CTNNB1 antibody - N-terminal region (P100600_T100) Data Sheet

Product Number P100600_T100 Product Name CTNNB1 antibody - N-terminal region (P100600_T100) Size 100ug Symbol CTNNB1 Alias Symbols CTNNB Nucleotide Accession# NM_001904 Size (# AA) 781 amino acids Molecular Weight 85kDa Product Format Lyophilized powder NCBI Gene Id 1499 Host Rabbit Clonality Polyclonal Official Gene Full Name Catenin (cadherin-associated protein), beta 1, 88kDa Gene Family ARMC This is a rabbit polyclonal antibody against CTNNB1. It was validated on Western Blot using a cell lysate as a Description positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: SLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRV Target Reference Strausberg, R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903. Description of Target CTNNB1 is involved in the regulation of cell adhesion and in signal transduction through the Wnt pathway. APC, APC, AXIN2, BCL3, BCL9, BTRC, CCND1, CD82, CDH1, CDH1, CDH1, CTNNA1, DKK1, ESR1, FAS, Partner FGF20, FOXO1, FOXO3, FOXO4, GSK3B, IGFBP2, KLK3, LEF1, MUC1, NFKB1, NR5A2, PKD1, PSEN1, RUVBL2, SGK1, TCF7L2, TCF7L2, TFF1, ACP1, AJAP1, APC, APC2, AR, ARHGAP32, AXIN1, AXIN2, BCL3, BCL9, BCL9L, BOC, BTRC, CA9, Reconstitution and Add 100 ul of distilled water. Final anti-CTNNB1 antibody concentration is 1 mg/ml in PBS buffer with 2% Storage sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-CTNNB1 antibody is Catalog # AAP30903 (Previous Catalog # AAPP01627) Immunogen The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the N terminal of human CTNNB1 Swissprot Id P35222 Protein Name Catenin beta-1 Sample Type Confirmation CTNNB1 is supported by BioGPS data to be expressed in HCT116 Protein Accession # NP_001895 Purification Protein A purified Species Reactivity Dog, Guinea pig, Horse, Human, Mouse, Pig, Rabbit, Application WB Predicted Homology Based on Immunogen Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; African clawed frog: 92%; Zebrafish: 83% Sequence

Human HCT116

CTNNB1 antibody - N-terminal region (P100600_T100) CTNNB1 antibody - N-terminal region (P100600_T100) validated by WB using HCT116 cell lysate CTNNB1 is supported by BioGPS gene expression data to be expressed in HCT116

Image 1

______

This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.