DOCSLIB.ORG

Patent Application Publication Oo) Pub. No.: US 2010/0129357 Al Garcia-Martinez Et Al

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Patent Application Publication Oo) Pub. No.: US 2010/0129357 Al Garcia-Martinez Et Al US 20100129357A1 US 20100129357A1 (19) United States (12) Patent Application Publication oo) Pub. No.: US 2010/0129357 Al Garcia-Martinez et al. (43) Pub. Date: May 27,2010 (54) ANTIBODIES TO IL-6 AND USE THEREOF filed on Nov. 25, 2008, provisional application No. 61/117,811, filed on Nov. 25, 2008. (76) Inventors: Leon Garcia-Martinez, Woodinville, WA (US); Ann Elisabeth Carvalho Jensen, Publication Classification Edmonds, WA (US); Katie Olson, (51) Int. Cl. Kenmore, WA (US); Ben Dutzar, A61K 39/395 (2006.01) Seattle, WA (US); Ethan Ojala, A61P 37/02 (2006.01) Snohomish, WA (US); Brian Kovacevich, Snohomish, WA (US); (52) U.S. Cl.......................................................... 424/133.1 John Latham, Seattle, WA (US); Jeffrey T. L. Smith, Redmond, WA (US) (57) ABSTRACT Correspondence Address: The present invention is directed to therapeutic methods HUNTON & WILLIAMS LLP using IL-6 antagonists such as an Abl antibody or antibody INTELLECTUAL PROPERTY DEPARTMENT fragment having binding specificity for IL-6 to prevent or 1900 K STREET, N.W., SUITE 1200 treat disease or to improve survivability or quality of life of a WASHINGTON, DC 20006-1109 (US) patient in need thereof. In preferred embodiments these patients will comprise those exhibiting (or at risk of develop­ (21) Appl. No.: 12/502,581 ing) an elevated serum C-reactive protein level, reduced (22) Filed: Jul. 14, 2009 serum albumin level, elevated D-dimer or other cogulation cascade related protein(s), cachexia, fever, weakness and/or Related U.S. Application Data fatigue prior to treatment. The subject therapies also may (60) Provisional application No. 61/117,861, filed on Nov. include the administration of other actives such as chemo- 25, 2008, provisional application No. 61/117,839, therapeutics, anti-coagulants, statins, and others. AB1LOAD I AB PANEL LOAD TIME (SECONDS) PatentApplicationPublication May 27, 2010 Sheet I of 44 US 2010/0129357 Al FIG. 1 :t------ ti" AB1LOAD I AB PANEL LOAD TIME (SECONDS) PatentApplicationPublication FIG. 2 FRl CDRl FR2 CDR2 FR3 I 23 24 34 35 49 50 56 57 88 RbtVL AYDMTQTPASVEVAVGGTVTINC QASETIYSWLS WYQQKPGQPPKLLIY QASDLAS GVPSRFSGSGAGTEYTLTISGVQCDDAATYYC III I Il III I Il I Il lllllll HIM Il I I MMIMII III Mill I M Mill L12A DIQMTQSPSTLSASVGDRVTITC RASQSISSWLA WYQQKPGKAPKLLIY HASSLES GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC Vl DIQMTQSPSTLSASVGDRVTITC RASQSISSWLA WYQQKPGKAPKLLIY DASSLES GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC VxO2 DIQMTQSPSSLSASVGDRVTITC RASQSISSYLN WYQQKPGKAPKLLIY AASSLQS GVPSRFSGSGSGTDFTLTISSLQPEDPATYYC VLh DIQMTQSPSTLSASVGDRVTITC QASETIYSWLS WYQQKPGKAPKLLIY QASDLAS GVPSRFSGSGSGTEFTLTISSLQPDDFATYYC CDR3 FR4 May 89 100 101 111 RbtVL QQGYSGSNVDNV FGGGTEVWKR Mill I M 27, FGGGTKVEIKR VLh FGGGTKVEIKR 2010 Sheet FRl CDRl FR2 CDR2 FR3 I 30 31 35 36 49 50 66 67 98 2 RbtVH QEQLKESGGRLVTPGTPLTLTCTASGFSLN DHAMG WVRQAPGKGLEYIG FINS-GGSARYASWAEG RFTISRTST- -TVDLKMTSLTTEDTATYFCVR of I M MM MM III Mil M 111111111MI I I III M I MMM I I Ml MM I I I 44 3-64-04 QVQLVESGGGLVQPGGSLRLSCSASGFTFS SYAMH WVRQAPGKGLEYVS AISSNGGSTYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR 3-66-04 EVQLVESGGGLVQPGGSLRLSCAASGFTVS SNYMS WVRQAPGKGLEWVS VIYS-GGSTYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR 3-53-02 EVQLVETGGGLIQPGGSLRLSCAASGFTVS SNYMS WVRQAPGKGLEWVS VIYS-GGSTYYADSVKG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR VHh QVQLVESGGGLVQPGGSLRLSCSASGFSLN DHAMG WVRQAPGKGLEYVG FINS-GGSARYAS|i|AEG RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR US 2010/0129357 CDR3 FR4 99 HO 111 121 RbtVH GGAVWSIHSFDP WGPGTLVTVSS M MMMM WGQGTLVTVSS VHh GGAVWSIHSFDP WGQGTLVTVSS Al Patent Application Publication May 27, 2010 Sheet 3 of 44 US 2010/0129357 Al FIG. 3 460 123456789 IO 11 12 Π1Ι Just IgG Mff IL-Gor B-IL-G HjlHlgG and IL-G or B-IL-G I 2 3 4 5 6 7 8 9 1011 12 A B C HIIIIIH D Eilium F G H 462 I 2 3 4 5 6 7 8 9 10 11 12 A IIIIIHII B C D E F G H 463 I 2 3 4 5 6 7 8 9 10 1112 A I lllllll B Hill C D IIIIIHII E F ilium G H PatentApplicationPublication May 27, 2010 Sheet 4 of 44 US 2010/0129357 Al FIG. 4 2000-1 0.03mg/kg Ab 1 1500- Control £ 1000- 0.1 mg/kg Ab1 ID50 = 0.09273 mg/kg r2 = 0.9701 1 mg/kg Ab1 Log DoseAbI PatentApplicationPublication May 27, 2010 Sheet 5 of 44 US 2010/0129357 Al FIG. 5 100 90 Polyclonal IgG (n=9) -·- PBS (n=10) Ab 1 (n=30) 80 70 60 I I 50 O a> a. 40 30 I k 20 Ϊ-Γ4 10 O 0 5 10 15 20 25 30 Time (days) Patent Application Publication May 27, 2010 Sheet 6 of 44 US 2010/0129357 Al FIG. 6 100 m */- Polyclonal IgG (n=9) 90 ••PBS (n=10) *-Ab1 (n=30) 80 70 60 ! 50 υ <D CL 40 30 I k 20 10 O O 10 15 20 25 30 Time (days) Patent Application Publication May 27, 2010 Sheet 7 of 44 US 2010/0129357 Al FIG. 7 100 90 I I 80 1-1 Polyclonal IgG (270-320mg TW) Ab1 (270-320mg TW) I 70 k I Tc 60 > > I 50 § ω CL 40 30 20 I 10 I------A OH------ 1 I I----- —I·.· I-------III11 O 5 10 15 20 25 30 35 40 45 50 Time (days) Patent Application Publication May 27, 2010 Sheet 8 of 44 US 2010/0129357 Al FIG. 8 Polyclonal IgG (400-527mg TW) Ab1 (400-527mg TW) 0. 40- Time (days) DS 2010/0129357 Al May Sheet 9 of 44 Patent Application Publication FIG. 9 300 Time (h) PatentApplicationPublication May 27, 2010 Sheet 10 of 44 US 2010/0129357 Al FIG. 10A Ab4 BLOCKS GP130 BINDING 2.0000- ANTI BODY 1.5000-- 1.0000-- BUFFER CONTROL 0.5000-- 1500 2000 2500 3000 3500 4000 TIME (SECONDS) PatentApplication Publication May 27, 2010 Sheet 11 of 44 US 2010/0129357 Al FIG. 10B Ab3 BLOCKS GP130 BINDING 2.5000- - ANTIBODY GP130. 2.0000-- 1 1.5000-- BUFFER CONTROL 1.0000- 0.5000— 1500 2000 2500 3000 3500 TIME (SECONDS) PatentApplicationPublication May 27, 2010 Sheet 12 of 44 US 2010/0129357 Al FIG. 10C Ab8 BLOCKS GP130 BINDING -CONTROL ANTIBODY -Ab8 TIME (SECONDS) PatentApplicationPublication May 27, 2010 Sheet 13 of 44 US 2010/0129357 Al FIG. 10D Ab2 INHIBITS GP130 BINDING CONTROL ANTIBODY Ab2 8888502 M. 0.8000 CD Q m 0,6000 0.4000-- 0.2000-- 0.0000 I I I I I I > I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I I 200 400 600 800 1000 1200 1400 1600 1800 TIME (SECONDS) Patent Application Publication May 27, 2010 Sheet 14 of 44 US 2010/0129357 Al FIG. 10E 1.4000-- C0NTR0L ANTIBODY 1.2000-- 1.0000-- 0.4000 — ANTIBODY 0.2000—1 200 400 600 800 1000 1200 1400 1600 1800 TIME (SECONDS) PatentApplicationPublication May 27, 2010 Sheet 15 of 44 US 2010/0129357 Al FIG. 11 Antibody Blocks IL6 Blocks IL6 Reference binding to FM binding to GP130 Ab1 Yes Yes 021051 Ab2 No Partial 021050 Ab3 No Yes 021030 Ab4 No Yes 021050 Ab6 Yes Yes 021051 Ab7 Yes Yes 021051 Ab8 No Yes 021051 PatentApplicationPublication FIG. 12 I VPPGEDSKDVAAPHR (SEQ ID NO: 590) 20 ENNLNL P KMAE KDGC (SEQ ID NO: 609) 39 QMSTKVLIQFLQKKA (SEQ ID NO: 628) 2 GEDSKDVAAPHRQPL (SEQ ID NO: 591) 21 LNLPKMAE KDGCFQS (SEQ ID NO: 610) 40 TKVLIQFLQKKAKNL (SEQ ID NO: 629) 3 SKDVAAPHRQPLTSS (SEQ ID NO: 592) 22 PKMAEKDGCFQSGFN (SEQ ID NO: 611) 41 LIQFLQKKAKNLDAI (SEQ ID NO: 630) 4 VAAPHRQPLTSSERI (SEQ ID NO: 593) 23 AEKDGCFQSGFNEET (SEQ ID NO: 612) 42 FLQKKAKNLDAITTP (SEQ ID NO: 631) 5 PHRQPLTSSERIDKQ (SEQ ID NO: 594) ■24 DGCFQSGFNEETCLV (SEQ ID NO: 613) 43 KKAKNLDAITTPDPT (SEQ ID NO: 632) 6 QPLTSSERIDKQIRY (SEQ ID NO: 595) 25 FQSGFNEETCLVKII (SEQ ID NO: 614) 44 KNLDAITTPDPTTNA (SEQ ID NO: 633) May 7 TSSERIDKQIRYILD (SEQ ID NO: 596) 26 GFNEETCLVKIITGL (SEQ ID NO: 615) 45 DAITTPDPTTNASLL (SEQ ID NO: 634) 27, ERIDKQIRYILDGIS (SEQ ID 597) 27 EETCLVKIITGLLEF (SEQ ID NO: 616) 46 TTPDPTTNASLLTKL (SEQ ID NO: 8 NO: 635) 2010 9 DKQIRYILDGISALR (SEQ ID NO: 598) 28 CLVKIITGLLEFEVY (SEQ ID NO: 617) 47 DPTTNASLLTKLQAQ (SEQ ID NO: 636) 10 IRYILDGISALRKET (SEQ ID NO: 599) 29 KIITGLLEFEVYLEY (SEQ ID NO: 618) 48 TNASLLTKLQAQNQW (SEQ ID NO: 637) Sheet 11 ILDGISALRKETCNK (SEQ ID NO: 600) 30 TGLLEFEVYLEYLQN (SEQ ID NO: 619) 49 SLLTKLQAQNQWLQD (SEQ ID NO: 638) 12 GISALRKETCNKSNM (SEQ ID NO: 601) 31 LE FEVYLEYLQNRFE (SEQ ID NO: 620) 50 TKLQAQNQWLQDMTT (SEQ ID NO: 639) 16 ■13 ALRKETCNKSNMCES (SEQ ID NO: 602) 32 EVYLEYLQNRFESSE (SEQ ID NO: 621) 51 QAQNQWLQDMTTHLI (SEQ ID NO: 640) of 14 KETCNKSNMCESSKE (SEQ ID NO: 603) 33 LEYLQNRFESSEEQA (SEQ ID NO: 622) 52 NQWLQDMTTHLILRS (SEQ ID NO: 641) 44 15 CNKSNMCE S S KEALA (SEQ ID NO: 604) 34 LQNRFESSEEQARAV (SEQ ID NO: 623) 53 LQDMTTHLILRSFKE (SEQ ID NO: 642) US 16 SNMCESSKEALAENN (SEQ ID NO: 605) 35 RFESSEEQARAVQMS (SEQ ID NO: 624) 54 MTTHLILRSFKEFLQ (SEQ ID NO: 643) 17 CESSKEALAENNLNL (SEQ ID NO: 606) 36 SSEEQARAVQMSTKV (SEQ ID NO: 625) 55 HLILRSFKEFLQSSL (SEQ ID NO: 644) 2010/0129357 18 SKEALAENNLNLPKM (SEQ ID NO: 607) 37 EQARAVQMSTKVLIQ (SEQ ID NO: 626) 56 LRSFKEFLQSSLRAL (SEQ ID NO: 645) 19 ALAENNLNLPKMAEK (SEQ ID NO: 608) 38 RAVQMSTKVLIQFLQ (SEQ ID NO: 627) ■57 FKEFLQSSLRALRQM (SEQ ID NO: 646) Al PatentApplicationPublication May 27, 2010 Sheet 17 of 44 US 2010/0129357 Al FIG. 13 PatentApplicationPublication May 27, 2010 Sheet 18 of 44 US 2010/0129357 Al FIG. 14 PatentApplicationPublication FIG. 15 A. Surface Plasmon Resonance: Averaged binding constants determined at 25 ° C for Abl to IL-6. Species (IL-6) Ka (M-1S'1) Kd (s-1) Kd Rat 1.6e6 2.2e-3 1.4 nM Mouse Lle6 4.0e-4 0.4 nM Dog Below LOQa Below LOQa Below LOQa Human 1.6e5 5e-7 4 pM May Cynomolgus 27, monkey 9.6e4 3e-6 31 pM 2010 a.
Load more

Recommended publications
  • Prezentace Aplikace Powerpoint
    Analgesics - antipyretics = „weak“ analgesics = non-opioid analgesics Most of them also • non-steroidal anti-inflamatory drugs (NSAIDs) •antirheumatics Oldřich Farsa 2011 Metabolism of eicosanoids O O arachidonic O H acid = 2 C O R1 R2 OH R2 O OH CH C O P O + 3 H N CH 2 O 3 CH3 glucocorticoids inhibitors of phspholipase A2 prostaglandins sythesis = COOH = "weak" analgesics + lipoxygenase inhibitors + NSAIDs arachidonic acid cyclooxygenases (COX1 + COX2) lipoxygenase OOH O COOH COOH O PG 5-hydroperoxy-6-trans-8,11,14-cis-eikosatetraenoic acid G2 OOH (5-HPETE) cyklooxygenases tromboxan synthase prostacyklin synthase PG H2 PG I2 = prostacyklin TX A2 endothelium cells LT A4 trombocytes isomerases PG D2 PG E2 LT C4 LT B4 PG F2α all the cells LT D4 LT E4 Effects of prostaglandins ↓ Prostaglandin E, F2α : ache, fewer, inflammation, sekretion of HCl , stomach mucosa capilaries dilatation, contraction of + ↑ uterus, kidneys: excretion of Na and H2O Prostacyclin (prostaglandin I ): vasodilatation, platelets aggregation inhibition 2 Tromboxan: vasokonstriction, platelets aggregation activation Leukotriens: alergic reactions (e.g. asthma bronchiale) Cyklooxygenases (= prostaglandin G/H synthases) COX1 Constitutive: in all the tissues Functions: •protection of stomach mucosa (vasodilatation) •diuresis •platelets aggregation (TXA) COX2 Philipp Needlemann Constitutive: kidneys, brain (co-localized with cyclins D and E) inventor of COX 1 isoenzymes Inducible: macrophages, neutrophfils, fibroblasts, endothelium cells (1989) Functions: •vasodilatation
    [Show full text]
  • Expression of the P53 Inhibitors MDM2 and MDM4 As Outcome
    ANTICANCER RESEARCH 36 : 5205-5214 (2016) doi:10.21873/anticanres.11091 Expression of the p53 Inhibitors MDM2 and MDM4 as Outcome Predictor in Muscle-invasive Bladder Cancer MAXIMILIAN CHRISTIAN KRIEGMAIR 1* , MA TT HIAS BALK 1, RALPH WIRTZ 2* , ANNETTE STEIDLER 1, CLEO-ARON WEIS 3, JOHANNES BREYER 4* , ARNDT HARTMANN 5* , CHRISTIAN BOLENZ 6* and PHILIPP ERBEN 1* 1Department of Urology, University Medical Centre Mannheim, Mannheim, Germany; 2Stratifyer Molecular Pathology, Köln, Germany; 3Institute of Pathology, University Medical Centre Mannheim, Mannheim, Germany; 4Department of Urology, University of Regensburg, Regensburg, Germany; 5Institute of Pathology, University Erlangen-Nuernberg, Erlangen, Germany; 6Department of Urology, University of Ulm, Ulm, Germany Abstract. Aim: To evaluate the prognostic role of the p53- Urothelical cell carcinoma (UCC) of the bladder is the second upstream inhibitors MDM2, MDM4 and its splice variant most common urogenital neoplasm worldwide (1). Whereas MDM4-S in patients undergoing radical cystectomy (RC) for non-muscle invasive UCC can be well treated and controlled muscle-invasive bladder cancer (MIBC). Materials and by endoscopic resection, for MIBC, which represents 30% of Methods: mRNA Expression levels of MDM2, MDM4 and tumor incidence, radical cystectomy (RC) remains the only MDM4-S were assessed by quantitative real-time polymerase curative option. However, MIBC progresses frequently to a chain reaction (qRT-PCR) in 75 RC samples. Logistic life-threatening metastatic disease with limited therapeutic regression analyses identified predictors of recurrence-free options (2). Standard clinical prognosis parameters in bladder (RFS) and cancer-specific survival (CSS). Results: High cancer such as stage, grade or patient’s age, have limitations expression was found in 42% (MDM2), 27% (MDMD4) and in assessing individual patient’s prognosis and response to 91% (MDM4-S) of tumor specimens.
    [Show full text]
  • (12) Patent Application Publication (10) Pub. No.: US 2009/0156582 A1 Tsukamoto Et Al
    US 20090156582A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2009/0156582 A1 Tsukamoto et al. (43) Pub. Date: Jun. 18, 2009 (54) PYRAZOLE COMPOUND Publication Classification (76) Inventors: Tetsuya Tsukamoto, Osaka-shi, (51) Int. Cl. Osaka (JP); Takeshi Yamamoto, A6II 3/55 (2006.01) Osaka-shi,Osaka (JP); Ryosuke A63L/454 (2006.01) Tokunoh, Osaka-shi, Osaka (JP); A63L/462 (2006.01) Tomohiro Kawamoto, Osaka-shi, C07D 403/02 (2006.01) Osaka (JP); Masahiro Okura, Osaka-shi, Osaka (JP); Masakumi (52) U.S. Cl. .................... 514/217.09: 514/406; 514/326; Kori, Osaka-shi, Osaka (JP); 548/364.1: 548/368.4: 546/211; 540/603 Katsuhito Murase, Osaka-shi, Osaka (JP) (57) ABSTRACT Correspondence Address: The present invention provides a pyrazole compound repre WENDEROTH, LIND & PONACK, L.L.P. sented by the formula (I): 1030 15th Street, N.W., Suite 400 East Washington, DC 20005-1503 (US) b (Io) (21) Appl. No.: 11/884,054 Ra R (22) PCT Filed: Feb. 9, 2006 (86). PCT No.: PCT/UP2006/302686 S371 (c)(1), wherein ring Ao is a pyrazole ring optionally further having 1 (2), (4) Date: Sep. 14, 2007 or 2 substituents; R is a substituted carbamoyl group; and R' (30) Foreign Application Priority Data is an optionally Substituted acylamino group, or a salt thereof or a prodrug thereof, which is useful as an agent for the Feb. 9, 2005 (JP) .................................. O333562005 prophylaxis or treatment of GSK-3? related pathology or Dec. 22, 2005 (JP) .................................. 3709622005 disease, and a GSK-3? inhibitor including same. US 2009/0156582 A1 Jun.
    [Show full text]
  • Sleason, Redwood City, CA (US), Juan W. W333. a 3. C
    USOO8288373B2 (12) United States Patent (10) Patent No.: US 8,288,373 B2 Chen et al. (45) Date of Patent: Oct. 16, 2012 (54) MODULATORS OF CXCR7 FOREIGN PATENT DOCUMENTS AU 2006-230674 A1 11, 2006 (75) Inventors: Xi Chen, Palo Alto, CA (US); Pingchen WO WOO2,08221 A2 1, 2002 Fan, Fremont, CA (US); Mark M. WO WOO3,O764OO A1 9, 2003 Sleason, Redwood City, CA (US), Juan W. W333. A 3. C. Jaen, Burlingame, CA (US). Lianfa WO WO 2007/126935 A2 11/2007 Li, Palo Alto, CA (US); Jeffrey P. WO WO 2008/008518 A1 1/2008 McMahon, Mountain View, CA (US); WO 2008, 11215.6 A1 9, 2008 Jay Powers, Pacifica, CA (US); Yibin Zeng, Foster City, CA (US); Penglie OTHER PUBLICATIONS Zhang, Foster City, CA (US) Konishi et al. (Yakugaku Zasshi (1973), 93(5), 684-7). Abstract.* r Miao et al., “CXCR7 (RDC1) promotes breast and lung tumor growth (73) Assignee: Chemocentryx, Inc., Mountain View, in vivo and is expressed on tumor-associated vasculature.” 2007. CA (US) PNAS, vol. 104. No. 40, pp. 15735-15740. c Zabel et al., “Elucidation of CXCR-7-Mediated Signaling Events and (*) Notice: Subject to any disclaimer the term of this Inhibition of CXCR4-Mediated Tumor Cell Transendothelial Migra patent is extended or adjusted under 35 tion by CXCR7 Ligands.” The Journal of Immunology, 2009, vol. U.S.C. 154(b) by 171 days. 183, Issue 5, pp. 3204-3211. International Search Reportmailed on Jan. 27, 2010, for International (21) Appl. No.: 12/612,638 Application No. PCT/US09/63298 filed on Nov.
    [Show full text]
  • Medsafe Sheet for Copaxone
    NEW ZEALAND DATA SHEET 1. PRODUCT NAME COPAXONE® 20 mg/mL PRE-FILLED SYRINGE COPAXONE® 40 mg/mL PRE-FILLED SYRINGE 2. QUALITATIVE AND QUANTITATIVE COMPOSITION Copaxone 20 mg/mL contains 20 mg of glatiramer acetate. Copaxone 40 mg/mL contains 40 mg of glatiramer acetate. Glatiramer acetate, the active ingredient in both Copaxone 20 mg/mL and Copaxone 40 mg/mL, is the acetate salt of synthetic polypeptides, containing four naturally occurring amino acids: L-glutamic acid, L-alanine, L-tyrosine and L-lysine with an average molar fraction 0.141, 0.427, 0.095 and 0.338, respectively. The average molecular weight of glatiramer acetate is 5000 to 9000 Daltons. For a full list of excipients, see section 6.1 List of excipients. 3. PHARMACEUTICAL FORM Copaxone is a clear, colourless solution for injection, in a pre-filled syringe. The pH of a 0.5% solution in water is in the range of 5.5 to 7.0 and an osmolarity of about 265 mOsmol/L and 300 mOsmol/L for the 20 mg/mL and 40 mg/mL, respectively. 4. CLINICAL PARTICULARS 4.1 Therapeutic indications Reduction of the frequency of relapses in patients with Relapsing Remitting Multiple Sclerosis. Treatment of patients with a single clinical event suggestive of multiple sclerosis and at least two clinically silent MRI lesions characteristic of multiple sclerosis, if alternative diagnoses have been excluded. 4.2 Dose and method of administration The only recommended route of administration of Copaxone injection is by the subcutaneous route. Copaxone should not be administered by the intravenous or intramuscular routes.
    [Show full text]
  • United States Patent (10) Patent No.: US 9,724,354 B2 Brake Et Al
    USOO9724354B2 (12) United States Patent (10) Patent No.: US 9,724,354 B2 Brake et al. (45) Date of Patent: Aug. 8, 2017 (54) COMBINATION OF CATALYTIC MTORC1/2 6,727.251 B2 4/2004 Bebbington et al. INHIBITORS AND SELECTIVE INHIBITORS g: R 1939: Shano et al. O OF AURORAAKNASE 7,049,116 B2 5, 2006 Shokat 7,148,228 B2 12/2006 Kasibhatla et al. (71) Applicant: Millennium Pharmaceuticals, Inc., 7,271,262 B2 9, 2007 tty al Cambridge, MA (US) 7,572,784 B2 8/2009 Claiborne et al. 8,026,246 B2 9, 2011 Claiborne et al. (72) Inventors: Rachael L. Brake, Natick, MA (US); 8,399.659 B2 3/2013 Claiborne et al. Huifeng Niu, Cambridge, MA (US) 9,102,678 B2 8, 2015 Claiborne et al. g Nu, 2C, 2001/0024.833 A1 9, 2001 Laborde et al. 2002fOO16976 A1 2/2002 Shokat (73) Assignee: Millennium Pharmaceuticals, Inc., 2002fO156081 A1 10, 2002 Hirst et al. Cambridge, MA (US) 2003/0022885 A1 1/2003 Bebbington et al. 2003/0055068 A1 3/2003 Bebbington et al. c - r 2003. O180924 A1 9, 2003 DeSimone (*) Notice: Sibi tO E. site th still 2003/0187001 A1 10, 2003 Calderwood et al. patent 1s extended or adjusted under 2005/0085472 A1 4/2005 Tanaka et al. U.S.C. 154(b) by 0 days. 2005. O197340 A1 9, 2005 Arora et al. 2006,0074074 A1 4/2006 Ohtsuka et al. (21) Appl. No.: 14/777,888 2006/0235031 A1 10, 2006 Arnold et al. 2006/0246551 A1 11/2006 Stack et al.
    [Show full text]
  • Human Anatomy As Related to Tumor Formation Book Four
    SEER Program Self Instructional Manual for Cancer Registrars Human Anatomy as Related to Tumor Formation Book Four Second Edition U.S. DEPARTMENT OF HEALTH AND HUMAN SERVICES Public Health Service National Institutesof Health SEER PROGRAM SELF-INSTRUCTIONAL MANUAL FOR CANCER REGISTRARS Book 4 - Human Anatomy as Related to Tumor Formation Second Edition Prepared by: SEER Program Cancer Statistics Branch National Cancer Institute Editor in Chief: Evelyn M. Shambaugh, M.A., CTR Cancer Statistics Branch National Cancer Institute Assisted by Self-Instructional Manual Committee: Dr. Robert F. Ryan, Emeritus Professor of Surgery Tulane University School of Medicine New Orleans, Louisiana Mildred A. Weiss Los Angeles, California Mary A. Kruse Bethesda, Maryland Jean Cicero, ART, CTR Health Data Systems Professional Services Riverdale, Maryland Pat Kenny Medical Illustrator for Division of Research Services National Institutes of Health CONTENTS BOOK 4: HUMAN ANATOMY AS RELATED TO TUMOR FORMATION Page Section A--Objectives and Content of Book 4 ............................... 1 Section B--Terms Used to Indicate Body Location and Position .................. 5 Section C--The Integumentary System ..................................... 19 Section D--The Lymphatic System ....................................... 51 Section E--The Cardiovascular System ..................................... 97 Section F--The Respiratory System ....................................... 129 Section G--The Digestive System ......................................... 163 Section
    [Show full text]
  • Etats Rapides
    List of European Pharmacopoeia Reference Standards Effective from 2015/12/24 Order Reference Standard Batch n° Quantity Sale Information Monograph Leaflet Storage Price Code per vial Unit Y0001756 Exemestane for system suitability 1 10 mg 1 2766 Yes +5°C ± 3°C 79 ! Y0001561 Abacavir sulfate 1 20 mg 1 2589 Yes +5°C ± 3°C 79 ! Y0001552 Abacavir for peak identification 1 10 mg 1 2589 Yes +5°C ± 3°C 79 ! Y0001551 Abacavir for system suitability 1 10 mg 1 2589 Yes +5°C ± 3°C 79 ! Y0000055 Acamprosate calcium - reference spectrum 1 n/a 1 1585 79 ! Y0000116 Acamprosate impurity A 1 50 mg 1 3-aminopropane-1-sulphonic acid 1585 Yes +5°C ± 3°C 79 ! Y0000500 Acarbose 3 100 mg 1 See leaflet ; Batch 2 is valid until 31 August 2015 2089 Yes +5°C ± 3°C 79 ! Y0000354 Acarbose for identification 1 10 mg 1 2089 Yes +5°C ± 3°C 79 ! Y0000427 Acarbose for peak identification 3 20 mg 1 Batch 2 is valid until 31 January 2015 2089 Yes +5°C ± 3°C 79 ! A0040000 Acebutolol hydrochloride 1 50 mg 1 0871 Yes +5°C ± 3°C 79 ! Y0000359 Acebutolol impurity B 2 10 mg 1 -[3-acetyl-4-[(2RS)-2-hydroxy-3-[(1-methylethyl)amino] propoxy]phenyl] 0871 Yes +5°C ± 3°C 79 ! acetamide (diacetolol) Y0000127 Acebutolol impurity C 1 20 mg 1 N-(3-acetyl-4-hydroxyphenyl)butanamide 0871 Yes +5°C ± 3°C 79 ! Y0000128 Acebutolol impurity I 2 0.004 mg 1 N-[3-acetyl-4-[(2RS)-3-(ethylamino)-2-hydroxypropoxy]phenyl] 0871 Yes +5°C ± 3°C 79 ! butanamide Y0000056 Aceclofenac - reference spectrum 1 n/a 1 1281 79 ! Y0000085 Aceclofenac impurity F 2 15 mg 1 benzyl[[[2-[(2,6-dichlorophenyl)amino]phenyl]acetyl]oxy]acetate
    [Show full text]
  • Information for Authors / Submission Process New
    INFORMATION FOR AUTHORS / SUBMISSION PROCESS NEW Electronic Submission Uniform Requirements for Manuscripts Submitted to Biomedical Journals: Writing and Editing for As of December 1, 2007, the Canadian Journal of Neurological Biomedical Publication International Committee of Sciences went to an Electronic Submission process. ALL manuscript submissions will be handled by an On-Line tracking system. Go to Medical Journal Editors www.cjns.org and click on SUBMIT YOUR MANUSCRIPT and For detailed instructions regarding style and layout refer to "Uniform follow the instructions. requirements for manuscripts submitted to biomedical journals". Copies of this document may be obtained on the website (we will no longer accept paper/disc submissions) http://www.icmje.org. Articles should be submitted under The manuscript submission process is broken into a series of five conventional headings of introduction, methods and materials, screens that gather detailed information about your manuscript and results, discussion, but other headings will be considered if more allow you to upload the pertinent files. The sequence of screens are as suitable. For Uniform Requirements for Sample References go to follows: http://www.nlm.nih.gov/bsd/uniform_requirements.html. After the manuscript is submitted, you will be asked to select the order you would like the files to be displayed in a merged PDF file 1. A long form asking for author information, title, abstract, and file that the system will create for you. Next, you will be directed to a quantities. page that will allow you to review your converted manuscript. If the 2. A screen asking for the actual file locations on your computer (via conversion is not correct, you can replace or delete your manuscript an open file dialog).
    [Show full text]
  • Antagonists of Il-6 to Prevent Or Treat
    (19) TZZ ¥_ _T (11) EP 2 376 126 B1 (12) EUROPEAN PATENT SPECIFICATION (45) Date of publication and mention (51) Int Cl.: of the grant of the patent: A61K 39/00 (2006.01) C07K 16/24 (2006.01) 20.12.2017 Bulletin 2017/51 (86) International application number: (21) Application number: 09830695.4 PCT/US2009/006266 (22) Date of filing: 24.11.2009 (87) International publication number: WO 2010/065077 (10.06.2010 Gazette 2010/23) (54) ANTAGONISTS OF IL-6 TO PREVENT OR TREAT THROMBOSIS ANTAGONISTEN VON IL-6 ZUR PRÄVENTION ODER BEHANDLUNG VON THROMBOSE ANTAGONISTES D IL-6 POUR PRÉVENIR OU TRAITER LA THROMBOSE (84) Designated Contracting States: • MATSUYAMA MASASHI ET AL: AT BE BG CH CY CZ DE DK EE ES FI FR GB GR "Anti-interleukin-6 receptor antibody HR HU IE IS IT LI LT LU LV MC MK MT NL NO PL (tocilizumab) treatment of multicentric PT RO SE SI SK SM TR Castleman’s disease", INTERNAL MEDICINE, JAPANESE SOCIETY OF INTERNAL MEDICINE, (30) Priority: 05.02.2009 US 366567 TOKYO, JP; BIOSCIENCES INFORMATION 14.07.2009 US 502581 SERVICE, PHILADELPHIA, PA, US, vol. 46, 1 25.11.2008 US 117811 P January 2007 (2007-01-01), pages 771-774, 25.11.2008 US 117861 P XP002696891, ISSN: 0918-2918, DOI: 24.02.2009 US 391717 10.2169/INTERNALMEDICINE.46.6262 06.03.2009 US 399156 • EMILLE D ET AL: "ADMINISTRATION OF AN 25.11.2008 US 117839 P ANTI-INTERLEUKIN-6 MONOCLONAL 24.02.2009 US 391615 ANTIBODY TO PATIENTS WITH ACQUIRED IMUNODEFICIENCY SYNDROME AND (43) Date of publication of application: LYMPHOMA: EFFECT ON LYMPHOMA GROWTH 19.10.2011 Bulletin 2011/42 AND ON B CLINICAL SYMPTOMS", BLOOD, AMERICAN SOCIETY OFHEMATOLOGY, US, vol.
    [Show full text]
  • Incidence of Urogenital Neoplasms in India
    Published online: 2021-06-17 Original Article Incidence of Urogenital Neoplasms in India Abstract Satyanarayana Objective: To study and compare the national and regional incidences and risk of developing Labani, of neoplasms of individual urogenital sites using 2012 – 2014 reports from the National Cancer Dishank Rawat, Registry Programme (NCRP) data. Materials and Methods: A number of incident cases, age- adjusted rates (AARs), and cumulative risk (0 – 64 years) pertaining to urogenital neoplasms, along Smita Asthana with the ICD-10 codes, were extracted. Data on indicators, namely number of incident cases, AARs Division of Epidemiology and one in a number of persons develop cancer were summarized for both the sexes in each of the and Biostatistics, Institute of Cytology and Preventive cancer registries and presented region-wise in the form of ranges. The proportion of all Results: Oncology, Indian Council of urogenital neoplasms in comparison to all cancers was 12.51% in women and 5.93% in men. Risk of Medical Research, Noida, development of urogenital cancers for women was maximum (1 in 50) in the North-eastern region, Uttar Pradesh, India followed by Rural West, South, and North. For men, the risk of developing neoplasms of urogenital sites was highest (1 in 250). For the neoplasms of the renal pelvis and ureter, both the incidence and risk were quite low for all genders across all the regions. Cervical neoplasms had the highest incidence (4.91 – 23.07) among female genital neoplasms, while prostate had the highest incidence (0.82 – 12.39) among male genital neoplasms. Conclusion: Making people aware of urogenital neoplasms and their risk factors are important for the public health awareness point of view.
    [Show full text]
  • Male Urogenital Cancers in Suriname 199
    Academic Journal of Suriname 2011, 2, 198-204 Biomedicine Full-length paper The incidence of malignancies of the male urogenital system in the Republic of Suriname from 1980 through 2004 Dennis R.A. Mans 1, Santosh S. Sardjoe 1, Martinus A. Vrede 2 1Department of Pharmacology, Faculty of Medical Sciences, Anton de Kom University of Suriname, Paramaribo, Suriname; 2Department of Pathology, Faculty of Medical Sciences, Anton de Kom University of Suriname, Paramaribo, Suriname Abstract The worldwide occurrence of male urogenital malignancies (cancers of prostate, penis, and testes, as well as those of kidneys and urinary bladder of men) varies from exceedingly rare to very common. In this study, incidence rates of these neoplasms in the Republic of Suriname between 1980 and 2004 have been assessed and compared with international data. Patient information was obtained from the Pathologic Anatomy Laboratory, population data from the General Bureau of Statistics. Sex-specific rates were calculated for cancer overall and for all anatomical sites, and stratified according to age groups 0 to 19, 20 to 49, and 50+ years, as well as the largest ethnic groups, viz. Hindustani, Creole, and Javanese. From these data, average yearly numbers and average rates per 100,000 men per year were calculated and expressed as means ± SDs. There were nearly 900 male urogenital malignancies in the period covered by this study, which corresponded to an overall rate of approximately 17. The most common urogenital neoplasm by far was prostatic cancer, occurring in more than three- quarters of cases and at a rate of about 13. Kidney, urinary bladder, penile, and testicular cancer were seen at rates lower than 2.
    [Show full text]