Cellular Mechanisms Controlling Surfacing of AICL Glycoproteins, Cognate Ligands of the Activating NK Receptor Nkp80
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
The Inhibitory NKR-P1B:Clr-B Recognition Axis Facilitates Detection of Oncogenic Transformation and Cancer Immunosurveillance Miho Tanaka1,2, Jason H
Published OnlineFirst April 24, 2018; DOI: 10.1158/0008-5472.CAN-17-1688 Cancer Tumor Biology and Immunology Research The Inhibitory NKR-P1B:Clr-b Recognition Axis Facilitates Detection of Oncogenic Transformation and Cancer Immunosurveillance Miho Tanaka1,2, Jason H. Fine1,2, Christina L. Kirkham1,2, Oscar A. Aguilar1,2, Antoaneta Belcheva1, Alberto Martin1, Troy Ketela3,4, Jason Moffat3,4, David S.J. Allan1,2, and James R. Carlyle1,2 Abstract Natural killer (NK) cells express receptors specific for MHC class in a primary lymphoma model despite preferential rejection of – – I (MHC-I) molecules involved in "missing-self" recognition of Clr-b / hematopoietic cells previously observed following adop- cancer and virus-infected cells. Here we elucidate the role of MHC- tive transfer into na€ve wild-type mice in vivo. Collectively, these I-independent NKR-P1B:Clr-b interactions in the detection of findings suggest that the inhibitory NKR-P1B:Clr-b axis plays a oncogenic transformation by NK cells. Ras oncogene overexpres- beneficial role in innate detection of oncogenic transformation sion was found to promote a real-time loss of Clr-b on mouse via NK-cell–mediated cancer immune surveillance, in addition fibroblasts and leukemia cells, mediated in part via the Raf/MEK/ to a pathologic role in the immune escape of primary lympho- ERK and PI3K pathways. Ras-driven Clr-b downregulation ma cells in Em-cMyc mice in vivo. These results provide a model occurred at the level of the Clrb (Clec2d) promoter, nascent Clr-b for the human NKR-P1A:LLT1 system in cancer immunosur- transcripts, and cell surface Clr-b protein, in turn promoting veillance in patients with lymphoma and suggest it may rep- missing-self recognition via the NKR-P1B inhibitory receptor. -
Human Lectins, Their Carbohydrate Affinities and Where to Find Them
biomolecules Review Human Lectins, Their Carbohydrate Affinities and Where to Review HumanFind Them Lectins, Their Carbohydrate Affinities and Where to FindCláudia ThemD. Raposo 1,*, André B. Canelas 2 and M. Teresa Barros 1 1, 2 1 Cláudia D. Raposo * , Andr1 é LAQVB. Canelas‐Requimte,and Department M. Teresa of Chemistry, Barros NOVA School of Science and Technology, Universidade NOVA de Lisboa, 2829‐516 Caparica, Portugal; [email protected] 12 GlanbiaLAQV-Requimte,‐AgriChemWhey, Department Lisheen of Chemistry, Mine, Killoran, NOVA Moyne, School E41 of ScienceR622 Co. and Tipperary, Technology, Ireland; canelas‐ [email protected] NOVA de Lisboa, 2829-516 Caparica, Portugal; [email protected] 2* Correspondence:Glanbia-AgriChemWhey, [email protected]; Lisheen Mine, Tel.: Killoran, +351‐212948550 Moyne, E41 R622 Tipperary, Ireland; [email protected] * Correspondence: [email protected]; Tel.: +351-212948550 Abstract: Lectins are a class of proteins responsible for several biological roles such as cell‐cell in‐ Abstract:teractions,Lectins signaling are pathways, a class of and proteins several responsible innate immune for several responses biological against roles pathogens. such as Since cell-cell lec‐ interactions,tins are able signalingto bind to pathways, carbohydrates, and several they can innate be a immuneviable target responses for targeted against drug pathogens. delivery Since sys‐ lectinstems. In are fact, able several to bind lectins to carbohydrates, were approved they by canFood be and a viable Drug targetAdministration for targeted for drugthat purpose. delivery systems.Information In fact, about several specific lectins carbohydrate were approved recognition by Food by andlectin Drug receptors Administration was gathered for that herein, purpose. plus Informationthe specific organs about specific where those carbohydrate lectins can recognition be found by within lectin the receptors human was body. -
Literature Mining Sustains and Enhances Knowledge Discovery from Omic Studies
LITERATURE MINING SUSTAINS AND ENHANCES KNOWLEDGE DISCOVERY FROM OMIC STUDIES by Rick Matthew Jordan B.S. Biology, University of Pittsburgh, 1996 M.S. Molecular Biology/Biotechnology, East Carolina University, 2001 M.S. Biomedical Informatics, University of Pittsburgh, 2005 Submitted to the Graduate Faculty of School of Medicine in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Pittsburgh 2016 UNIVERSITY OF PITTSBURGH SCHOOL OF MEDICINE This dissertation was presented by Rick Matthew Jordan It was defended on December 2, 2015 and approved by Shyam Visweswaran, M.D., Ph.D., Associate Professor Rebecca Jacobson, M.D., M.S., Professor Songjian Lu, Ph.D., Assistant Professor Dissertation Advisor: Vanathi Gopalakrishnan, Ph.D., Associate Professor ii Copyright © by Rick Matthew Jordan 2016 iii LITERATURE MINING SUSTAINS AND ENHANCES KNOWLEDGE DISCOVERY FROM OMIC STUDIES Rick Matthew Jordan, M.S. University of Pittsburgh, 2016 Genomic, proteomic and other experimentally generated data from studies of biological systems aiming to discover disease biomarkers are currently analyzed without sufficient supporting evidence from the literature due to complexities associated with automated processing. Extracting prior knowledge about markers associated with biological sample types and disease states from the literature is tedious, and little research has been performed to understand how to use this knowledge to inform the generation of classification models from ‘omic’ data. Using pathway analysis methods to better understand the underlying biology of complex diseases such as breast and lung cancers is state-of-the-art. However, the problem of how to combine literature- mining evidence with pathway analysis evidence is an open problem in biomedical informatics research. -
CLEC2D (NM 001197317) Human Tagged ORF Clone – RG230997 | Origene
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG230997 CLEC2D (NM_001197317) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: CLEC2D (NM_001197317) Human Tagged ORF Clone Tag: TurboGFP Symbol: CLEC2D Synonyms: CLAX; LLT1; OCIL Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG230997 representing NM_001197317 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCATGACAGTAACAATGTGGAGAAAGACATTACACCATCTGAATTGCCTGCAAACCCAGCAATAAGAG CTAACTGCCATCAAGAGCCATCAGTATGTCTTCAAGCTGCATGCCCAGAAAGCTGGATTGGTTTTCAAAG AAAGTGTTTCTATTTTTCTGATGACACCAAGAACTGGACATCAAGTCAGAGGTTTTGTGACTCACAAGAT GCTGATCTTGCTCAGGTTGAAAGCTTCCAGGAACTGAATTTCCTGTTGAGATATAAAGGCCCATCTGATC ACTGGATTGGGCTGAGCAGAGAACAAGGCCAACCATGGAAATGGATAAATGGTACTGAATGGACAAGACA GTTTCCTATCCTGGGAGCAGGAGAGTGTGCCTATTTGAATGACAAAGGTGCCAGTAGTGCCAGGCACTAC ACAGAGAGGAAGTGGATTTGTTCCAAATCAGATATACATGTC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG230997 representing NM_001197317 Red=Cloning site Green=Tags(s) MHDSNNVEKDITPSELPANPAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQD ADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHY TERKWICSKSDIHV TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not -
C07k - 2021.08
CPC - C07K - 2021.08 C07K PEPTIDES (peptides in foodstuffs A23; obtaining protein compositions for foodstuffs, working-up proteins for foodstuffs A23J; preparations for medicinal purposes A61K; peptides containing beta-lactam rings C07D; cyclic dipeptides not having in their molecule any other peptide link than those which form their ring, e.g. piperazine-2,5-diones, C07D; ergot alkaloids of the cyclic peptide type C07D 519/02; macromolecular compounds having statistically distributed amino acid units in their molecules, i.e. when the preparation does not provide for a specific; but for a random sequence of the amino acid units, homopolyamides and block copolyamides derived from amino acids C08G 69/00; macromolecular products derived from proteins C08H 1/00; preparation of glue or gelatine C09H; single cell proteins, enzymes C12N; genetic engineering processes for obtaining peptides C12N 15/00; compositions for measuring or testing processes involving enzymes C12Q; investigation or analysis of biological material G01N 33/00) Relationships with other classification places An amino acid per se is classified in C07D while peptides (starting from dipeptides) are classified in C07K. Subclass C07K is a function oriented entry for the compounds themselves and does not cover the application or use of the compounds under the subclass definition. For classifying such information other entries exist, for example: preservation of bodies of humans or animals or plants or parts thereof; Biocides, e.g. as disinfectants, as pesticides, as herbicides; pest repellants or attractants; plant growth regulators are classified in A01N. Preparations for medical, dental, or toilet purposes are classified in A61K. Amino acids or derivatives thereof are classified in C07C or C07D. -
UC San Francisco Previously Published Works
UCSF UC San Francisco Previously Published Works Title FitSNPs: highly differentially expressed genes are more likely to have variants associated with disease. Permalink https://escholarship.org/uc/item/91k8p2km Journal Genome biology, 9(12) ISSN 1474-7596 Authors Chen, Rong Morgan, Alex A Dudley, Joel et al. Publication Date 2008 DOI 10.1186/gb-2008-9-12-r170 Peer reviewed eScholarship.org Powered by the California Digital Library University of California Open Access Research2008ChenetVolume al. 9, Issue 12, Article R170 FitSNPs: highly differentially expressed genes are more likely to have variants associated with disease Rong Chen*†‡, Alex A Morgan*†‡, Joel Dudley*†‡, Tarangini Deshpande§, Li Li†, Keiichi Kodama*†‡, Annie P Chiang*†‡ and Atul J Butte*†‡ Addresses: *Stanford Center for Biomedical Informatics Research, 251 Cmpus Drive, Stanford, CA 94305, USA. †Department of Pediatrics, Stanford University School of Medicine, Stanford, CA 94305, USA. ‡Lucile Packard Children's Hospital, 725 Welch Road, Palo Alto, CA 94304, USA. §NuMedii Inc., Menlo Park, CA 94025, USA. Correspondence: Atul J Butte. Email: [email protected] Published: 5 December 2008 Received: 17 June 2008 Revised: 26 September 2008 Genome Biology 2008, 9:R170 (doi:10.1186/gb-2008-9-12-r170) Accepted: 5 December 2008 The electronic version of this article is the complete one and can be found online at http://genomebiology.com/2008/9/12/R170 © 2008 Chen et al.; licensee BioMed Central Ltd. This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. -
Single-Cell Transcriptomes Reveal a Complex Cellular Landscape in the Middle Ear and Differential Capacities for Acute Response to Infection
fgene-11-00358 April 9, 2020 Time: 15:55 # 1 ORIGINAL RESEARCH published: 15 April 2020 doi: 10.3389/fgene.2020.00358 Single-Cell Transcriptomes Reveal a Complex Cellular Landscape in the Middle Ear and Differential Capacities for Acute Response to Infection Allen F. Ryan1*, Chanond A. Nasamran2, Kwang Pak1, Clara Draf1, Kathleen M. Fisch2, Nicholas Webster3 and Arwa Kurabi1 1 Departments of Surgery/Otolaryngology, UC San Diego School of Medicine, VA Medical Center, La Jolla, CA, United States, 2 Medicine/Center for Computational Biology & Bioinformatics, UC San Diego School of Medicine, VA Medical Center, La Jolla, CA, United States, 3 Medicine/Endocrinology, UC San Diego School of Medicine, VA Medical Center, La Jolla, CA, United States Single-cell transcriptomics was used to profile cells of the normal murine middle ear. Clustering analysis of 6770 transcriptomes identified 17 cell clusters corresponding to distinct cell types: five epithelial, three stromal, three lymphocyte, two monocyte, Edited by: two endothelial, one pericyte and one melanocyte cluster. Within some clusters, Amélie Bonnefond, Institut National de la Santé et de la cell subtypes were identified. While many corresponded to those cell types known Recherche Médicale (INSERM), from prior studies, several novel types or subtypes were noted. The results indicate France unexpected cellular diversity within the resting middle ear mucosa. The resolution of Reviewed by: Fabien Delahaye, uncomplicated, acute, otitis media is too rapid for cognate immunity to play a major Institut Pasteur de Lille, France role. Thus innate immunity is likely responsible for normal recovery from middle ear Nelson L. S. Tang, infection. The need for rapid response to pathogens suggests that innate immune The Chinese University of Hong Kong, China genes may be constitutively expressed by middle ear cells. -
Genetic Mapping of the Major Histocompatibility Complex in the Zebra Finch (Taeniopygia Guttata)
This is a repository copy of Genetic mapping of the major histocompatibility complex in the zebra finch (Taeniopygia guttata). White Rose Research Online URL for this paper: http://eprints.whiterose.ac.uk/152446/ Version: Accepted Version Article: Ekblom, R., Stapley, J., Ball, A.D. et al. (3 more authors) (2011) Genetic mapping of the major histocompatibility complex in the zebra finch (Taeniopygia guttata). Immunogenetics, 63 (8). pp. 523-530. ISSN 0093-7711 https://doi.org/10.1007/s00251-011-0525-9 This is a post-peer-review, pre-copyedit version of an article published in Immunogenetics. The final authenticated version is available online at: http://dx.doi.org/10.1007/s00251-011-0525-9. Reuse Items deposited in White Rose Research Online are protected by copyright, with all rights reserved unless indicated otherwise. They may be downloaded and/or printed for private study, or other acts as permitted by national copyright laws. The publisher or other rights holders may allow further reproduction and re-use of the full text version. This is indicated by the licence information on the White Rose Research Online record for the item. Takedown If you consider content in White Rose Research Online to be in breach of UK law, please notify us by emailing [email protected] including the URL of the record and the reason for the withdrawal request. [email protected] https://eprints.whiterose.ac.uk/ Manuscript Click here to download Manuscript: zfMHCmapp_manuscript_resubm2.doc Click here to view linked References 1 Genetic mapping of the major histocompatibility complex in the 1 2 3 4 2 zebra finch (Taeniopygia guttata) 5 6 3 7 8 1,2* 2 2, 3 2 2 9 4 Robert Ekblom , Jessica Stapley , Alex D. -
LLT1) Checkpoint: a Novel Independent Prognostic Factor in HPV-Negative Oropharyngeal Squamous Cell Carcinoma
biomedicines Article Lectin-Like Transcript 1 (LLT1) Checkpoint: A Novel Independent Prognostic Factor in HPV-Negative Oropharyngeal Squamous Cell Carcinoma 1,2, 1,2,3, 2,4 Mario Sanchez-Canteli y, Francisco Hermida-Prado y , Christian Sordo-Bahamonde , Irene Montoro-Jiménez 1,2, Esperanza Pozo-Agundo 1,2, Eva Allonca 1,2 , Aitana Vallina-Álvarez 2,5,César Álvarez-Marcos 1,2,3, Segundo Gonzalez 2,4 , Juana M. García-Pedrero 1,2,3,* and Juan P. Rodrigo 1,2,3,* 1 Department of Otolaryngology, Hospital Universitario Central de Asturias, Instituto de Investigación Sanitaria del Principado de Asturias, 33011 Oviedo, Spain; [email protected] (M.S.-C.); [email protected] (F.H.-P.); [email protected] (I.M.-J.); [email protected] (E.P.-A.); [email protected] (E.A.); [email protected] (C.Á.-M.) 2 Instituto Universitario de Oncología del Principado de Asturias, University of Oviedo, 33006 Oviedo, Spain; [email protected] (C.S.-B.); [email protected] (A.V.-Á.); [email protected] (S.G.) 3 CIBERONC, Instituto de Salud Carlos III, 28029 Madrid, Spain 4 Department of Functional Biology, Instituto de Investigación Sanitaria del Principado de Asturias, University of Oviedo, 33006 Oviedo, Spain 5 Department of Pathology, Hospital Universitario Central de Asturias, ISPA, 33011 Oviedo, Spain * Correspondence: juanagp.fi[email protected] (J.M.G.-P.); [email protected] (J.P.R.) These authors contributed equally to this work. y Received: 30 October 2020; Accepted: 23 November 2020; Published: 25 November 2020 Abstract: Lectin-like transcript 1 (LLT1) expression by tumor cells contributes to immune evasion, thereby emerging as a natural killer (NK) cell-mediated immunotherapeutic target. -
LLT1 and CD161 Expression in Human Germinal Centers Promotes B Cell Activation and CXCR4 Downregulation
LLT1 and CD161 Expression in Human Germinal Centers Promotes B Cell Activation and CXCR4 Downregulation This information is current as Alba Llibre, Constantino López-Macías, Teresa Marafioti, of September 24, 2021. Hema Mehta, Amy Partridge, Carina Kanzig, Felice Rivellese, Jacob D. Galson, Lucy J. Walker, Paul Milne, Rodney E. Phillips, Dominic F. Kelly, Gordon J. Freeman, Mohey Eldin El Shikh, Paul Klenerman and Christian B. Willberg Downloaded from J Immunol published online 1 February 2016 http://www.jimmunol.org/content/early/2016/01/30/jimmun ol.1502462 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2016/01/30/jimmunol.150246 Material 2.DCSupplemental Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision by guest on September 24, 2021 • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 The Authors All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published February 1, 2016, doi:10.4049/jimmunol.1502462 The Journal of Immunology LLT1 and CD161 Expression in Human Germinal Centers Promotes B Cell Activation and CXCR4 Downregulation Alba Llibre,* Constantino Lo´pez-Macı´as,†,1 Teresa Marafioti,‡,1 Hema Mehta,* Amy Partridge,* Carina Kanzig,* Felice Rivellese,x Jacob D. -
CLEC2D / OCIL / LLT1 Antibody (Internal) Goat Polyclonal Antibody Catalog # ALS13098
10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 CLEC2D / OCIL / LLT1 Antibody (Internal) Goat Polyclonal Antibody Catalog # ALS13098 Specification CLEC2D / OCIL / LLT1 Antibody (Internal) - Product Information Application IHC Primary Accession Q9UHP7 Reactivity Human, Monkey, Horse Host Goat Clonality Polyclonal Calculated MW 22kDa KDa CLEC2D / OCIL / LLT1 Antibody (Internal) - Additional Information Gene ID 29121 Anti-CLEC2D antibody IHC of human placenta. Other Names C-type lectin domain family 2 member D, Lectin-like NK cell receptor, Lectin-like transcript 1, LLT-1, Osteoclast inhibitory lectin, CLEC2D, CLAX, LLT1, OCIL Target/Specificity Human CLEC2D. Reconstitution & Storage Store at -20°C. Minimize freezing and thawing. Precautions CLEC2D / OCIL / LLT1 Antibody (Internal) is for research use only and not for use in Anti-CLEC2D antibody IHC of human tonsil. diagnostic or therapeutic procedures. CLEC2D / OCIL / LLT1 Antibody (Internal) - Background CLEC2D / OCIL / LLT1 Antibody (Internal) - Protein Information Receptor for KLRB1 that protects target cells against natural killer cell-mediated lysis. Name CLEC2D Inhibits osteoclast formation. Inhibits bone resorption. Modulates the release of interferon- Synonyms CLAX, LLT1, OCIL gamma. Binds high molecular weight sulfated Function glycosaminoglycans. Receptor for KLRB1 that protects target cells against natural killer cell-mediated CLEC2D / OCIL / LLT1 Antibody (Internal) - lysis (PubMed:<a href="http://www.uniprot. References org/citations/20843815" Page 1/2 10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 target="_blank">20843815</a>, Boles K.S.,et al.Immunogenetics 50:1-7(1999). PubMed:<a href="http://www.uniprot.org/ci Hu Y.S.,et al.J. -
Downloaded Per Proteome Cohort Via the Web- Site Links of Table 1, Also Providing Information on the Deposited Spectral Datasets
www.nature.com/scientificreports OPEN Assessment of a complete and classifed platelet proteome from genome‑wide transcripts of human platelets and megakaryocytes covering platelet functions Jingnan Huang1,2*, Frauke Swieringa1,2,9, Fiorella A. Solari2,9, Isabella Provenzale1, Luigi Grassi3, Ilaria De Simone1, Constance C. F. M. J. Baaten1,4, Rachel Cavill5, Albert Sickmann2,6,7,9, Mattia Frontini3,8,9 & Johan W. M. Heemskerk1,9* Novel platelet and megakaryocyte transcriptome analysis allows prediction of the full or theoretical proteome of a representative human platelet. Here, we integrated the established platelet proteomes from six cohorts of healthy subjects, encompassing 5.2 k proteins, with two novel genome‑wide transcriptomes (57.8 k mRNAs). For 14.8 k protein‑coding transcripts, we assigned the proteins to 21 UniProt‑based classes, based on their preferential intracellular localization and presumed function. This classifed transcriptome‑proteome profle of platelets revealed: (i) Absence of 37.2 k genome‑ wide transcripts. (ii) High quantitative similarity of platelet and megakaryocyte transcriptomes (R = 0.75) for 14.8 k protein‑coding genes, but not for 3.8 k RNA genes or 1.9 k pseudogenes (R = 0.43–0.54), suggesting redistribution of mRNAs upon platelet shedding from megakaryocytes. (iii) Copy numbers of 3.5 k proteins that were restricted in size by the corresponding transcript levels (iv) Near complete coverage of identifed proteins in the relevant transcriptome (log2fpkm > 0.20) except for plasma‑derived secretory proteins, pointing to adhesion and uptake of such proteins. (v) Underrepresentation in the identifed proteome of nuclear‑related, membrane and signaling proteins, as well proteins with low‑level transcripts.