Product datasheet Anti-DEFA1 Antibody Catalog Number: A10546
BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China
Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]
Basic Information Product Name Anti-DEFA1 Antibody Gene Name DEFA1 Source Rabbit IgG Species Reactivity human,rat Tested Application WB Contents 500ug/ml antibody with PBS ,0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC). Purification Immunogen affinity purified. Observed MW 10KD Dilution Ratios Western blot: 1:500-2000
Storage 12 months from date of receipt,-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing
Background Information Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.
Reference
Anti-DEFA1 Antibody被引用在0文献中。
暂无引用
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 1 Product datasheet Anti-DEFA1 Antibody Catalog Number: A10546
BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China
Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected]
Selected Validation Data
Figure 1. Western blot analysis of Alpha Defensin 1 using anti- Alpha Defensin 1 antibody (A10546). lane 1: rat testis tissue lysate,lane 2: HELA whole cell lysates. anti-Alpha Defensin 1 antigen affinity purified polyclonal antibody (Catalog # A10546)probed with a goat anti-rabbit IgG-HRP secondary antibody The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) . A specific band was detected for Alpha Defensin 1 at approximately 19KD. The expected band size for Alpha Defensin 1 is at 10KD.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC AND CLINICAL USE. 2
Powered by TCPDF (www.tcpdf.org)