jci.me/112771/pdf Fibrin Induces Release of von Willebrand Factor from Endothelial Cells Julie A. Ribes, Charles W. Francis, and Denisa D. Wagner Hematology Unit, Department ofMedicine, University ofRochester School ofMedicine and Dentistry, Rochester, New York 14642 Abstract erogeneous and can be separated by sodium dodecyl sulfate (SDS) electrophoresis into a series of disulfide-bonded multimers Addition of fibrinogen to human umbilical vein endothelial cells with molecular masses from 500,000 to as high as 20,000,000 in culture resulted in release of von Willebrand factor (vWf) D (8).
    [Show full text]
  • Plasma Levels of Plasminogen Activator Inhibitor Type 1, Factor VIII
    Plasma Levels of Plasminogen Activator Inhibitor Type 1, Factor VIII, Prothrombin ,Activation Fragment 1؉2, Anticardiolipin and Antiprothrombin Antibodies are Risk Factors for Thrombosis in Hemodialysis Patients Daniela Molino,*,†,‡ Natale G. De Santo,* Rosa Marotta,*,†,§ Pietro Anastasio,* Mahrokh Mosavat,† and Domenico De Lucia† Patients with end-stage renal disease are prone to hemorrhagic complications and simul- taneously are at risk for a variety of thrombotic complications such as thrombosis of dialysis blood access, the subclavian vein, coronary arteries, cerebral vessel, and retinal veins, as well as priapism. The study was devised for the following purposes: (1) to identify the markers of thrombophilia in hemodialyzed patients, (2) to establish a role for antiphos- pholipid antibodies in thrombosis of the vascular access, (3) to characterize phospholipid antibodies in hemodialysis patients, and (4) to study the effects of dialysis on coagulation cascade. A group of 20 hemodialysis patients with no thrombotic complications (NTC) and 20 hemodialysis patients with thrombotic complications (TC) were studied along with 400 volunteer blood donors. Patients with systemic lupus erythematosus and those with nephrotic syndrome were excluded. All patients underwent a screening prothrombin time, activated partial thromboplastin time, fibrinogen (Fg), coagulation factors of the intrinsic and extrinsic pathways, antithrombin III (AT-III), protein C (PC), protein S (PS), resistance to activated protein C, prothrombin activation fragment 1؉2 (F1؉2), plasminogen, tissue type plasminogen activator (t-PA), plasminogen tissue activator inhibitor type-1 (PAI-1), anticardiolipin antibodies type M and G (ACA-IgM and ACA-IgG), lupus anticoagulant antibodies, and antiprothrombin antibodies type M and G (aPT-IgM and aPT-IgG).
    [Show full text]
  • Recommended Abbreviations for Von Willebrand Factor and Its Activities
    RECOMMENDED ABBREVIATIONS FOR VON WILLEBRAND FACTOR AND ITS ACTIVITIES On behalf of the von Willebrand Factor Subcommittee of the Scientific and Standardization Committee of the International Society on Thrombosis and Haemostasis Claudine Mazurier and Francesco Rodeghiero Previous official recommendations concerning the abbreviations for von Willebrand Factor (and factor VIII) are 15 years old and were limited to "vWf" for the protein and "vWf:Ag" for the antigen (1). Nowadays, the various properties of von Willebrand Factor (ristocetin cofactor activity and capacity to bind to either collagen or factor VIII) are better defined and may warrant specific abbreviations. Furthermore, the protein synthesized by the von Willebrand factor gene is now abbreviated as pre-pro-VWF (2). Accordingly, the subcommittee on von Willebrand Factor of the Scientific and Standardization Committee of the ISTH has recommended new abbreviations for von Willebrand Factor antigen and its various activities, currently measured by immunologic or functional assays (Table I). It is hoped that a uniform application of the abbreviations recommended here will improve communication among scientists and clinicians, especially for those who are less familiar with the field. Table 1: Recommended abbreviations for von Willebrand Factor and its activities Attribute Recommended abbreviations Mature protein VWF Antigen VWF:Ag Ristocetin cofactor activity VWF:RCo Collagen binding capacity VWF:CB Factor VIII binding capacity VWF:FVIIIB REFERENCES: 1 – Marder VJ, Mannucci PM, Firkin BG, Hoyer LW and Meyer D. Standard nomenclature for factor VIII and von Willebrand factor: a recommendation by the International Committee on Thrombosis and Haemostasis. Thromb. Haemost. 1985, 54, 871-2. 2 – Goodeve AC, Eikenboom JCJ, Ginsburg D, Hilbert L, Mazurier C, Peake IR, Sadler JE, Rodeghiero F on behalf of the ISTH SSC subcommittee on von Willebrand Factor.
    [Show full text]
  • Biomechanical Thrombosis: the Dark Side of Force and Dawn of Mechano-­ Medicine
    Open access Review Stroke Vasc Neurol: first published as 10.1136/svn-2019-000302 on 15 December 2019. Downloaded from Biomechanical thrombosis: the dark side of force and dawn of mechano- medicine Yunfeng Chen ,1 Lining Arnold Ju 2 To cite: Chen Y, Ju LA. ABSTRACT P2Y12 receptor antagonists (clopidogrel, pras- Biomechanical thrombosis: the Arterial thrombosis is in part contributed by excessive ugrel, ticagrelor), inhibitors of thromboxane dark side of force and dawn platelet aggregation, which can lead to blood clotting and A2 (TxA2) generation (aspirin, triflusal) or of mechano- medicine. Stroke subsequent heart attack and stroke. Platelets are sensitive & Vascular Neurology 2019;0. protease- activated receptor 1 (PAR1) antag- to the haemodynamic environment. Rapid haemodynamcis 1 doi:10.1136/svn-2019-000302 onists (vorapaxar). Increasing the dose of and disturbed blood flow, which occur in vessels with these agents, especially aspirin and clopi- growing thrombi and atherosclerotic plaques or is caused YC and LAJ contributed equally. dogrel, has been employed to dampen the by medical device implantation and intervention, promotes Received 12 November 2019 platelet thrombotic functions. However, this platelet aggregation and thrombus formation. In such 4 Accepted 14 November 2019 situations, conventional antiplatelet drugs often have also increases the risk of excessive bleeding. suboptimal efficacy and a serious side effect of excessive It has long been recognized that arterial bleeding. Investigating the mechanisms of platelet thrombosis
    [Show full text]
  • ER Guide to Bleeding Disorders
    Bleeding disorders ER guide to bleeding disorders 1 Table of contents 4 General Guidelines 4–5 national Hemophilia Foundation guidelines 5–10 Treatment options 10 HemopHilia a Name:__________________________________________________________________________________________________ 10–11 national Hemophilia Foundation guidelines Address:________________________________________________________________________________________________ 12 dosage chart Phone:__________________________________________________________________________________________________ 14–15 Treatment products 16 HemopHilia B In case of emergency, contact: ______________________________________________________________________________ 16 national Hemophilia Foundation guidelines Relation to patient:________________________________________________________________________________________ 17 dosage chart 18 Treatment products 19 HemopHilia a or B with inHiBiTors Diagnosis: Hemophilia A: Mild Moderate Severe 20 national Hemophilia Foundation guidelines Inhibitors Inhibitors Bethesda units (if known) ____________________________________ 21 Treatment products Hemophilia B: Mild Moderate Severe 22–23 Von willeBrand disease Inhibitors Inhibitors Bethesda units (if known) ____________________________________ 23–24 national Hemophilia Foundation guidelines von Willebrand disease: Type 1 Type 2 Type 3 Platelet type 25 Treatment products 27 Bibliography Preferred product:_________________________________________________________________________________________ Dose for life-threatening
    [Show full text]
  • Justification
    Justification to the Resolution of the Federal Joint Committee (G-BA) on an Amendment of the Pharmaceuticals Directive (AM ‑ RL): Annex XII – Resolutions on the Benefit Assessment of Medicinal Products with New Active Ingredients in Accordance with Section 35a SGB V Damoctocog alfa pegol From 20 June 2019 Contents 1. Legal basis ................................................................................................................ 2 2. Key points of the resolution ..................................................................................... 2 2.1 Additional benefit of the medicinal product in relation to the appropriate comparator therapy ..................................................................................................... 3 2.1.1 Approved therapeutic indication of damoctocog alfa pegol (Jivi®) in accordance with the summary of product characteristics ............................................ 3 2.1.2 Appropriate comparator therapy ................................................................... 3 2.1.3 Extent and probability of the additional benefit .............................................. 5 2.1.4 Summary of the assessment ........................................................................ 6 2.2 Number of patients or demarcation of patient groups eligible for treatment ...... 6 2.3 Requirements for a quality-assured application ................................................ 7 2.4 Treatment costs ..............................................................................................
    [Show full text]