DOCSLIB.ORG

Príloha Č. 1. Králová S. (2017) Role of Fatty Acids in Cold Adaptation Of

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Príloha Č. 1. Králová S. (2017) Role of Fatty Acids in Cold Adaptation Of Príloha č. 1. Králová S. (2017) Role of fatty acids in cold adaptation of Antarctic psychrophilic Flavobacterium spp. Syst. Appl. Microbiol., 40(6): 329-333. Doi: 10.1016/j.syapm.2017.06.001 Systematic and Applied Microbiology 40 (2017) 329–333 Contents lists available at ScienceDirect Systematic and Applied Microbiology j ournal homepage: www.elsevier.de/syapm Role of fatty acids in cold adaptation of Antarctic psychrophilic Flavobacterium spp. Stanislava Králová Czech Collection of Microorganisms, Department of Experimental Biology, Faculty of Science, Masaryk University, Kamenice 5, 62500 Brno, Czech Republic a r t i c l e i n f o a b s t r a c t Article history: Cold-loving microorganisms developed numerous adaptation mechanisms allowing them to survive in Received 9 May 2017 extremely cold habitats, such as adaptation of the cell membrane. The focus of this study was on the Received in revised form 8 June 2017 membrane fatty acids of Antarctic Flavobacterium spp., and their adaptation response to cold-stress. Fatty Accepted 12 June 2017 acids and cold-response of Antarctic flavobacteria was also compared to mesophilic and thermophilic members of the genus Flavobacterium. The results showed that the psychrophiles produced more types Keywords: of major fatty acids than meso- and thermophilic members of this genus, namely C15:1 iso G, C15:0 iso, Flavobacterium C15:0 anteiso, C15:1 ω6c, C15:0 iso 3OH, C17:1 ω6c, C16:0 iso 3OH and C17:0 iso 3OH, summed features 3 Antarctic bacteria ω ω ω Adaptation (C16:1 7cand/or C16:1 6c) and 9 (C16:0 10-methyl and/or C17:1 iso 9c). It was shown that the cell membrane of psychrophiles was composed mainly of branched and unsaturated fatty acids. The results Fatty acids Cell membrane also implied that Antarctic flavobacteria mainly used two mechanisms of membrane fluidity alteration Cold-shock in their cold-adaptive response. The first mechanism was based on unsaturation of fatty acids, and the second mechanism on de novo synthesis of branched fatty acids. The alteration of the cell membrane was shown to be similar for all thermotypes of members of the genus Flavobacterium. © 2017 Elsevier GmbH. All rights reserved. Introduction effort needed to maintain a liquid crystalline state [4,12,25,29,30]. The response of bacterial cells leading to maintenance of a fully Microscopic life in cold regions of the Earth is characterized by functional cell membrane is termed homeoviscous adaptation. a high biodiversity comprised mainly of microorganisms such as Bacteria achieve homeoviscous adaptation to low temperatures bacteria, fungi and microalgae [6]. To survive in conditions typical (cold-shock) by using several mechanisms. These cold-induced of cold regions (cold temperature, a lack of water and/or nutrients, responses are common among different bacterial groups and intense UV irradiation and/or higher salinity) various adaptation include an increase in FA unsaturation, FA methyl branching and/or mechanisms are required [7]. Of these conditions, cold tempera- increasing the iso/anteiso-branched FAs ratio [8,22–24]. Moreover, tures strongly affect microbial cellular functions by influencing cell with a decrease in temperature, the average length of FAs, as well as integrity, water viscosity, diffusion rates, the kinetics of enzyme the sterol/phospholipid ratio, have been shown to decrease [13,25]. reactions and membrane fluidity [7]. These changes in different combinations and quantities allow bac- In recent years, researchers have intensively studied cold- teria to retain membrane function and fluidity [24] and thereby adapted bacteria in order to determine the adaptations related to sustain the survival of these bacterial cells. their cytoplasmic membrane [13]. The composition of the mem- Previously, a number of bacterial species have been studied brane fatty acids (FAs) strongly affects membrane properties by in order to characterize their membranes or the mechanisms influencing fluidity and/or biological functions, such as solute of their membrane temperature adaptation. These studies were uptake, nutrient transport, osmotic pressure and/or energy pro- mainly focused on Gram-positive bacteria, such as members of duction [4]. These functions are directly associated with natural the genera Bacillus, Clostridium, Micrococcus or Listeria monocyto- forms of biomembranes represented by the semi-liquid state of genes [2,8,20,21,31]. Within the Gram-negative bacteria, the main lipid structures. It is well known that environmental conditions and object of chemotaxonomic studies has been the cell wall structure stresses strongly affect cell membrane structure, due to the cellular [10,14,15,19,27,29]. This current study focused on the cold-adapted Flavobacterium spp. isolated from Antarctica, and on their cell membrane proper- ties. The aims of the study were: (i) to determine the FA composition E-mail address: [email protected] http://dx.doi.org/10.1016/j.syapm.2017.06.001 0723-2020/© 2017 Elsevier GmbH. All rights reserved. 330 S. Králová / Systematic and Applied Microbiology 40 (2017) 329–333 of Antarctic Flavobacterium spp., (ii) to determine their cold- re-cultivated three times and their FAs were analysed. The cultiva- adaptation mechanisms to low temperatures due to alteration of tion temperatures were initially set up according to optimal growth ◦ ◦ ◦ ◦ the FA composition, (iii) to compare the FAs of Antarctic flavobac- temperatures (20 C, 25 C, 30 C and 50 C) and, using standard teria to mesophilic and thermophilic reference strains of the genus deviation values, more stable FA profiles were obtained after cul- Flavobacterium, and (iv) to compare the cold-shock response of all tivation for 48 h. The same process was repeated with the strains ◦ ◦ ◦ three of these thermotypes. cultivated under lower cultivation temperatures (10 C, 15 C, 20 C ◦ and 40 C). In this case, the FA values varied less when the cultiva- tion of Antarctic strains was prolonged for 72 h, since the growth Materials and methods rate decreased significantly at lower temperature. The indicator of the late exponential growth phase required for harvesting the Bacterial strains bacterial biomass was confluent growth in the third sector of the agar plates, which was reached after 72 h cultivation. FA profiles Two groups of Flavobacterium spp. were used in this study. The T of mesophilic flavobacteria and F. thermophilum CCM 3496 were first group included 28 unique psychrophilic gliding Flavobacterium again most reproducible after cultivation for 48 h. In general, the FA spp. isolated from terrestrial abiotic sources in Antarctica (vari- amounts varied by less than 2%, which indicated high reproducibil- ous water sources, rocks and regolith from James Ross Island). The ity and stability of FA composition patterns. strains used are listed and detailed in Table S1. These psychrophilic species exhibited the main characteristics of the genus Flavobac- Fatty acid composition of Antarctic Flavobacterium strains terium: Gram-negative rods with a yellow pigment exhibiting gliding motility. The assignment of these bacteria to the genus A total of 42 FAs were detected in the FAME profiles for all the 28 Flavobacterium was based on sequencing of their 16S rRNA gene Antarctic flavobacteria cultivated under optimal growth conditions and MALDI-TOF MS analysis (data not shown). All strains grew well ◦ ± ◦ (20 2 C, 48 h). Nineteen FAs were uniformly present among all under aerobic conditions at a temperature of 20 C. strains, with 10 of them present at values greater than 4% for most The second group was comprised of mesophilic flavobacte- strains, and these were assigned as the main FAs of the Antarctic ria reference cultures and one thermophilic reference culture of T gliding Flavobacterium spp. (Fig. S1; bold emphasized in Table S3). Flavobacterium thermophilum CCM 3694 with optimal growth ◦ ◦ According to Bernardet and Bowman [3], it is clear that members temperatures of 25–30 C and 50 C, respectively. The reference of the genus Flavobacterium have typically high amounts of C strains were obtained from the Czech Collection of Microorganisms 15:0 iso, and significant amounts of C , C iso 3OH, C anteiso, (http://www.sci.muni.cz/ccm/) and are detailed in Table S2. 15:0 15:0 15:0 C15:1 iso G, C15:1 ω6c, C16:0 iso 3OH, C17:0 iso 3OH, C15:0 iso 2OH and/or C16:1 ω7c and/or C16:1 ω7t. In this study, the highest quanti- Cultivation for fatty acid methyl ester (FAME) analysis ties were found among branched FAs, namely C15:0 iso (18.6%), C15:0 anteiso (6.0%), C15:0 iso 3OH (8.4%), C17:0 iso 3OH (8.2%), C15:1 iso All strains used in the study were cultured under optimal growth G (9.6%) and summed feature 3 containing C16:1 ω7c and/or C16:1 conditions for 48 h, and at temperatures that decreased by approx- ◦ ω6c (12.6%). Slightly lower quantities were detected for C17:1 ω6c imately 10 C (for 48 or 72 h) in order to investigate the cold-shock (3.7%) and C16:0 iso 3OH (5.3%). These major components matched response of their cell membranes. The psychrophilic strains used ◦ ◦ the taxa-specific FAs mentioned above, except for summed fea- for FA analysis were grown on R2A agar at 20 ± 2 C and 10 ± 2 C ture 9 that included C16:0 10-methyl and/or C17:1 iso ω9c (4.3%), for 48 and 72 h, respectively. The mesophilic reference strains used ◦ ◦ ◦ which were found among all strains in quantities varying from were grown on R2A agar at 30 ± 2 C and 20 ± 2 C, 25 ± 2 C and ◦ 0.8 to 7.7%. These FAs made up approximately 83% of the over- 15 ± 2 C for 48 h, and one thermophilic strain of F. thermophilum ◦ ◦ all FA membrane content. Thus, the results clearly showed that was grown at 50 ± 2 C and 40 ± 2 C for 48 h.
Load more

Recommended publications
  • Deinococcus Radiodurans : La Recombinaison Entre S´Equencesr´Ep´Et´Eeset La Transformation Naturelle Solenne Ithurbide
    Variabilit´eg´en´etiquechez la bact´erieradior´esistante Deinococcus radiodurans : la recombinaison entre s´equencesr´ep´et´eeset la transformation naturelle Solenne Ithurbide To cite this version: Solenne Ithurbide. Variabilit´eg´en´etiquechez la bact´erieradior´esistante Deinococcus radio- durans : la recombinaison entre s´equencesr´ep´et´eeset la transformation naturelle. Biologie mol´eculaire.Universit´eParis Sud - Paris XI, 2015. Fran¸cais. <NNT : 2015PA112193>. <tel- 01374867> HAL Id: tel-01374867 https://tel.archives-ouvertes.fr/tel-01374867 Submitted on 2 Oct 2016 HAL is a multi-disciplinary open access L'archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destin´eeau d´ep^otet `ala diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publi´esou non, lished or not. The documents may come from ´emanant des ´etablissements d'enseignement et de teaching and research institutions in France or recherche fran¸caisou ´etrangers,des laboratoires abroad, or from public or private research centers. publics ou priv´es. UNIVERSITÉ PARIS-SUD ÉCOLE DOCTORALE 426 GÈNES GÉNOMES CELLULES Institut de Biologie Intégrative de la Cellule THÈSE DE DOCTORAT SCIENCES DE LA VIE ET DE LA SANTÉ par Solenne ITHURBIDE Variabilité génétique chez la bactérie radiorésistante Deinococcus radiodurans : La recombinaison entre séquences répétées et la transformation naturelle Soutenue le 23 Septembre 2015 Composition du jury : Directeur de thèse : Suzanne SOMMER Professeur
    [Show full text]
  • Horizontal Gene Transfer Elements: Plasmids in Antarctic Microorganisms
    Chapter 5 Horizontal Gene Transfer Elements: Plasmids in Antarctic Microorganisms Matías Giménez, Gastón Azziz, Paul R. Gill, and Silvia Batista Abstract Plasmids play an important role in the evolution of microbial communi- ties. These mobile genetic elements can improve host survival and may also be involved in horizontal gene transfer (HGT) events between individuals. Diverse culture-dependent and culture-independent approaches have been used to character- ize these mobile elements. Culture-dependent methods are usually associated with classical microbiological techniques. In the second approach, development of spe- cific protocols for analysis of metagenomes involves many challenges, including assembly of sequences and availability of a reliable database, which are crucial. In addition, alternative strategies have been developed for the characterization of plas- mid DNA in a sample, generically referred to as plasmidome. The Antarctic continent has environments with diverse characteristics, including some with very low temperatures, humidity levels, and nutrients. The presence of microorganisms and genetic elements capable of being transferred horizontally has been confirmed in these environments, and it is generally accepted that some of these elements, such as plasmids, actively participate in adaptation mechanisms of host microorganisms. Information related to structure and function of HGT elements in Antarctic bac- teria is very limited compared to what is known about HGT in bacteria from temper- ate/tropical environments. Some studies are done with biotechnological objectives. The search for mobile elements, such as plasmids, may be related to improve the expression of heterologous genes in host organisms growing at very low tempera- tures. More recently, however, additional studies have been done to detect plasmids in isolates, associated or not with specific phenotypes such as drug resistance.
    [Show full text]
  • Paenibacillus Elgii Kocuria Rosea Bacillus Horikoshii Curtobacterium
    9/25/2016 Kocuria rosea Paenibacillus elgii Where we found it: Where we found it: On a Mars Exploration On a Mars Exploration Rover Rover before launch before launch (2004) at the Jet (2004) at the Jet Propulsion Laboratory (JPL- Propulsion Laboratory NASA, Pasadena, CA) (JPL-NASA, Pasadena, CA) Why it’s awesome: Why it’s awesome: This microbe is being studied This microbe produces for its ability to degrade (currently unknown) feathers which would have (photo from JPL) antimicrobials effective (photo by Alex Alexiev) applications in industrial waste (photo from JPL) against a wide range of management Fun Fact: fungi and bacteria Fun Fact: When applied to soil this microbe has been shown to This microbe is so commonly found on microbiology plates enhance growth of both tobacco and peanut at UC Davis that the students have nicknamed it “Henry” Regular Season Stats Regular Season Stats Time to saturation: 83 hrs Time to saturation: 67 hrs Time to exponential growth: 50 hrs Time to exponential growth: 9 hrs Growth Growth density: 52% Growth Growth density: 100% Description: Gram variable, faculative Description: Gram-positive, coccoid, Days Days anaerobe, rod-shaped, spore forming anaerobic Originally isolated: In Germany as “Micrococcus Originally isolated from: Shiso roots in roseus” in 1889 Korea (2004) Bacillus horikoshii Curtobacterium pusillum Where we found it: On a football field sample Where we found it: collected by the Pop Warner On the outside of Aggie Saints cheerleaders (Port Stadium, UC Davis, CA. Reading, NJ) Why it’s awesome:
    [Show full text]
  • Deinococcus Antarcticus Sp. Nov., Isolated from Soil
    International Journal of Systematic and Evolutionary Microbiology (2015), 65, 331–335 DOI 10.1099/ijs.0.066324-0 Deinococcus antarcticus sp. nov., isolated from soil Ning Dong,1,2 Hui-Rong Li,1 Meng Yuan,1,2 Xiao-Hua Zhang2 and Yong Yu1 Correspondence 1SOA Key Laboratory for Polar Science, Polar Research Institute of China, Shanghai 200136, Yong Yu PR China [email protected] 2College of Marine Life Sciences, Ocean University of China, Qingdao 266003, PR China A pink-pigmented, non-motile, coccoid bacterial strain, designated G3-6-20T, was isolated from a soil sample collected in the Grove Mountains, East Antarctica. This strain was resistant to UV irradiation (810 J m”2) and slightly more sensitive to desiccation as compared with Deinococcus radiodurans. Phylogenetic analyses based on the 16S rRNA gene sequence of the isolate indicated that the organism belongs to the genus Deinococcus. Highest sequence similarities were with Deinococcus ficus CC-FR2-10T (93.5 %), Deinococcus xinjiangensis X-82T (92.8 %), Deinococcus indicus Wt/1aT (92.5 %), Deinococcus daejeonensis MJ27T (92.3 %), Deinococcus wulumuqiensis R-12T (92.3 %), Deinococcus aquaticus PB314T (92.2 %) and T Deinococcus radiodurans DSM 20539 (92.2 %). Major fatty acids were C18 : 1v7c, summed feature 3 (C16 : 1v7c and/or C16 : 1v6c), anteiso-C15 : 0 and C16 : 0. The G+C content of the genomic DNA of strain G3-6-20T was 63.1 mol%. Menaquinone 8 (MK-8) was the predominant respiratory quinone. Based on its phylogenetic position, and chemotaxonomic and phenotypic characteristics, strain G3-6-20T represents a novel species of the genus Deinococcus, for which the name Deinococcus antarcticus sp.
    [Show full text]
  • Access to Electronic Thesis
    Access to Electronic Thesis Author: Khalid Salim Al-Abri Thesis title: USE OF MOLECULAR APPROACHES TO STUDY THE OCCURRENCE OF EXTREMOPHILES AND EXTREMODURES IN NON-EXTREME ENVIRONMENTS Qualification: PhD This electronic thesis is protected by the Copyright, Designs and Patents Act 1988. No reproduction is permitted without consent of the author. It is also protected by the Creative Commons Licence allowing Attributions-Non-commercial-No derivatives. If this electronic thesis has been edited by the author it will be indicated as such on the title page and in the text. USE OF MOLECULAR APPROACHES TO STUDY THE OCCURRENCE OF EXTREMOPHILES AND EXTREMODURES IN NON-EXTREME ENVIRONMENTS By Khalid Salim Al-Abri Msc., University of Sultan Qaboos, Muscat, Oman Mphil, University of Sheffield, England Thesis submitted in partial fulfillment for the requirements of the Degree of Doctor of Philosophy in the Department of Molecular Biology and Biotechnology, University of Sheffield, England 2011 Introductory Pages I DEDICATION To the memory of my father, loving mother, wife “Muneera” and son “Anas”, brothers and sisters. Introductory Pages II ACKNOWLEDGEMENTS Above all, I thank Allah for helping me in completing this project. I wish to express my thanks to my supervisor Professor Milton Wainwright, for his guidance, supervision, support, understanding and help in this project. In addition, he also stood beside me in all difficulties that faced me during study. My thanks are due to Dr. D. J. Gilmour for his co-supervision, technical assistance, his time and understanding that made some of my laboratory work easier. In the Ministry of Regional Municipalities and Water Resources, I am particularly grateful to Engineer Said Al Alawi, Director General of Health Control, for allowing me to carry out my PhD study at the University of Sheffield.
    [Show full text]
  • Bacterial Diversity Assessment in Antarctic Terrestrial and Aquatic Microbial Mats: a Comparison Between Bidirectional Pyrosequencing and Cultivation
    Bacterial Diversity Assessment in Antarctic Terrestrial and Aquatic Microbial Mats: A Comparison between Bidirectional Pyrosequencing and Cultivation Bjorn Tytgat1*, Elie Verleyen2, Dagmar Obbels2, Karolien Peeters1¤a, Aaike De Wever2¤b, Sofie D’hondt2, Tim De Meyer3, Wim Van Criekinge3, Wim Vyverman2, Anne Willems1 1 Laboratory for Microbiology, Department of Biochemistry and Microbiology, Ghent University, Ghent, Belgium, 2 Laboratory of Protistology and Aquatic Ecology, Department of Biology, Ghent University, Ghent, Belgium, 3 Laboratory of Bioinformatics and Computational Genomics, Department of Mathematical Modelling, Statistics and Bioinformatics, Ghent University, Ghent, Belgium Abstract The application of high-throughput sequencing of the 16S rRNA gene has increased the size of microbial diversity datasets by several orders of magnitude, providing improved access to the rare biosphere compared with cultivation-based approaches and more established cultivation-independent techniques. By contrast, cultivation-based approaches allow the retrieval of both common and uncommon bacteria that can grow in the conditions used and provide access to strains for biotechnological applications. We performed bidirectional pyrosequencing of the bacterial 16S rRNA gene diversity in two terrestrial and seven aquatic Antarctic microbial mat samples previously studied by heterotrophic cultivation. While, not unexpectedly, 77.5% of genera recovered by pyrosequencing were not among the isolates, 25.6% of the genera picked up by cultivation were not detected by pyrosequencing. To allow comparison between both techniques, we focused on the five phyla (Proteobacteria, Actinobacteria, Bacteroidetes, Firmicutes and Deinococcus-Thermus) recovered by heterotrophic cultivation. Four of these phyla were among the most abundantly recovered by pyrosequencing. Strikingly, there was relatively little overlap between cultivation and the forward and reverse pyrosequencing-based datasets at the genus (17.1– 22.2%) and OTU (3.5–3.6%) level (defined on a 97% similarity cut-off level).
    [Show full text]
  • Polyphasic Systematics of Marine Bacteria and Their Alpha-Glucosidase Inhibitor Activity
    Polyphasic systematics of marine bacteria and their alpha-glucosidase inhibitor activity Thesis Submitted to AcSIR For the Award of the Degree of DOCTOR OF PHILOSOPHY In Biological Science By RAHUL BHOLESHANKAR MAWLANKAR AcSIR no. 10BB13J26036 Under the guidance of Research Supervisor Dr. Syed G. Dastager Research Co-supervisor Dr. Mahesh S. Dharne NCIM Resource Centre, Biochemical Science divison, CSIR-National Chemical Laboratory, Pune-411 008, India Table of contents Table of contents 1 Certificate 4 Declaration 5 Acknowledgment 6 List of fugures 9 List of tables 12 List of abbreviations 14 Abstract 16 Chapter 1. Introduction 19 1.1. Bacterial Systematics 20 1.1.1. Phenotypic analysis 22 1.1.2. Phylogenetic analysis 28 1.1.2.1. The 16S rRNA gene sequencing 29 1.1.2.2. Phylogenetic analysis 30 1.1.2.3. Whole genome analysis 32 1.1.3. Genotypic analysis 33 1.1.3.1. DNA-DNA hybridization (DDH) 33 1.1.3.2. Genomic DNA G+C content 35 1.1.3.3. Multi-locus sequence typing (MLST) 36 1.1.3.4. DNA profiling 37 1.2. Marine bacteria and their potentials 38 1.3. Marine sediments 39 1.4. Alpha-glucosidase inhibitor 44 1.4.1. Acarbose 45 1.4.2. Voglibose 48 1.4.3. Nojirimycin 49 1.4.4. 1-deoxynojirimycin 50 1.4.5. Miglitol 51 1.5. Alpha-glucosidase inhibitors from marine isolates 52 Chapter 2. Polyphasic Systematic approach 55 2.1. Overview 56 2.2. Isolation of marine sediment sample 57 2.3. Characterization 57 2.3.1.
    [Show full text]
  • (12) Patent Application Publication (10) Pub. No.: US 2014/0017724 A1 LEONETT Et Al
    US 20140017724A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2014/0017724 A1 LEONETT et al. (43) Pub. Date: Jan. 16, 2014 (54) METHODS FOR ISOLATING BACTERIA (30) Foreign Application Priority Data (71) Applicants:CENTRE NATIONAL DE LA Jan. 19, 2009 (EP) .................................. O9305041.7 RECHERCHE SCIENTIFIOUE, Paris Cedex 16 (FR); DEINOVE, Paris (FR) Publication Classification (72) Inventors: JEAN-PAUL LEONETTI, Montpellier (51) Int. Cl. (FR); STEPHANIETEXIER, CI2P I/04 (2006.01) Montauban (FR) CI2R I/OI (2006.01) CI2P 23/00 (2006.01) (73) Assignees: CENTRE NATIONAL DE LA (52) U.S. Cl. RECHERCHE SCIENTIFIOUE, Paris CPC, C12P I/04 (2013.01): CI2P 23/00 (2013.01); Cedex 16 (FR); DEINOVE, Paris (FR) CI2R I/01 (2013.01) USPC ........... 435/67; 435/170; 435/71.3; 435/69.4: (21) Appl. No.: 14/030,504 435/101; 435/252.1 (57) ABSTRACT (22) Filed: Sep. 18, 2013 The present invention relates to compositions and methods to identify novel bacteria and metabolites derived therefrom. Related U.S. Application Data More specifically, the invention describes a novel method to isolate bacteria producing metabolites of interest from envi (63) Rsingit. E; ronmental samples. Particularly, the invention discloses a EP2010/05 o 51 3. O Jan 18, 201 p method to select rare antibiotic producing bacteria. The • Y-s invention can be used from any sample and allows the isola (60) Provisional application No. 61/145,606, filed on Jan. tion of bacteria having e.g., pharmaceutical or agrochemical 19, 2009. interest. Patent Application Publication Jan. 16, 2014 US 2014/0017724 A1 igure 1a Figure 1b US 2014/0017724 A1 Jan.
    [Show full text]
  • Oxidative Stress Resistance in Deinococcus Radiodurans†
    Downloaded from MICROBIOLOGY AND MOLECULAR BIOLOGY REVIEWS, Mar. 2011, p. 133–191 Vol. 75, No. 1 1092-2172/11/$12.00 doi:10.1128/MMBR.00015-10 Copyright © 2011, American Society for Microbiology. All Rights Reserved. Oxidative Stress Resistance in Deinococcus radiodurans† 1 1,2 Dea Slade * and Miroslav Radman http://mmbr.asm.org/ Universite´de Paris-Descartes, Faculte´deMe´decine, INSERM U1001, 156 Rue de Vaugirard, 75015 Paris, France,1 and Mediterranean Institute for Life Sciences, Mestrovicevo Setaliste bb, 21000 Split, Croatia2 INTRODUCTION .......................................................................................................................................................134 GENERAL PROPERTIES OF DEINOCOCCUS RADIODURANS.......................................................................134 Common Features of a “Strange” Bacterium.....................................................................................................134 Ecology of D. radiodurans.......................................................................................................................................135 D. radiodurans Physical Structure and Cell Division ........................................................................................135 Metabolic Configuration of D. radiodurans .........................................................................................................136 on March 25, 2015 by UNIVERSIDADE EST.PAULISTA JÚLIO DE Phylogeny of D. radiodurans ..................................................................................................................................140
    [Show full text]
  • Final Report
    Final Report Study of glutamate decarboxylase gene from GABA-producing lactic acid bacteria isolated from Kung-Som, the traditional Thai fermented shrimp Investigator Suppasil Maneerat Department of Industrial Biotechnology Faculty of Agro-Industry Prince of Songkla University This research project was supported by Prince of Songkla University, Thailand, for the fiscal year of 2013-2014 (Grant No. AGR560008S) 2015 i ACKNOWLEDGEMENTS This study was financially supported by Prince of Songkla University, Thailand, for the fiscal year of 2013-2014 (Grant No. AGR560008S). Suppasil Maneerat ii ABSTRACT Kung-Som is one of several traditional Thai fermented shrimp products, especially popular in the southern part of Thailand. This is the first report to reveal the bacterial communities in the finished product of Kung-Som. Ten Kung-Som samples were evaluated using the polymerase chain reaction-denaturing gradient gel electrophoresis (PCR-DGGE) methodology combined with appropriated primers to study the dynamics of the bacterial population. Two primers sets (V3; 341f(GC)-518r and rpoB; rpoB1698f(GC)-rpoB2014r primers) were considered as a possible tool for study the communities of bacteria. PCR- DGGE analysis of both the V3-region and rpoB amplicon was successfully applied to discriminate between lactic acid bacteria (LAB) and other Gram positive strains in the bacterial communities of Kung-Som products. These preliminary results concluded that the main microbiology of finished product of Kung-Som was LAB and coagulase negative cocci (CNC). Kung-Som presents a high glutamic acid which is a major substrate for biosynthesis of natural γ-aminobutyric acid (GABA) by LAB. The GABA-producing LAB from Kung- Som products were isolated, screened and identified.
    [Show full text]
  • (Muty) Protein Showing a 4 Amino Acid Insertion That Is a Distinctive Characteristic from Homologs of Deinococcus Group of Bacteria
    24 82 Deinococcus radiodurans 499191373 LLGWFDRAGRDLPWRLGDE GRRD PYRVWVAEILLQQTQVARGLGYYERFLEAFPTVQAL Deinococcus swuensis 746728251 --A---A----------S- ---- --------------------H--D---------E-- Deinococcus deserti 502012169 --A---A--------A-V- ---- -----IS-V-----------T--D---Q-------- Deinococcus marmoris 1175298040 --A---AS--E------T- -A-- --------------------H--D-------S---- Genus Deinococcus Deinococcus reticulitermitis 1094410079 -------V--A------P- -G-- -------------------RL--------------- Deinococcus wulumuqiensis 648447004 --A-------E----V-P- -A-- ----------------V--RM--------------- (26/26) Deinococcus geothermalis 499848436 --A-------A----V-P- ---- ------S-V----------RV-F----------E-- Deinococcus apachensis 518416424 --S-------P----V-P- ---- ------S-V----------RV-F----A-------- Deinococcus puniceus 1028846678 --T---QH--A------E- -A-- --------------------V------T---S-E-- Deinococcus aquatilis 517840375 --T---HS--A----A-A- -A-- --------------------V------T---S---- Deinococcus actinosclerus 1011240592 --A----Q-------Q-P- ---- ---A----V-----------E--H---T---S--V- Deinococcus maricopensis 503320979 ------AHA-T----A-A- -A-- ------S-V-----------V-F----A-------- Deinococcus peraridilitoris 505047897 --A---EHA------AASP ---- ------S-V-------V--KV-F----T---D-A-- Hyphomonas adhaerens 916989539 --A----H-------MALG E--- -----L---M----TIPH-TP-FHK-TDRW-S-E-- Hyphomonas spp. Hyphomonas jannaschiana 916990686 --A----H-------TALG E--- -----L---M----TIPH-TP-FLT-TQRW---E-- (11/11) Acinetobacter dijkshoorniae 1008917059 --N---QH--HDLPWQVAD - --K---S--M------KTV-Q-FD--M-R----E--
    [Show full text]
  • Microbial Hitchhikers on Intercontinental Dust: Catching a Lift in Chad
    The ISME Journal (2013) 7, 850–867 & 2013 International Society for Microbial Ecology All rights reserved 1751-7362/13 www.nature.com/ismej ORIGINAL ARTICLE Microbial hitchhikers on intercontinental dust: catching a lift in Chad Jocelyne Favet1, Ales Lapanje2, Adriana Giongo3, Suzanne Kennedy4, Yin-Yin Aung1, Arlette Cattaneo1, Austin G Davis-Richardson3, Christopher T Brown3, Renate Kort5, Hans-Ju¨ rgen Brumsack6, Bernhard Schnetger6, Adrian Chappell7, Jaap Kroijenga8, Andreas Beck9,10, Karin Schwibbert11, Ahmed H Mohamed12, Timothy Kirchner12, Patricia Dorr de Quadros3, Eric W Triplett3, William J Broughton1,11 and Anna A Gorbushina1,11,13 1Universite´ de Gene`ve, Sciences III, Gene`ve 4, Switzerland; 2Institute of Physical Biology, Ljubljana, Slovenia; 3Department of Microbiology and Cell Science, Institute of Food and Agricultural Sciences, University of Florida, Gainesville, FL, USA; 4MO BIO Laboratories Inc., Carlsbad, CA, USA; 5Elektronenmikroskopie, Carl von Ossietzky Universita¨t, Oldenburg, Germany; 6Microbiogeochemie, ICBM, Carl von Ossietzky Universita¨t, Oldenburg, Germany; 7CSIRO Land and Water, Black Mountain Laboratories, Black Mountain, ACT, Australia; 8Konvintsdyk 1, Friesland, The Netherlands; 9Botanische Staatssammlung Mu¨nchen, Department of Lichenology and Bryology, Mu¨nchen, Germany; 10GeoBio-Center, Ludwig-Maximilians Universita¨t Mu¨nchen, Mu¨nchen, Germany; 11Bundesanstalt fu¨r Materialforschung, und -pru¨fung, Abteilung Material und Umwelt, Berlin, Germany; 12Geomatics SFRC IFAS, University of Florida, Gainesville, FL, USA and 13Freie Universita¨t Berlin, Fachbereich Biologie, Chemie und Pharmazie & Geowissenschaften, Berlin, Germany Ancient mariners knew that dust whipped up from deserts by strong winds travelled long distances, including over oceans. Satellite remote sensing revealed major dust sources across the Sahara. Indeed, the Bode´le´ Depression in the Republic of Chad has been called the dustiest place on earth.
    [Show full text]