$1.50 Vol. 59 No. 46 • Friday, February 26, 2021 Crime stats Crime down )RUW 4X·$SSHOOH 5&03 6WDII 6JW 'HDQ/HUDWUHSRUWHGWKDWWKHRYHUDOO FULPHUDWHLQWKHFRPPXQLW\GURSSHG drop in Fort DERXWSHUFHQWODVW\HDUSULPDULO\ GXHWRWKH&29,'SDQGHPLF7KH ODUJHVWGHFUHDVHZDVLQWKHIWZKLFK ZDVGRZQSHUFHQW ALAN HUSTAK | GRASSLANDS NEWS from COVID By Alan Hustak Grasslands News

The overall crime rate in Fort Qu’Appelle was down by about 20 percent last year because of the COVID-19 pandemic. But traffic offenses in 2020 al- most doubled as the result of a strategic crackdown on impaired driving in the area. “COVID has slowed things down considerably,” RCMP Staff Sgt, Dean Lerat informed council. “A major factor contributing to the decline was everyone spent more time indoors, and because we were able to patrol more, the police were more visible.” As a result there was a 60 per cent drop in thefts, a 30 per cent decline in break and enters and a 10 per cent drop in the number of assaults reported to the local detachment. The number of incidents of public mis- chief remained the same, but Lerat attributed that to a “core group of certain individuals known to po- lice,” offenders who “do things over and over again,” and wind up regularly in police cells. “We’re trying to help them by referring them to drug and alcohol treatment centres, but we need more help with that. We have a harder time finding shelter for men than we do for women.” Lerat is especially pleased with the work of com- bined traffic services aimed at reducing impaired driving. “That was our priority last year, a strategy to increase the number of patrols on the roads. The initiative worked. I am very proud of the members of the Fort Qu’Appelle detachment and the work they put into it,” he said. “We had 165 occurrences, compared with 98 in 2018. Lerat said any fines col- lected by Regina police patrolling the area remain in the municipality. Councillor Ron Shordee wanted to QVCA and Town at odds over agreement know whether the police will implement bike patrols in the summer and Staff Sgt. Lerat replied, “It is always a balancing act. I would like to have the re- By Chris Ashfield town control over the QVCA assets, merely a tenant of a Town-owned sources, but we don’t have the money. We are doing Grasslands News right-to-evict, and numerous other property.” the best we can.” changes which the QVCA described After about three months of dis- Lerat said the detachment’s priority this year is as “questionable.” cussion and various draft agree- to get drugs off the streets. The Qu’Appelle Valley Centre “This partnership began in 2010 ments between the two sides – all of The incidents of drug possession and trafficking for the Arts (QVCA) and the Town by a group of local citizens prevent- which were rejected by the QVCA increased 50 per cent during the pandemic. “Opiates of Fort Qu’Appelle are at odds ing the damaged and dilapidated for not being based on the exist- and fentanyl and the abuse of prescription drugs re- over the renewal of a collaborative ‘Old Central School’ building from ing agreement, or following the main a problem. The dealers are in Regina and they agreement between the two which being demolished. These citizens renewal process, but instead tried send people here to sell drugs,” Staff Sgt. Lerat ex- details the continued operation created the non-profit QVCA with to impose an inappropriate lease, plained. “We are trying to develop intelligence to find of the Old Central School as the this agreement: if the town keeps landlord or occupancy “template” out who the players are.” community Centre for the Arts. the building, the QVCA will repair, – the QVCA obtained a legal opin- Deaths from fentanyl in Saskatchewan doubled Initially signed six years ago, the renovate, restore, upkeep, and op- ion from lawyer George Morris. In last year; 377 people overdosed on the drug in 2020. agreement expired in November erate the building as a community his findings, which he addressed “The question is – did COVID speed that up? Hard and has yet to be renewed. arts centre. Since 2011, both QVCA in a letter to the town on Nov. 2, to say,” observed community clinic doctor Morris The dispute began last August and the Town of Fort Qu’Appelle Morris emphasized that the orig- Markentin, a physician who specialises in substance when the QVCA requested to have have kept their ends of the bar- inal agreement states the QVCA abuse. “Maybe, but we knew it was coming. We saw the agreement renewed, which was gain,” said QVCA member Brian has “the right to renew a similar the tidal wave of fentanyl coming.” one of the terms within the origi- Baggett in a letter to Grasslands agreement” and that the agreement The detatchment wants to start a Citizens on Pa- nal agreement. What the town pre- News. “The QVCA has raised over “is a contract in law and as such trol Program (COPP) in Fort Qu’Appelle and will sented to the group however, was a $250,000 for renovations, most enforceable by the parties thereto be looking for volunteers to act “as another pair of new agreement that saw the QVCA achieved with volunteer labour. and capable of amendment only by eyes,” for the community, and patrol the streets in listed not as operators of the facil- None of these funds would have mutual consent.” their own cars to help identify “suspicious or con- ity but instead tenants, giving the been possible if the QVCA was -SEE QVCA, 12 cerning behaviour.” 2 February 26, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Totally tubular fun at Mission Ridge

By Alan Hustak Grasslands News

This young daredevil disappeared head first down the tube slide at Mission Ridge when the park reopened for business last weekend. All the runs were closed for six days because of bitter cold, nasty weather. When temperatures began to return to normal, hundreds anxious to be out- doors took advantage of the mild conditions on the weekend to return to the slopes on their skis, snowboards and tubes. “It is just so awesome to be able to get out of the city,” said one enthusiastic boarder, “There’s nothing like this in Regina.” Because of the pandemic, Mission Ridge has in- troduced a mandatory Lift Pass reservations sys- tem which limits the number of people who can ski each day. It has also opened an outdoor ser- vice for Punch Card holders, Pre-purchased tube park passes and guests who require a day pass. Crowd control and social distancing is in effect and monitors on site instruct visitors to wear their masks properly. “All lift passes and tube park passes must be reserved in advance,” said the park’s business manager Anders Svenson. “An overwhelming ma- jority of our visitors know the rules and respect the protocols we have in place. The majority are very happy that we are here. I’d say 99.9 per cent appreciate the amount of work we have put in to keep the place safe. It’s the one per cent who are loud and obnoxious that can ruin your day.” De- pending on the whims of Mother Nature, the park is scheduled to close at the end of March. Cool cat is fundraiser mascot for animal shelter

By Alan Hustak Hack said there are at least 100 res- Grasslands News cue cats in the shelter, as well as other animals. Because of COVID the group hasn’t been able to hold its usual out- Each year for the past decade or so door fundraising activities, like hot-dog residents in Melville look for the new- sales. est creation at Queen Street and Ninth Avenue west to see what snow sculpture “Even though pet food is donated, it Scott Miller has created. Miller has been is always a struggle,” said Hack. making the icy sculptures since he was Getting the 2-1/2 metre tall cat fin- a kid and normally shuns media atten- ished was a bit of a challenge for Miller tion. He comes by his talent naturally, too. “I don’t know how much time I both his mother and a sister are artists. spent working on it; I didn’t keep track, “I do them for me, but if people ap- but it took a lot of hours,” he said. “The preciate them, I’m happy,” Miller told cold snap didn’t help.” Grasslands News. This year, however, When asked if he has a name for his he created a really cool cat in his front creation, Miller shook his head. “No. yard as a fundraising mascot for the But now that it is starting to melt, let’s local animal rescue shelter. call it the ghost cat.” “If people like the cat and want to Paws n’ Claws provides a variety show their appreciation, they are asked of options for donors; contributions of to make a donation to Paws n’ Claws,” more than $20 are tax deductible. To said volunteer fundraiser Donna Hack. support the group, go to www.pawsand- “All the money we get goes to pay our clawsyorkton.ca or check the shelter’s veterinarians.” face book page. Broadview council Well repairs estimated at $12,500

By Sarah Pacio mittee could look at the tain financial assistance Grasslands News damaged wells, and until to hire two summer stu- the town receives KGS’s dents in 2021. next Lagoon Monitoring Due to provincial Broadview town coun- Report scheduled for 2022. regulations and an in- cil held its regular meet- Town officials are creased number of posi- ing at 7:00 am on January aware that the sewer tive COVID cases in the 20 with all members in service line at 630 Mor- area, council made a mo- attendance. ley Street is sunk on the tion that the Broadview The group discussed a owner’s property. Council Skating Rink will remain proposal from KGS Group made a motion to inform closed. to install three new the owner that the town groundwater monitoring will not be responsible wells and decommission for future costs to clean two damaged monitoring or clear the line until the wells between the town’s owner repairs the sewer lagoon and wells. The es- service line on their prop- timated cost provided in erty. 'R\RXUSDUWWR Snow cat $/$1+867$._*5$66/$1'61(:6 the proposal was $12,478 Council authorized SUHYHQWFULPH plus applicable taxes. administration to apply 3DZ·VQ&ODZVIXQGUDLVHU'RQQD+DFNZLWKWKH¶JKRVWFDW·7KHVQRZVFXOS- Council voted to table the to the Government of &RQWDFW WXUHLVRQDIURQWODZQRQWKHFRUQHURI1,QWK$YHQXHZHVWDQG4XHHQ6WUHHW issue until members of Canada’s Summer Jobs 7,36 LQ0HOYLOOH the Public Works Com- Program in order to ob- www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV February 26, 2021 3 Cowessess FN installing solar power panels

By Sarah Pacio essess, for the additional 10MW of en- complete. 30 years. “This is the equivalent of tak- Grasslands News ergy, and construction is expected to “Cowessess First Nation is on the ing approximately 2,000 cars off the begin in the spring. path to becoming one of the greenest road for one year,” Daphne Kay, Cow- Utilizing renewable energy sources In addition to this, the First Nation is nations in Saskatchewan,” Chief Cad- essess’ Community Energy Specialist, continues to be a priority for Cowessess completing a renewable energy project mus Delorme said in a recent statement. told Grasslands News. “Cowessess First First Nation. Plans are underway for on the Cowessess reserve just north of “Renewable energy speaks to our tradi- Nation will continue to implement re- expansion at the First Nation’s existing Broadview. A total of 803 solar panels tional values of land stewardship and newable energy as we do our part to solar energy site and another project is will be installed at five of the commu- environmental sustainability and allows contribute to the Government of Cana- nearly complete on the reserve. nity buildings by the end of this month. us to think of our future generations in da’s goal to reach net-zero emissions by In the summer of 2020, leaders an- Solar Arrays were placed on the roofs the way our previous generations have 2050.” nounced that Cowessess First Nation of the Administration Office and the thought about us.” Not only will the First Nation reduce would be adding more than 30,000 solar Seniors Centre Four-Plex. The Water A grant from the Government of Can- its carbon footprint, the project will panels (10MW) to its hybrid energy cen- Treatment Plant, Cowessess Community ada’s Low Carbon Economy Challenge also create an estimated cost savings tre near Regina. The site already in- Educational Centre and Chief Henry S. Fund will provide partial funding for of $28,000 annually and provide em- cludes 500kW of solar panels, an 800kW Delorme Mall will also be powered by the solar project on the reserve. The ployment for Cowessess citizens during wind turbine, and a 400kW lithium ion solar energy through ground-mounted grant program supports initiatives that construction. Annual savings in energy battery storage unit. A power purchase solar arrays near those three buildings. reduce carbon pollution, save money, costs will be directed first to pay down agreement was formalized in September The panels at the Seniors’ Centre are and create jobs. Cowessess will receive project costs and savings thereafter will 2020 between SaskPower and Awasis already running and the others will be approximately $633,000 from the federal be redirected to underfunded social Solar, a business entity owned by Cow- operational as soon as installation is grant, which will cover 25 per cent of areas. Awasis Solar provided solar in- the project’s overall cost. stallation training for 11 Cowessess Cit- The 803 panels on Cowessess’ build- izens last June and four of them were ings have a combined capacity of 321 hired by the contractor, SkyFire En- kilowatts and will generate 390-mega- ergy, for the community project. An ad- watt hours of solar power annually ditional member of the six-person crew through SaskPower’s Net Metering is also from Cowessess; he underwent Program. This clean energy source is similar training in 2018 and has been projected to reduce greenhouse gas a full-time employee with SkyFire ever emissions by 8,165 tonnes over the next since. It all starts HERE! 150 GIVE BLOOD the gift of DONORS Needed

Solar panels installed 68%0,77('_*5$66/$1'61(:6 0RUHWKDQVRODUSDQHOVDUHEHLQJLQVWDOOHGDWÀYHVLWHVZLWKLQWKH&RZHV- sess First Nation community. The project has created jobs for band members and is expected to save the First Nation $28,000 annually in energy costs. Blood Donor Clinic Tues., March 9 3:30 p.m. - 7:30 p.m. Wellness, Beauty and Holistic Melville Community Works 800 Prince Edward St., Melville, SK DONORS ARE REQUIRED TO: Directory • Be between the ages of 17 and 71 years if they are a regular donor. • Be between the ages of 17 and 61 if they are a first time donor. • Be in general good health, a minimum of 110 lbs. Yorkton Hearing Services YOU ARE REMINDED TO: #18 First Avenue North, Yorkton, Sask. S3N 1J4 • Please eat something before donating. Your ears deserve an audiologist! • Bring Identification with full name and signature or full name and photo. PERSONAL CARE HOME • Hearing Tests • Hearing Aids This advertisement is sponsored by these businesses • Repairs • Batteries Private bedrooms/bathrooms for Singles and Couples. • Custom Molds Corinne Pauliuk - Owner/Operator St. Peter’s Phone: 306-782-1793 306.699.2548 www.yorktonhearing.com website: carehomes.ca/homes/sunrise-country-haven/ Jacquie Mvula 135 - 3rd Ave E. Hospital M.S., R. Aud. Located on acreage between McLean & Qu’Appelle Melville 306-728-5625

Kreklewich & Chambers Simply Divine Law Office ‡&OHDQ&HUWLILHG&DEV %DUULVWHUV 6ROLFLWRUV²0HOYLOOH6DVN 1RQVPRNLQJYHKLFOH 306-728-2772 Call 306-728-5468 Tammy Oryschak 306-730-5748 Phone 306-720-0789 508-7th Ave. West, Melville, SK Prairie Co-operative Ltd. Online: mytiber.com/tammyoryschak Facebook: 728-4556 Tiber River with Tammy Oryschak 156 - 2nd Avenue East - Melville, SK

For all your denture needs: Caleb Village Melville Grasslands 680 - 7th Ave. East Tru-Fit Denture Clinic News Group 306-728-5448 306-728-2035 2130B Broad Street, Regina, Saskatchewan S4P 1Y5 306-352-2552 Book your appointment: www.blood.ca CALL COLLECT 1-888-236-6283 “Doing a smiling business for over a decade and a half” 4 February 26, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Support for Pine Lodge move gains momentum Fort San Council wants to do its due diligence By Alan Hustak experience, before Pine Lodge burned in to believe that council was going to make the Pine Lodge project because through Grasslands News December and was located in his riding a decision at its last meeting,” he said, experience we know the overwhelming in Indian Head, he never received one “The day of the meeting we were asked positive impact a facility can have for The chorus of those who support the complaint about its operations. “While not to attend. The legal advice we have a person, their families, and in the end, application to allow the former Prairie it will be up to local authorities to de- received is that the process Mr. Goodman their community.” Christian Training Centre in Fort San to cide whether it is relocated, I support suggests is outside the requirements of A delegation of some Fort San citizens be used as a treatment centre for recover- its efforts to move to Fort San. I have the bylaw, and that all we need is to pro- opposed to the relocation of Pine Lodge ing alcoholics and drug addicts is grow- met with many of those who have gone vide a development permit application have asked that their objections to the ing – and growing louder. But the Village through their program, and it was amaz- consistent with the zoning requirements. treatment centre moving into their com- of Fort San says the endorsements are ing to learn how Pine Lodge has helped We have the written elements done, and munity be raised in private. But it is un- part of an orchestrated campaign against to turn their lives around.” all that remains to be done is submit a derstood than in an attempt to lower the the town, and in part, blames the media The File Hills Tribal Council also has site plan. Surveyors were out on Wednes- rhetoric, council has agreed to hear sub- for stirring up the controversy. thrown its support behind Pine Lodge. day completing the site plan.” missions, both for and against the move Among those who want to see Pine “Time and time again, we have proven Meanwhile, the union representing in private. Lodge move into the renovated building that a treatment facility can co-exist and Pine Lodge says bureaucratic delays in Goodman says if the delegation brings along Fort San road are The File Hills thrive in the community with absolute delaying the relocation are putting lives forward pertinent information that Tribal Council, the Union representing minimal negative impact,” said Tribal at risk. should be made public it will be asked Pine Lodge employees, Saskatchewan’s Chief Edmund Bellegarde. “We support “There are so many people suffering to appear and make its case at an open minister of government relations, Don the endeavour of Pine Lodge in providing with addictions, and there is mounting meeting of council. McMorris, and the MLA for Last Moun- relevant addiction treatment for individ- evidence that Saskatchewan is facing an A statement issued on Wednesday tain Touchwood, Travis Keisig. uals who are reaching out for assistance addictions crisis. Reopening Pine Lodge signed by Mayor Steve Helfrick says “Pine Lodge has done some fantastic in addressing their misuse of substance as quickly as possible would help im- he and the council have wrongly been work. The 2-million dollars that the Pine abuse and we encourage the community prove access to treatment,” says Aimee portrayed in the media as being against Lodge would bring into Fort San would to welcome Pine Lodge.” Nadon, national representative with the Pine Lodge. be an economic driver for any small Fort San’s Chief Administration Of- Canadian Union of Public Employees. “This is not an accurate portrait,” town in Saskatchewan,” said Travis ficer, Victor Goodman says comparing “The waiting list for treatment is grow- reads the statement, “Fort San council Keisig who represents Fort San residents Leading Thunderbird Lodge and Pine ing longer every day, while Pine Lodge agrees and acknowledges that substance in the legislature. Lodge is mixing apples with oranges. remains closed. When you add that to abuse treatment facilities are an import- Keisig, who was elected MLA last “Their zonings are not the same. Each the recent layoffs at the facility, the neg- ant and necessary service in any commu- October, admits that as a new MLA he has to be considered on their own mer- ative effects on the community are ex- nity. However councils are required to may not be as well informed as he could its. Leading Thunderbird Lodge is in the panding.” make decisions on what they believe is be, but said hearing actual patients talk process of becoming an urban reserve. Karen Main, the executive director in the best interest of their communities. about how Pine Lodge has changed their The issue is not about Pine Lodge, per of Leading Thunderbird Lounge told Council needs to be given the time to lives was very moving, very convincing. se, but whether it can operate as a resi- Grassland News that when the centre complete thorough due diligence without “I think it is important for the re- dential care facility under existing zon- first opened as the New Dawn Valley outside distractions. In the end, if coun- cord to show that the government of ing bylaws.” Goodman also points out Adult Treatment Centre 25 years ago, cil does not believe a substance abuse Saskatchewan has made it a priority to that council has received nothing in similar anxieties were raised by people treatment centre fits into the definition address health and substance abuse is- writing, from the owner of the former who were concerned about “undesir- of a residential care facility as defined in sues. While I support the Pine Lodge ini- PCTC building, James Archer, and until ables” moving into the neighbourhood. the zoning bylaw, it is under no obliga- tiative, I will not step on the toes of the he provides Council with a written de- She says that since Leading Thunderbird tion to agree to the definition.” municipal government’s right to decide velopment plan, the matter remains un- Lodge began operations in 2007 it has in- A meeting was called for last Wednes- for itself whether or not it meets zoning resolved. jected $35-million into the local economy day evening, (Feb. 24) but the matter requirements.” Archer says the first time he was ad- and it has helped hundreds of youths is not expected to be resolved until the Don McMorris, minister of Govern- vised that he needed to submit a written deal with addictions and mental health next regular meeting of Fort San Council ment Relations says that based on his proposal was last Friday. “We were led issues without incident. “We support scheduled for March 15.

     
    Be Ready For Spring

          ! !$"$ "#!$#"$!$    $ $
$$ $   $ $  $   $ $ $

 
 
 Are you looking for
 





 new patio furniture? Stop in and see the
    
 New arrivals for 2021!     
   K
   
       
 Hardware Clerk &DUHHU2SSRUWXQLW\ Full-time 
       Borderland Co-op is hiring a Hardware Clerk at our Home Centre in Whitewood, SK.
     Who we are: Co-op does business differently. As a co-operative, we believe in working together to
 serve Western Canadians, delivering profi ts back to our communities and investing in
    sustainable growth. To learn more about who we are and how you can help bring our       brand to life, visit us at www.borderlandcoop.com Apply via email or in person or contact us at [email protected]
     or more information.

    
  ww 
 Whitewood Home Centre – 804 S. Railway St. – 306-735-2410 %'K+!(!)K%*'K,(!)K)KHHH >62E@1D /A=K www.borderlandcoop.crs www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV February 26, 2021 5 PVSD focus on Indigenous education increases

By Emily Jane Fulford The board included in their presentation updates the COVID-19 pandemic on student learning. Grasslands News the number of self-declared Indigenous students en- The Resident Knowledge Keeper Program, which rolled, which they noted has remained at a consis- transitioned to the Remote Learning Elder online pro- tent 1,300 over the past number of years. It was also gram, at every school except one, continues to be a The Prairie Valley School Division Board an- nounced on Feb. 19 that they will be ramping up Indig- brought to the public’s attention that the graduation success; the Bert Fox Community High School con- enous focused education moving forward. It was part rates for Indigenous students also remained signifi- tinuing with the in-person program. Both versions of of their board update created on Feb. 11 to address var- cantly higher than the provincial average, indicating the program, in-school and online, have been designed ious key points the school board has as we approach that the system is working thus far. to connect students and teachers consistently with El- the end of another school year. Reading results in this demographic have remained ders and Knowledge Keepers from their community “Graduation rates for Indigenous students continue consistent since the fall, another piece of good news whose goals are to provide guidance, mentoring, and to trend up. That is one message the Board heard from for the board during these troubling times when it teachings both inside and outside the classroom. senior leadership during a presentation on the Divi- would be expected that numbers would fluctuate due Action items related to the strategic plan, such as sion’s Indigenous Education Strategy. The last year to students having to deal with the circumstances sur- those which include work on culture and language has been and continues to be, highly impacted by the rounding the pandemic and the limitations that had to courses, First Nation-driven partnerships, and an- COVID-19 pandemic. For that reason, there have been be imposed in order to ensure safety. Regardless of the ti-racism and oppression education for staff also con- some changes to the Indigenous Education Strategy positive results and outlook, the school division has tinue to operate under the board and have thus far and focus for the 2020-2021 school year.” vowed to continue its efforts to evaluate the impact of appeared to produce positive results. Phase 2 public vaccination clinics planned for 180 communities

By Elaine Ashfield population based on age, 61 mobile clinics) in 180 Some of these clinics in vide the vaccine without munities. A number of ad- Grasslands News working in 10-year in- communities. The lo- the Grasslands News area an appointment. These ditional health workers, crements starting with cations and hours will include: clinics are expected to including those directly Vaccination for COVID- people in their 60s and be announced later this Broadview, Esterhazy, have longer wait times involved in the delivery of 19 for the general public, working down. It will spring. Fort Qu’Appelle, Gren- and lineups and will be in the vaccine during Phase defined as Phase 2, is ten- also include a targeted In addition to the sites fell, Indian Head, Kipling, Esterhazy and Melville as 2, will receive their vacci- tatively scheduled to start group of adults and staff operated by the SHA, Melville, Moosomin, Ro- well as other locations in nations in the first phase. in April, and the gov- in group homes and shel- community clinics will canville, Whitewood and the province. ernment has announced ters to receive vaccina- also be available through Wolseley. Phase 1, which started there will be vaccine clin- tions as well as extremely pharmacies, doctor’s of- Mobile immunization on Dec. 22, focuses on ics in 180 communities vulnerable adults which fices, partnerships with units are self-contained immunizing high-risk LANDFILL )25748·$33(//( across the province. includes people undergo- community organizations, clinics that will be used to members of the public The province has cau- ing certain cancer treat- First Nations clinics and reach rural, remote and including health-care :,17(5+2856 tioned it will depend ments, people with severe partnerships with large vulnerable populations in workers in intensive • November 1 to April 30 • on vaccine supplies but respiratory conditions businesses and industries. Saskatchewan. Some of care units, emergency Monday to Friday Premier Scott Moe said and others with a variety Mass immunization these centres include: departments and COVID- 9:00 a.m. - 4:00 p.m. Ottawa has assured him of ailments. clinics will be the prov- Balcarres, Grayson, 19 wards, testing staff, Saturday 9:00 a.m. - 1:00 p.m. that deliveries will be The Sask. Health Au- ince’s primary mode of Neudorf, Wolseley, elderly residents in care Closed Sunday and Statutory Holidays Minimum Load Charge is $10 ramping up significantly thority will operate 226 vaccine delivery in the amongst others in the homes, individuals aged We now Accept: in the coming weeks. vaccine clinics (141 mass second phase of the roll- province. 70 and older, and resi- Phase 2 will focus on immunization clinics, out. Appointments will be In the area, the drive dents over the age of 50 immunizing the general 24 drive-thru clinics and needed for these sites. thru locations will pro- in remote northern com-

21024ge0 6 February 26, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News

“For the cause that needs assistance; for the wrong that needs resistance; the future in the distance and the good that we can do.” Businesses need an insurance plan for stability

As businesses, and especially small businesses, con- portantly, keep operating. hoppers of a business - no insult intended as it’s a free tinue to struggle, I wonder if things would be different if Being in business for many years, I don’t believe I world to choose your means of purchasing. They have businesses had an insurance program in place, let’s say can honestly say I have seen an insurance program that invaded the communities leaving the businesses stripped similar to the Crop Insurance Program. guarantees a level of income for the business sector in of customers and a whole pile of non-usable stock to sell My comments are definitely not to insult farmers. our communities. There is business interruption insur- at sale prices and with either decreased or no income Their insurance program has proven to be very bene- ance if something transpire that stops your business from coming in to continue to pay their employees with or to ficial to their businesses and their businesses are very operating. There is fire insurance, glass insurance, theft diversify their business. beneficial to the small businesses and the economy of our insurance and vandalism insurance, but there is nothing This is what is happening in today’s world of business. communities and our country. called guaranteed income insurance that I am aware of. As the saying goes – “It’s a risky business” being in busi- I guess you could say that after seeing this week’s an- When external factors affect the number of sales – just ness today. I venture to bet that there would be a lot of nouncement about the Crop Insurance Program for this like the farmer’s bushels per acre – the business owner businesses diversifying or even relocating if they could year, I would categorize myself as somewhat jealous of just has to find ways to continue operating without any sign up to an insurance program that would be paying their business benefits available to them. means of applying for more income to cover their losses. them a guaranteed level of income dependent on the ex- You see, operating a small business has never had any By this I am referring to insurance, not lending services. ternal factors during their operational year. income guarantees for the owners, providing stability to External factors could be a decrease in the economy so There may be a lot more businesses still in operation, the owners, no matter what situation arises. that the money being divided in their community by the helping our communities to prosper, if they were or had Operating a business has always been a challenge shoppers may now all have to go towards food and other been privy to a business insurance program. which is more than evident in all communities where we family survival needs instead of towards what other busi- We have seen the big businesses replace the small have seen businesses come and go over the years. There nesses may have once also benefited from. business over the years as big box stores moved in and is no guarantee that your income will support your ex- Things such as a shut-down of a major employer in an draw shoppers from miles around. We are now also see- penses as your business relies on many external factors. area for a lengthy or even sometimes a short period of ing many big box stores closed and leaving empty spaces This is where I’d like to compare the business situ- time can be a hard hit to the dollars that pass through a in retail areas. Are small businesses going to start pop- ation to farmer’s businesses and their sustainability businesses’ sales totals. Unpredictable and destruction to ping up again? I’m afraid the number of people who once through Crop Insurnace. External factors dominate what the bottom line of many businesses is the result. believed a small business would give them a stable, even the yields and the net income may be for that production Or what about changes in the manner that people de- if meager lifestyle are far fewer now that are willing to year for the farmer and they are guaranteed a certain cide to do business? Some businesses may have benefited take the gamble of being a business owner. Well, unless level of income if they have bought into the Crop Insur- from things like – let’s say – online shopping but on the of course – maybe, just maybe, someone could develop a ance Plan. other side of the coin, what about all the businesses that guaranteed income insurance plan as beneficial to busi- This is great as the insurance holders can now pay once supplied these items to people in their communities. nesses as Crop Insurance is to farmers. their bills, continue to pay their employees and most im- I guess you could call them (online shoppers) the grass- - Elaine Ashfield Texas reminds us of value of SaskPower By Murray Mandryk havoc on poorly insulated homes, Political columnist businesses and people more accus- tomed to enduring tornadoes, hur- ricanes and summer heat. There are a number of reasons About 4.7 million Texas homes why we take good, ol’ SaskPower and businesses were left without for granted … and maybe some- electricity, heat and running water times even dislike it. due to burst pipes and frozen natu- For starters, a govern- ral gas intakes. Power lines downed ment-owned monopoly utility is by ice and freezing rain added to bound to irritate us because it the chaos. seemingly can charge what it wants So did wind turbines that ac- for something we absolutely can’t count for 15.7 per cent of Texas live without. power that were shuddered by the This has always been a source of cold. resentment in Saskatchewan — one To say that SaskPower is vastly that’s likely grown as we’ve become more prepared for such cold more free enterprise in nature. weather is a massive understate- And while publicly owned util- ment. ities like SaskPower actually For starters, we do better insu- pre-date the first Co-operative Com- late everything, including our wind ing of the reality that distributing electric- Texans were hit with bills of $5,000 for five monwealth Federation (the CCF turbines — although they only ac- ity to a vast jurisdiction (Saskatchewan is days because their contracts were with pri- that would later become the NDP) count for 241 megawatts or five per within 4,000 square kilometres of being as vate companies allowed to jack up prices to government, Crown corporations cent of SaskPower total 4,893-mega- big as Texas) requires rules to be followed make up for shortfalls. have always been long-associated watt generating capacity. (Another and a willingness of both business and peo- Here in Saskatchewan, some big industrial with the NDP, social democratic 387 megawatts is in the works in ple to co-operate. users do have guarantee supply contracts to philosophy. That was cemented the Herbert-Riverhurst-Assiniboia What really bogged down Texas, even prevent damages to their businesses, but in the 1980s when the NDP fought area with 300 more megawatts in after the power went back on, is utility de- even they can have their power cut to ensure tooth and nail to stop their privat- the planning.) regulation in that state that’s created a bit electricity first flows to homes and hospitals. izations. Contrary to the notion held by of a free-for-all for that now sees Texas con- Are we perfect? Hardly. And our electrical But ultimately why we still own some that wind turbines don’t work sumers buy their power from the cheapest costs are high. Crown utilities like SaskPower in cold Saskatchewan winters, they private source and sees little in the way of But maybe what we saw in Texas is reason comes down to our recognition that continue to spin here in tempera- a backup plant for catastrophic events like to question whether it’s smart to be handing we do need a stable, reliable and af- tures as low as -30 C (windchill this snowstorm. rebate cheques back to consumers as the fordable power supply for all. being a non-factor, because wind is Unlike SaskPower that stops energy ex- Saskatchewan Party promised last election A snowstorm 1,400 miles to the the turbine’s friend). In fact, wind ports in times of shortages and also has rather than pumping that money back into south of us in Texas now serves as turbines here pump out more en- agreements and means to quickly purchase SaskPower’s aging infrastructure. a reminder of that. ergy in the colder months. power from neighbours in a crisis, there is As Texas proved, electricity costs you The -20C temperatures Texans But besides being prepared for little central planning in deregulated Texas. dearly when you don’t have it. faced a couple weeks ago wreaked cold, Saskatchewan is more accept- So even after power was restored, some

SUBSCRIPTION RATES: All subscription expire Dec. 31. Pick-Up Boxes: Prices shown are based on one full year. $37.80 per year Subsciptions will be pro-rated. Mailed in Saskatchewan: Melville Advance, Whitewood Grenfell Herald Sun, Fort Qu’Appelle Times Chris Ashfi eld Tammy Oryschak Michelle Walz Lloyd Schmidt Pat Gattinger Prices include GST. Publisher Accounts Advertising Production Classifi eds $50.40 per year Issued Fridays by Grasslands News Group from the office Make cheques payable to Grasslands News Group at 218 - 3rd Ave. West, P.O. Box 1420 Melville, SK., S0A 2P0 Send e-transfers to [email protected] Mailed in Canada: Ph: 306-728-5448 • Fax 306-728-4004 • Whitewood: 306-735-2230 $70.00 per year

Toll Free: 1-844-GNG-NEWS Electronic Edition: www.grasslandsnews.ca • [email protected] $37.80 per year

Wendy Krobath Emily Fulford Elaine Ashfi eld Sarah Pacio Alan Hustak © Copyright (c) News and advertising content of this newspaper are protected by copyright. Offi ce Assistant Melville Whitewood Grenfell Fort Qu’Appelle 2020 There may be no reproduction of content without permission of the publisher. www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV February 26, 2021 7

*307(5+:(=,;/0:*644<50;@*(3,5+(9¶796<+3@)96<./;;6@6<)@

• Melville • Fort Qu’Appelle • Lipton Prairie Co-op Ltd. • Cupar • Strasbourg Ag. • Ituna • Kelliher Administration - 751 - 7th Ave. W., Melville, SK 1-306-728-5497 www.prairiecoop.com Fun things to do and keep active! MARCH 2021

Sunday Monday Tuesday Wednesday Th ursday Friday Saturday During this month we offer suggestions and 123456 a few event activities for you and your family to do. Some of the dates are actual observances, while others are just ideas you can use. 2 2 2 Feel free to add your own to the list. Have fun and enjoy March! 7 8 9 10 11 12 13 All Month 2 2 2

Melville Legion Chase the Ace - Fridays 14 15 16 17 18 19 20 Draw made at 6:15 p.m. 136 - 3rd Ave. W, Melville, SK 2 2 2 March 1 21 22 23 24 25 26 27 National Peanut Butter Lovers’ Day Smooth Peanut Butter is by far the most popular. Crunchy peanut butter 2 2 is also on the market, and is enjoyed by 28 29 30 31 many. Peanut Butter is not limited to a Peanut Butter and Jelly (PB&J) sand- wich. It’s popular on crackers, celery 2 2 and other “peanut butter” holders. It is also used in recipes for cookies and snacks. And, don’t forget peanut butter candies, too! corn in the traditional way, with March 23 (holidayinsights.com) salt and butter. Or, you can add National Chip and Dip Day anyone of a number of flavors Today is best celebrated in the evening with a bag of chips to it. Popcorn Lover’s Day is the and your favorite dip. Open your favourite bag and grab some March 3 perfect day to make a big bowl dip. (holidayinsights.com) Care Giver Appreciation Day of popcorn and cozy up to your This day of recognition is for both paid and unpaid care giv- cutie on the sofa, as you watch ers. We believe unpaid care givers, deserve even more special television this evening. (holidayinsights.com) March 25 recognition. They silently go about the task of supporting International Waffle Day someone in need, most often a family member. March 14 Waffle Day is a day that you can waffle on issues and deci- (holidayinsights.com) sions. And, it certainly is a day to get out the waffle iron and Daylight Saving Time eat waffles. (holidayinsights.com) Daylight Saving Time (DST) is the practice of moving the March 5 clocks forward one hour from Standard Time during the Employee Appreciation Day summer months, and changing them back again in the fall. March 28 Although daylight saving time is not done in Saskatchewan, it If the boss can get a Bosses Day, Palm Sunday does affect the rest of Canada. (www.almanac.com) then it’s only fair and appropriate Palm Sunday is begins that you, the employee, gets a day the Holy week leading to in your honor. Employee Apprecia- March 17 Easter and the resurrection tion Day honors employees every- of Jesus Christ from the where. (holidayinsights.com) Saint Patrick’s Day dead. It commemorates Saint Patrick’s day is in honor of Jesus’ triumphant entry into the Patron Saint of Ireland, who Jerusalem where people put March 7 brought Christianity to the Emerald Isles, as Ireland is known. palms down in front of his National Crown Roast of Pork Day It is truly a day of celebrating Irish history, ancestry, traditions path. This is National Crown Roast of Pork Day, a special day to and customs. Saint Patrick’s’ Day has many symbols and tra- (holidayinsights.com) cook and eat pork. To participate in this day it must be crown ditions, from shamrocks and leprechauns, to green beer and roast pork. Any other just will not do. (holidayinsights.com) Corned Beef and Cabbage. (holidayinsights.com) March 30 Take a Walk in the Park Day March 8 March 20 A walk in the park will likely be the most enjoyable part of International (Working) Women’s Day Spring Vernal Equinox your day. However, make sure to do so with a clear mind and International Women’s Day is a The Spring Vernal Equinox brings days and nights in equal with your eyes open. In addition to avoiding a fall, open eyes celebration goes back to the late proportions. It is simply the day when there is exactly 12 will allow you to take in the beauty of nature’s wonders: flow- 1800’s and early 1900s. It grew hours of daylight and 12 hours of nighttime. ers, and trees, birds, and wildlife – if you want have another from women’s socialist move- (holidayinsights.com) person join you! (holidayinsights.com) ments and early women’s trade union groups. The first International Women’s Day was held March 19, 1911. The event grew from there, and has been celebrated RE-OPENED annually since. The focus is upon women workers, and ad- Melville Community Works TO THE PUBLIC! vancing women’s rights in the workforce, politics and society. • Thrift Shop open - Tuesday and Thursday 12 - 4 p.m. (holidayinsights.com) • Gift Shop open - Tuesday and Thursday 1 - 3 p.m. • Kidsville opening to be determined • Canadian Mental Health Association - Melville Branch March 11 - Meeting 1st Wednesday of every month 7 p.m. Popcorn Lover’s Day • Magic Moments Playschool is currently full and accepting names for www.prairiecoop.com Many of us love popcorn and is good for you, when eaten the 2020 - 2021 school year wait list. Please contact Chantel Fahlman www.facebook.com/prairiecoopretail for more info at 306-730-6272 or via Facebook messenger. plain. It is not as healthy, when it’s loaded with salt and butter. Sponsored by Prairie Co-op But, all that butter and salt tastes so good. You can have pop- 8 February 26, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Saskatchewan pharmacists ready to help immunize Sask. Health Authority prepares for start of Phase 2

By Emily Jane Fulford of COVID-19.” While this signifies light at the end of the tunnel, as Grasslands News The province aims to have community pharmacies vaccine availability grows ever closer, it is strongly stocked and ready to go for Phase 2 of the provincial recommended not to tempt irony. Mask regulations immunization plan. The hope is that it will signifi- and limits on public gatherings are still in effect to The Saskatchewan Health Authority (SHA) an- cantly increase public access to the vaccine, thereby ensure that no matter how close the finish line, more nounced Monday, Feb. 22 that 81 per cent of residents improving the rate of vaccination. of the population makes it there. in long-term care homes throughout the province had “We appreciate that Saskatchewan pharmacists are officially received their first doses of the COVID-19 ready to step up and deliver the COVID-19 vaccine,” vaccine. On top of that, more than half that number Health Minister Paul Merriman said. “The Govern- had also received their second dose and were fully vac- ment of Saskatchewan is working hard to make sure cinated as of this week. COVID-19 vaccine is safely delivered into the arms of Government officials also announced this week that Saskatchewan residents through all possible avenues.” pharmacists across the province are ready and willing Of course, administering a shot is nothing new to to step up to the plate when it comes to the delivery of pharmacists, so don’t worry, they know their stuff. the largest mass vaccination campaign in the nation’s Many pharmacies provide annual flu vaccines to the history. Pharmacists in many community pharmacies majority of populations throughout the winter months; including Melville’s Pharmasave location which has a the only difference with COVID-19 is the name on the website with up-to-date information on COVID-19 in- bottle. cluding a placeholder for when the vaccine has been Mayor’s Corner “We are proud to join other health care profes- delivered there for distribution. sionals in providing safe, timely access to COVID-19 “Our health care workers are doing an excellent “Working Together... to Grow Melville vaccinations for Saskatchewan residents,” Pharmacy job of administering vaccines quickly, safely, and ef- Association of Saskatchewan Board Chair George Fur- The most recent cold snap, ficiently in long-term care facilities across the prov- neaux said. running a full ten days or so, cer- ince,” Health Minister Paul Merriman said. “The only For a listing of first and second doses in Saskatche- tainly brought the balmy winter thing slowing them down is the shortage of vaccines wan administered by geographic zone, visit www.sas- weather we so comfortably experi- from the federal government.” katchewan.ca/covid19-vaccine-update . enced to an abrupt end. Little rest There were 920 COVID-19 vaccine doses adminis- The SHA would like to remind residents that at the was experienced by our faithful tered in Saskatchewan on Feb. 21 which brought the moment the province is still in Phase 1 of vaccine de- furnaces and fortunately the water total in the province to 61,730; a substantial jump with livery which includes residents and staff of long-term taps continued to flow. over 10 thousand vaccinations taking place during the and personal-care homes, identified health care pro- Strangely, in just a few short previous week. Officials believe that availability for viders, residents 70 years and older and residents aged weeks, we will have been exposed the public in future phases through local pharmacies 50 and older in remote/Northern Saskatchewan. As to the dreaded COVID-19 for one will speed up the process even more. each Phase progresses, registration for appointments full year. Is it over? And if not, “When we get enough doses, we will be able to STREELASKY will become available. Citizens are urged not to use when might it be over? We pa- quickly finish vaccinating all the residents and staff the 811 HealthLine to register for vaccinations before tiently wait, practice all the necessary precau- in our long-term care homes. We look forward to hav- their Phase has begun. tions, and suffer the agony of no or very limited ing our seniors in long-term care fully vaccinated as Daily counts have also dropped below the 200’s in social connections. No family get togethers… no soon as possible so they are protected from the threat new cases; a significant improvement since the fall. large gatherings… very restricted hospital-care facilities visitation… abbreviated funeral fare- wells. Our sense of regularity-normalcy continues to be challenged. Grenfell approves $139,452 for road paving The Covered Population Report issued on June 30, 2020 recognized growth in our city population from 2019 to 2020. This is always encouraging By Sarah Pacio fundraiser has encountered a problem due to the un- news. This year 2021, Canada will be conducting Grasslands News foreseen closure of Linmark Publishing. Council had a nation-wide CENSUS. This is a very important previously paid for a calendar and agreed to donate population survey as much information is pro- the fee to the Band Parents rather than asking for a Grenfell town council held its regular meeting in vided which serves to benefit Melville. So many refund. the Lilac Room at 7 pm on Wednesday, Feb. 17. Mayor provincial and federal grants are based on actual As directed by council at a previous meeting, Di- Rod Wolfe participated via teleconference and Coun. census numbers. Our city, along with Census rector of Recreation and Culture, Andrea Nicholl has Corinne Steininger chaired the meeting. Canada, will attempt to provide as much infor- During councilor reports, several members noted started planning for Canada Day celebrations. She sub- mation as possible to our citizens so as to enable the value of participating in the Municipalities of Sas- mitted road closure requests for a street hockey tour- Melville residents to be active participants in the katchewan (formerly SUMA) annual convention the nament at Lake Street on June 30, and for a parade process. previous week. Councillors missed networking with through town on July 1. Both requests were approved. Lately, the result of a doctor shortage, our hos- other communities but appreciated the opportunity to Council authorized administration to begin ini- pital has been subjected to limited or suspended strengthen relationships within their own group. tial paperwork for local improvements, namely to emergency services. Hopefully, with the arrival Councillor Les McGhie shared a summary of the pave three sections of gravel road in the residential of Dr. Chattha, this unfortunate situation can be Grenfell Museum Association’s annual meeting held area on the northwest side of town. The designated overcome. We welcome Dr. Chattha to our com- earlier that day. She said that volunteers are needed to sections are Lake Street, from Assiniboia Avenue to munity. assist the aging board by filling roles on executive and the airstrip, at a cost of $34,711; Assiniboia Avenue, Did you know that the 1909 Melville Sports other committees. McGhie also told council that the from Alice Street to Lake Street, $70,030; Alice Street, Day located at the Third Avenue area attracted museum needs someone to be on call for security pur- from Athabaska Avenue to the north property line, hundreds of people with ladies in long gowns and poses. Councillors Patty Cole and Corinne Steininger $34,711. The total expense is estimated at $139,452 and men in top hats? said they and their husbands would help meet this residents will be expected to cover some of the cost, Walter Streelasky, Mayor of Melville need. based on their property frontage, since the road has Finance officer Lynn Hewitt submitted her resigna- never been paved. tion, explaining that she has accepted a position with a Before going in camera to discuss confidential mat- Rural Municipality. The town has posted an ad for the ters, a new Fees and Charges Bylaw was presented for ADVERTISING DEADLINE vacancy on its website and other appropriate outlets. its first reading. Council will review the bylaw and Council reviewed a letter from the Grenfell Band submit any necessary changes to the administrator so Tuesdays 12 noon – 306-728-5448 Parents Association explaining that its calendar it can be approved at a future meeting.

DISTRICT BUSINESS

DIRECTORY LOCATED ON THE CORNER OF FIFTH & MAIN, MELVILLE CHECK OUT OUR NEW WEBSITE! Expert Service from “Treating Your Family Like You Are A Part Of Ours” www.fi reworksinsaskatchewan.ca Trusted Professionals 306.728.5488 Custom Shows • Large Assortment Raymond and Crystal Bailey 306.748.0070 or 306.794.4991 &99;!8ধ2+!;‚ˆ‡c132;, Don Klus, Ron Wilson Marlene Muzyka and Len Varga [email protected] '1!-£V!&9|+8!99£!2&92'>9W$! www.baileysfuneralhome.com Grayson, SK

• Deli Meats Stop In and See Us at Stockholm Agencies Ltd. • Jerky 113 Ohlen St., P.O. Box 322, Stockholm, Sask. •Barbecue Needs Tel.: 306.793.2900 Fax: 306.793.2959 Neudorf Email: [email protected] • Liquor Vendor  



 



  



 
Spirits &Wines • Personal Insurance • Farm Insurance • Full Service Gas Pumps













 



 




• Diesel Dye Pumps • Commercial Insurance • Hail Insurance  
 



 
 
  
• Tire Repair & Tires • Full Line of Hardware Grayson, SK • Health Insurance • Motor Licence Issuer & Automotive Supplies



 

 
'%"


&""

• Notary Public Phone: 306 794-2113 • Minor Automotive Repairs • Feed



 
(""


&""

• Bulk Petroleum
 

 

Business Hours: Business Hours: Tues. - Sat. Tuesday to Friday: 9:00 a.m.-12:00 noon & 1:00 to 5:00 p.m. Open Monday - Saturday (Closed Sunday)
%"&%%%$#$$
Saturday: 9:00 a.m. -12:00 noon Sunday & Monday - CLOSED 8:30 a.m. - 5:30 p.m. Closed Noon Phone 306-748-2474  



  




www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV February 26, 2021 9 Gene Hauta Department responds to 15 MVC’s It’s A Strange World Whitewood Fire and Rescue 2020 Report When Fort Myers (Fla.) police released security photos after a bank robbery, Barbara Robilotta noticed that the robber had very, very large By Elaine Ashfield hr. A MVC is a minimum one hour and hands. In fact, they were described as “Popeye Grasslands News pro-rated per minute after. Fire is pro- hands.” Robilotta told police the robber might be rated at $16.033 per minute. her boyfriend, Glenn Aiken, 36, who shortly after “These prices include equipment the robbery paid a $960 bill at a tire shop in cash. Motor vehicle collisions (MVC) The serial numbers were matched to the stolen and manpower. Any extra equipment continue to outnumber other calls for currency. Aiken was arrested, and told police Ro- the Whitewood Fire and Rescue De- not held by the fire department may bilotta had no idea he was going to rob a bank to partment was the report made to the have extra charges. Any extinguishing pay her bill. Whitewood Town Council at the Feb. foams will be charged on top of this,” In Oregon, two would-be thieves probably 16 meeting by committee representative Waynert’s report continued. thought they had the perfect plan. One would Coun. Brian Waynert. Upgrades were made to the fire hall run into the local Kohl’s, grab whatever he could The Provincial Emergency Call Cen- in the 2020 year with new LED lights carry, and run back out to the parking lot, where tre dispatched the services to 15 MVCs installed, removal of the rug in the the second guy would be waiting with the getaway in 2020. There were 54 total dispatches meeting room and a new sign was in- car. There was only one weakness in their plan… made in the year with calls for alarms a dying car battery! Police found the getaway stalled on the building. A fence on the showing 17 but a lot of these calls were confirmed to car with the hood up. Raymond Stavig and Derek be false before firemen left the hall or were enroute. north side of the hall for the UTV trailer was starter Shurts were trying to get a jump start from by- Fire calls accounted for 10 calls and five assists were and will be completed this year. standers. Stavig tried to convince made for STARS landings by the department. Firemen For the firefighters, a new SCBA tank filling and deputies that the items in the also assisted EMS on four calls and responded to three compressor system was installed to allow for filling car all belonged to his wife. CO2 calls. their high pressure SCBA bottles. Two sets of XXL Oh, yes, the getaway car itself “Of the calls that were made, 15 were for White- bunker gear were purchased for individuals that were had been stolen. Stavig was wood, three for the intersection of Highways #1 and using out-dated gear. arrested on charges of theft, #9, 16 in the RM of Willowdale, six in the RM of Silver- A water tank was purchased to install on the flat identity theft, possession of meth, and had a warrant for wood, 13 to Ochapowace First Nation and one for the deck truck donated by Loraas Disposal last year. The ID theft. Shurts, meanwhile, RM of Rocanville,” Waynert added. tank, fittings and purchase of a pump for the flat deck Whitewood Fire and Rescue have 20 firefighters, in- was arrested for theft, pos- water hauler will be another 2021 project. cluding two junior firefighters. There are always addi- session of a forged instru- The Saskatchewan Government supplied PPE sup- tions and deletions with members leaving and moving ment, and a warrant for away. plies for the fire department due to COVID-19. “The heroin possession. Training continues at regular meeting nights and members did a great job upholding strict social dis- While I am definitely the department also racked up 365 man hours of train- tancing and mandatory mask wearing in the halls, aging myself, but I have not seen many positives ing besides meeting nights. trucks, on scene and during training sessions,” in TikTok videos. A Louisiana woman ended up Fire and rescue rates are the SGI rates of $962 per Waynert stated. in emergency room after giving herself a perma- nent hairstyle by using a powerful spray adhesive, Gorilla Glue Spray, instead of her normal “hair glue”. Tessica Brown, 40, tried to remove the glue Police search for suspicious white van in several different ways but ended up seeking medical attention. In fact, she tied up ER person- nel for 16 hours. Now, go figure, she is contem- Sabrina Bailey When police arrived the in a theft. A police dog the vehicle. Members plating suing the company because the Gorilla Fort Qu’Appelle Detachment registered owner was was brought in to locate made extensive patrols Glue label only warns not to get the adhesive in climbing into their vehi- the driver but attempts but could not locate the eyes, on skin or on clothing, and doesn’t specifi- cally mention hair. Reporting period: cle. It was in fact never were unsuccessful. van; neighbouring de- My friend Joe went on the Dolly Parton diet. Feb. 16 to Feb. 22 stolen, simply parked be- An attempted break-in tachments were asked to hind a larger truck. is still being investigated. be on the look out. It really made Joe lean, Joe lean, Joe lean. Traffic Four reports of fraud The culprit knew the oc- A call of two males One person is dead and three injured after a Police received three were received this week, cupant’s name however fighting had police attend frozen waterfall collapsed during a tour in east- reports of deer collisions all different schemes but the complainant does not the scene. Members lo- ern Russia. The peninsula in Kamchatka Territory is home to the Vilyuchinsky volcano, a magnet for this week; one vehicle impossible to trace. All know who could be in- cated a male and female tourists to one of Russia’s most beautiful regions. was not longer driveable victims were instructed volved. holding down a 37-year- The 40-metre waterfall is formed from the melting as a result. on how to proceed. old male. All parties were Mischief glacier. In winter, the water freezes and creates a Police received a call Police are still investi- heavily intoxicated and of a suspicious vehicle Police received a com- giant icicle, which is a tourist draw. gating holes in a window plaint of a white van fol- arrested for mischief. The An online retailer advertised on Facebook on Hwy. 10. Members at- that may have been cre- matter is still under in- tended to find the vehicle lowing our caller. The that they would be “dropping $100,000 in value ated by a pellet gun. caller took side streets vestigation; early reports ran out of gas; grandpar- from the sky” at a public square in Auckland, Members attended to and stopped at a gas sta- suggest it was a consen- ents attended with fuel New Zealand. People were urged to show up in an abandoned vehicle in tion. When the caller left sual fight and the 37-year- and members lent battery person to grab their share at the appointed time. a field. The vehicle fled the vehicle started follow- old male may have been cables to self-boost. Even though most people should have anticipated from police earlier that ing again. The caller took held down to prevent him A complaint of a a stampede of chaotic reaction, people “flocked” day after being involved some more turns and lost from driving impaired. driver tailgating, pass- to the event. As $5 bills started falling, multiple people were injured. Then it got worse when it ing closely, making rude was determined they were simply fake bills. The gestures, and speeding outraged crowd turned violent. So, what busi- was received. The com- ness was foolish enough to stage this stupid stunt, plainant provided police Automotive and Service asked Randy Cassingham. Well, try the Safety with dash cam video. The Warehouse, which sells PPE gear! driver was given a warn- Employees of Denver’s Parks and Recreation ing. Directory district made a grisly find: a suitcase along a A complaint of a speed- road with a foot sticking out. There were more ing vehicle all over the body parts inside, and a second suitcase nearby road was received. The OW TOWING SERVICES held the rest. The murdered man was identified as vehicle was located and 24 Hour Service Joshua Lockard, 33, and Benjamin Satterthwaite, driver tested for intoxica- 28, was quickly arrested and charged with first tion; the sober driver was Cell: 306-331-8833 degree murder. The police quickly connected the issued a warning for their :UHFNPDVWHU&HUWLÀHG suitcases to Satterthwaite, because one of the bags driving. 6*,6WRUDJH&RPSRXQG Ervin Wolfe still had a baggage tag on it from a recent flight. Tickets issued for: )UHH8QZDQWHG&DU5HPRYDO The detective is coincidentally assigned to another Product Advisor speeding, speeding passed /RFNRXWVERRVWLQJDQGZLQFKLQJ death, of a woman who had apparently overdosed, stopped emergency vehi- [email protected] who was found lying next to an unconscious man cle while lights activated, Cell 306-533-5945 three days after the suitcases were found. That drive while disqualified, man was Satterthwaite, and the detective had drive unaccompanied 306-331-8833 655 Broad Street, Regina, Sask noticed significant amounts of blood in the apart- with learner’s permit, 1-800-667-9976 – taylorautogroup.ca ment. and fail to stop at railway In a scenario reminiscent of the 2004 Tom crossing. Hanks film “The Terminal,” a man who feared the Crimes Against the Wholesale Transmission coronavirus found himself living in an airport SHANNON for three months instead of flying home. Aditya Person/Property & Differential Singh, 36, was arrested inside Chicago’s O’Hare In- Police received three Wholesale Prices ternational Airport after being found with an iden- ,PSRUWV 'RPHVWLFV2YHUKDXOV)UHH5RDG7HVWV complaints of uttering TRANSPORT tification that allegedly belonged to an operations All Makes & Models Rebuilt in Our Own Shop threats. One matter is manager who reported it missing last year. Singh + Differential +CVA Joints + Clutches + arrived on a flight from LA on Oct. 19, 2020, and still under investiga- + Universal Joints + Drive Shafts + 4X4 Transfer Cases + tion; the subjects of com- #1 in the bin, since 1982 survived in the airport for at least three months. plaint in the other two ´7KH3ULFH:H4XRWH··LVWKH3ULFH

MILLER MOAR GRODECKI RSP top-up, TFSAs or an extra KREKLEWICH & CHORNEY mortgage payment? Chartered Professional Accountants :KDW·VWKHEHVWFKRLFH",FDQKHOS\RXPDNHWKHULJKWGHFLVLRQ IRU\RXUÀQDQFLDOVLWXDWLRQ &RQWDFWPHWRÀQGRXWKRZVPDUWDGYLFHDQG  !81T'8932!£{38638!;'!?8'6!8!ধ32{£!22-2+ DSHUVRQDOL]HGSODQFDQKHOS $$3<2ধ2+{<&-ধ2+'8=-$'9f -2!2$-!£;!;'1'2;8'6!8!ধ32 3300''6-2+{!@83££'8=-$'9

MELVILLE ESTERHAZY GRENFELL WHITEWOOD ˆŒŒҺŠ    ‹‰‡Һ   ˆ¤Һ   ‡Һ   Š‡¤Һ‰¥Һ‹Œ‰Œ Š‡¤Һ‹ŒҺ¤¤ˆˆ Š‡¤Һ¤ŽҺŠŒŒ¥ Š‡¤ҺŠŒҺ‰Š¥Œ PATTY WELCH, CFP & RRC FINANCIAL CONSULTANT       Һ Z   Phone: (306) 728-4998   Һ  WK$YH(DVW0HOYLOOH(back door entrance) [email protected]

www.millerandco.ca Œ7UDGHPDUNVRZQHGE\,*0)LQDQFLDO,QFDQGOLFHQVHGWRLWVVXEVLGLDU\FRUSRUDWLRQV 3 smart things to do with your tax refund

dream vacation after the pandemic, it’s tions, can help you reach your goals important to develop a savings plan to faster. reach your objectives. The Financial Consumer Agency Identifying your goals and under- of Canada provides unbiased and fact- standing how much money you need to based information you can count on. achieve them can help you decide how You can learn more about making a to allocate extra money. Putting your plan to be debt-free, creating an emer- tax refund towards them while continu- gency fund or setting savings goals at ing to make regular, smaller contribu- canada.ca/money. Working to make ends meet? The Canada workers benefi t can help This year, many of us are fi nding it same, you can receive up to half of your more diffi cult to make ends meet, par- benefi t in advance payments instead of ticularly as the pandemic continues . If Tax season is here, and many of us to pay off your smallest debt fi rst to waiting for tax time. you’re finding it a struggle to pay will be getting some money back. Per- achieve a “quick win” that motivates So, how do you get the benefit? for basic necessities, receiving govern- haps one of the most important fi ndings you to keep going. You simply need to do your taxes. It’s ment credits and benefi ts can make a the only way that the Canada Revenue from new Financial Consumer Agency Create or add to your emergency fund big difference in your life. of Canada research is that by doing Agency can assess your income and el- An emergency fund can help you pre- The Canada workers benefi t was de- small things today, you can signifi cantly igibility. pare for future situations that are out signed to put more money in the hands When completing your income tax improve your long-term fi nancial situa- of working individuals and families who of your control, like an unexpected job and benefi t return, follow the instruc- tion, regardless of your income. earn a low income. The amount you loss, healthcare costs or car repairs. tions on how to claim the benefi t in Here are three small steps you can While reaching your emergency sav- can expect to receive depends on your your NETFILE-certifi ed tax software. If take with your refund in 2021. ing goals may seem overwhelming, start income and the province or territory you fi le a paper return, fi ll out Schedule Pay off your debt small. It’s a good idea to save gradually where you live. Individuals in most provinces and 6 in your income tax package. Use your tax refund to help pay off and supplement your emergency fund territories can get up to $1,381 and You can apply for advance payments your debts. There are different strat- with extra money when you receive it. A tax refund is a great way to add to it. families up to $2,379. This extra money through the agency’s My Account por- egies for paying down debt. The most could be used to help with rent, child- tal or by mailing in the advance pay- common is to pay off debts with high in- Save for short-term or long-term goals care or paying your bills. And there’s no ments form. terest rates fi rst, in order to pay less in- Whether you’re saving for a down catch – if you’re eligible, you just need Every dollar counts. Find out if you terest in the long run and become debt payment on a house, adding to your to claim it on your taxes. qualify at canada.ca/workers-bene- free sooner. But you could also choose retirement savings or planning for a If you think your income will stay the fi t-canada. Get your refund instantly. Walk in with your taxes and walk out with your refund.

For more info, contact: 148 3rd Ave E, Melville SK S0A2P0 (306)728-4358 hrblock.ca

At participating offices. H&R Block Instant Refund™ valid only on the federal portion of tax returns filed in Quebec. Some restrictions apply. Not everyone gets a refund. Not everyone is eligible for H&R Block Instant Refund™. www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV February 26, 2021 11

Construction and Renovation Feature Popular window styles and where to use them

Do you want to update the win- fi nishes. They open horizontally outward from the home and are dows in your home? If so, here are rather than vertically, which makes traditionally composed of a picture some popular types and where they them ideal for spaces with horizon- win dow fl anked by one or more might look best. tal features. For example, they look pairs of double-hung or casement Double-hung windows fea- good over a counter or in a hall- windows. Place them anywhere ture two large sashes that slide up way. Since slider windows are easy that overlooks a view or in a living and down along vertical tracks. to open and close, they’re also prac- room, family room or bedroom that They perfectly complement ram- tical in hard-to-reach spaces. needs a focal point. bler, farmhouse, bungalow and Casement windows open in- The best windows for your home other modern-traditional style ward or outward with a mechan- will depend on your budget and homes. They have many custom- ical crank. They’re well suited to style. In all cases, however, it’s ization options and look good in contemporary homes and great in best to make sure they’re energy almost any room. rooms where you want to let in a efficient (look for the Energy Star Slider windows are available cool breeze. label) and installed by an experi- in a variety of styles, materials and Bay and bow windows extend enced contractor. Should you invest in a sump pump?

PVC WINDOWS, DOORS & BLINDS Can be used for the Sask. 31''23=!ধ32!?8'&-;R A sump pump is a device that can with an alarm that alerts you if the be installed in a basement, either be- water in the basin reaches a dangerous neath or above the fl oor. It’s designed level. to pump out water collected in a sump In addition, you may want to in- basin and discharge it to the outdoors. stall a secondary sump pump next to Consequently, your home is kept safe the fi rst one, especially if you have a from the damage that can occur as a fi nished basement. This way, if your result of fl ooding. primary pump fails or becomes over- If your basement is at risk of fl ood- taxed, the secondary pump will auto- ing, you should consider buying a matically take over. sump pump, especially if you live A battery backup pump can also be somewhere with a high water table. If installed. In the event of a power out- possible, select a submersible rather age, this type of pump will continue to than a pedestal pump, as they’re less work for up to noisy when covered with a lid. You two days. should also opt for a model with an To install a sump pump in your iron core since it’s more durable home, speak with a qualifi ed plumber than the plastic alternative. Plus, you in your area. should think about getting a pump

'1!0'>-2&3>9,366-2+'!9@WWW '1!2<(!$;<8' '-29;!££ '>!88!2;@ Һ     !££3>(38!   9ধ1!;' 712 Lalonde Street, Whitwood, SK – 306-735-4328 '£=-££'TŠ‡¤‰¥f‰‰ˆˆ OR 515 Main Street, Kipling, SK – 306-736-5328 www.centuryglassltd.com íđŜĻŞɳǚíƤœíŞđƎœƫŜĉĻŞİȤĊí email: [email protected] 12 February 26, 2021 )RUW4X·$SSHOOH7LPHV Grasslands News

Sask. sunrise As days get longer and milder tempera- tures return, the morning skies across Saskatchewan have become a canvas of colour on most morn- ings as the sunrise produces a vast array of pinks, purples and orange colours. This photo shows an abandoned farm yard and trees with the ris- ing sun behind it.

&+5,6$6+),(/'_*5$66/$1'61(:6

site. If the Agreement is extended it is ing that he cannot overstate how im- QVCA wants agreement renewed with Town the QVCA that will continue to be re- portant Qu’Appelle Valley Centre for sponsible for the ongoing financial and the Arts is to him and the many tour- - continued from front page administrative obligations.” ing musicians who play there every In hopes of resolving the dispute meet our obligations under the original In hopes of trying to ensure the sur- year. over the agreement, a delegation from agreement – paying the electrical and vival of the Centre of the Arts, artists “Other than being blowin’ away by the QVCA is attending the Feb. 25 town natural gas utility bills, renewing our and community members have written the absolute beauty of this valley and council meeting where they will ask for insurance policy, paying for cleaning letters of support for the QVCA where the main street and the people, Fort the Town to extend the original letter and ongoing upkeep, and volunteering they emphasized the importance of Qu’appelle Valley is an important link of agreement for another six years as to administer the activities and events such a facility in the community. in the fabric of this country we call well as recommend creating a Town- that are allowed with the public health “The Fort is a unique and unusual Canada or Turtle Island. Without this QVCA joint working group (consisting protocols. We thankfully established a town in that it has never had a town patchwork quilt of communities that ex- of the mayor and two elected officials Contingency Fund that will help us get hall where community can gather to tend from sea to sea to sea there would and three from QVCA) that would ad- through the low-to-no-income period celebrate be it the arts, family occa- be no culture and I really think no Can- dress any possible outstanding issues of the pandemic,” said Baggett. “The sions, holidays, offer dance, pottery, ada. A beautiful place like this needs and to discuss areas of possible mutu- Town is taking no financial risks, at yoga classes etc. These gatherings are to be celebrated by touring musicians ally agreeable improvements. all, by honouring the existing Letter of what make a town and establish a sense and others. I speak about it whenever “In good faith we have continued to Agreement. In fact, it is just the oppo- of community. Due to the foresight, I tour, as someplace very special,” said endless volunteer hours and support of Eastmure. “We must all pull together the Town, we now have such a center. to retain what is most valuable in our Unless the Town budget can accommo- communities; people, jobs, family, the Telemiracle kicks off Feb. 27 date the building of a million plus new land, and culture last but certainly not structure, and until that structure is in least. I strongly and humbly urge the place, I as a taxpayer, support honour- Town Council and Mayor Lagace “to TeleMiracle Week in Saskatchewan 44 years and this year, we need their ing the original agreement with QVCA. enter into the right to renew a similar kicked off on Feb. 17 and will culminate support more than ever,” TeleMiracle 45 A town without a cultural center is a agreement” that was stated in the cur- this Saturday, Feb. 27 when the 45th edi- Chair Brian Angstadt said. “Thanks to town without character or a soul,” said rent agreement. This will provide se- tion of the annual telethon kicks off. our donors, TeleMiracle will continue to Sharron Labatt. curity for the future and decades more “TeleMiracle is a distinctly Saskatch- touch the lives of people in every cor- Singer/songwriter Pete Eastmure of community arts and connection to ewan event, reflecting the kindness and ner of the province. We are grateful for also provided a letter of support, stat- all parts of Canada.” generosity of our province’s people,” the honour of having TeleMiracle Week Don McMorris, Minister Responsible declared in Saskatchewan, which helps for the Provincial Capital Commission raise awareness in advance of this im- said. “With a population of nearly 1.2 portant telethon.” million people, we can all be proud that TeleMiracle 45 will take place at Prai- more than $140 million has been raised rieland Park in Saskatoon without an since 1977. I urge everyone to support in-studio audience. The hosts will be on this extraordinary fundraiser by tuning stage live but, for safety reasons, the ma- into the telethon and encouraging your jority of the musical entertainment and family, friends and neighbours to ‘ring donor presentations will be pre-taped or those phones’ with donations to Tele- linked live from other locations. The Miracle 45, helping people right here in pre-show, Countdown to TeleMiracle, our province.” will be live-streamed on www.telemira- TeleMiracle is organized annually by cle.com beginning at 6:15 p.m. Saturday the Kinsmen, Kinettes and Kin Clubs of night. At 9 p.m. the 20-hour television Saskatchewan with the proceeds going broadcast gets underway on Saskatche- to the Kinsmen Foundation, which pro- wan’s CTV stations. The telethon will vides specialized mobility and medical continue to air around the clock until 5 equipment to people and organizations p.m. on Sunday, February 28. throughout the province, as well as While the annual event has been oc- travel assistance for residents in need curring in Saskatchewan for 45 years, of medical treatment outside their com- the week was first officially recognized munity. Last year’s telethon raised in legislation in 2006 with The Recogni- $5,523,472. tion of TeleMiracle Week Act. “Saskatchewan people have given For more information, visit www.tel- generously to TeleMiracle for the past emiracle.com. 21012bs1 YOUR NEWSPAPER NEEDS YOU!

You rely on us to provide you with the news that matters most to you, and it’s our privilege to deliver it. In a sea of misinformation and fake news, we’re proud to offer you credible, verifi ed facts reported to you by our team of qualifi ed journalists.

However, in order to keep bringing you the coverage and stories you’ve come to count on, we need your help.

Subscribe for a full year now, and gain access to the news you need — anywhere, anytime — in our print or digital edition. SUBSCRIBE NOW! CONTACT US TODAY! Subscribe for a full year to gain unlimited access to our print or digital edition $3780 for pick-up or online subscriptions. 1-844-GNG-NEWS (ext. 227) | [email protected] Call for prices on mailed subscriptions. www.grasslandsnews.ca )RUW4X·$SSHOOH7LPHV February 26, 2021 13

Construction and Renovation Feature Kitchen trends of 2021

If you plan to remodel your kitchen Range hoods that are integrated this year, you should know that lac- into cabinets or walls are increasingly quered cabinets, exaggerated mod- po¬pular. You can also hide them be- ernism and large cabinet handles are hind tile or natural stone. However, passé. When it comes to kitchen de- make sure your range hood is posi- signs, here’s what’s trending in 2021. tioned for optimal ef¬fi ciency and easy to access for repair or replacement. Oversized pantries Whether free-standing or walk-in, Warm neutral tones large pantries with showcase-like shelv- Browns, beiges and greys are taking ing and plenty of hideaway storage are centre stage in 2021. Hardware should a hit in kitchens of all styles. If you also be warm. Choose matted gold, cop- have the space for it, this trend is for per, champagne and charcoal pieces for you. your drawers and cabinets as well as Storage walls your faucets and other fi xtures. If there’s limited room in your kitchen, fl oor-to-ceiling storage rather than multiple cabinets will maximize Natural materials the space to accommodate all your Wood, stone and other materials that evoke the natural world are the cooking essentials. Pro-tip: add electri- If there’s one trend not to ignore in your kitchen, be sure to buy decora- cal outlets inside the cabinets so you backbone of minimalist, contemporary, 2021, it’s the rising tendency to favour tive items, cabinets, hardware, tile and can plug in small appliances. rustic and garden-themed kitchens. Opt for understated matte fi nishes and locally crafted items and regionally stone from retailers and craftspeople in Hidden range hoods warm rather than cool tones. sourced materials. When renovating your community. Brief guide to home additions

Melville, SK 306-728-5433 Contact: Terry or Logan Rathgeber 1!-£V3ă$'|28$32$8';'W$31 '8ধ(-'&£!2; >>>W28$32$8';'W$31

Building an addition build and inspect. At is a great way to expand each stage, you’ll need your living space with- to rely on the expertise out moving. Here’s what of the right professional you should know about to ensure your addition this type of renovation is functional, safe and project. to-code. You’ll need an Types architect to design it, a contractor to build it One way to add space and an inspector to en- to your home is to build sure everything is just another storey. How- right. ever, if you have the square-footage, house Costs extensions can also be Building a home ex- lateral. Alternatively, an tension is a major ren- extension can be added ovation and will likely to the rear of your home. come with a hefty price What’s more, house tag. However, you can additions can be built on save on expenses by piers or a foundation. If carefully planning out you want to build a sun- your project and choos- room, carport or storage ing materials that are room, you’re better off modestly priced. Also, building the extension extensions built on piers on piers. How ever, if it’s are more affordable than a space that will be fre- those built on a founda- quently used, you may tion. want to put in a founda- The best way to get tion. started on an addition Steps is to reach out to an ar- chitect who can help you Adding an extension draw up the plans and can be broken down into get the necessary per- three basic steps: plan, mits for the project. 14 February 26, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News

Construction and Renovation Feature A look at 2021 bathroom trends

Marble bathrooms are timelessly elegant, and in 2021, inte- rior designers are increasingly using this type of stone. Here are some other trends to consider for your next bathroom re- model. • Gold fi xtures, faucets and mirrors are taking the spot- light. A matte or brushed fi nish is the way to go. • Natural elements like loose stones, wood cabinets and plants are lending bathrooms an organic feel. • Open showers are on trend, especially those with luxuri- ous features like an in tegrated bench, a misting system, ambi- ent lighting, an anti-fog mirror and a linear drain. • Island vanities that feature two sinks sitting back to back rather than side by side are a chic upgrade for a large bathroom. Lastly, technology is playing an increasingly important role in bathroom design. If you’re planning a remodel, you can ask your contractor to incorporate features like USB chargers in vanity dra wers, app-controlled speakers and smart sho wer heads that conserve water. What is grandmillennial style?

Grandmillennial style, also known ruffl es, pleats, fringe and scalloped as granny chic, offers a new take edges. Extravagant chandeliers and Krueger s on an old tradition. In opposition to ornate mirrors are also on theme. minimalist white spaces, this eclectic • Traditional collections. Un- Plumbing & Heating Ltd. style embraces patterns, ruffl es and earth that old collection of deco- heirloom furniture but juxtaposes rative china, antique fi gurines or them with abstract art and modern bohemian crystal and proudly dis- Œ‡Œ!$-)$;8'';f 8'2('££T!90W accents. play it. Get the look • Needlepoint pillows. Without a doubt, no grandmillennial bed room Raid your parents’ or grandpar- Commercial or living room would be complete ents’ basement or head to local fl ea without at least one of these. Bonus markets, thrift stores and furniture points if it’s inscribed with a sassy shops to stock up on the following: {'9-&'2ধ!£ saying. • Patterned everything. Cur- Keep in mind that the colour tains, rugs and furniture in classic scheme of grandmillennial style is prints like toile, fl oral and plaid are a 29;!££!ধ329 generally monochromatic or analo- must. gous. This allows the space to be lay- • Embellished items. Look for ac- ered yet still feel cohesive. & Service cessories, lamps and other decor with

Complete New Home £<1#-2+!2& '!ধ2+ Packages Available

• 2f £338 '!ধ2+@9;'19 • 38$'&f-8 '!ধ2+@9;'19 •'1!2&!;,'8 '!;'89 •-832&-ধ32-2+ •£<1#-2+{'>!+'@9;'19 •!;'88'!;1'2; Specializing in all your **FREE ESTIMATES**

ă$'VŠ‡¤f¤ŽfŠŒ‡‹ Һ   '££VŠ‡¤f¤Žf‰ˆŽ    Requirements!      ~Evan Penner~ Cell: 306.744.7676 Email: [email protected] '#9-;'V>>>W6'22'8-29<£!ধ2+W$! Bredenbury, SK www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV February 26, 2021 15

Construction and Renovation Feature Popular renovation trends for 2021 Home renovation trends are ev- showcases creative trends in design, ar- in 2021, and large windows naturally Renovations that can help homeowners er-changing. Renovations that might chitecture, art, technology, and fashion, brighten homes while making rooms transform rooms into multi-functional have been de rigueur 20 years ago may predicts that eco-friendly living solu- appear bigger, helping people feel less seem dated now. Recognizing the poten- tions fi gure to be hot commodities in cramped. That’s an especially benefi cial spaces fi gure to be hot commodities in tially popular trends of tomorrow is a 2021. Eco-friendly appliances, furniture characteristic when spending more time the years ahead. great way for homeowners to give their and designs can help to conserve energy indoors at home. homes a fresh new look and put them- and reduce waste, which environmen- • Minimalism: The anticipated popu- selves in position to capitalize on pop- talists and government agencies like the larity of minimalism in 2021 may also be ular trends when they put their homes Environmental Protection Agency note connected to the pandemic. As profes- on the market. That’s especially so after are two critical components in the fi ght sionals were forced to work from home 2020, a year when millions of people against climate change. and many families spent more time to- spent more time at home than ever be- • Large windows: Large windows gether inside their homes then ever be- fore. All that time working from home can provide stunning views of the out- fore, they may have recognized a need and relaxing at home gave millions of doors and allow ample natural light into to cut back on clutter, including extra Free estimates, 24 hour emergency service Danny Currie, Journeyman Electrician homeowners ideas about what they like a home. It may not be a coincidence if furniture. A minimalist approach is [email protected] about their homes and what they hope large windows prove to be a hot trend both simple and clean, which can make to change. The following are some ren- in 2021. The COVID-19 pandemic that homes feel less claustrophobic. 306-331-6588 ovation trends that various experts sus- dominated much of 2020 forced many • Multi-functional spaces: Home- echoelectric.ca Locally owned and operated serving fort qu’appelle and pect could emerge in 2021. people to spend considerably more time owners asked a lot of their homes in surrounding area call or email today! • Eco-friendly living: Climate at home. Darker homes without much 2020, as rooms were transformed into change, and how to combat it, was a natural light can adversely affect mood, multi-functional spaces seemingly over- hot button issue during the 2020 pres- especially when people are spending night. HGTV notes that spending more STILL OPEN FOR BUSINESS idential election in the United States. more time at home. HGTV predicts that time at home showed homeowners that We are still here to serve you, at a social distance of course! So it should come as no surprise that homeowners will seek ways to bring it may not make sense to dedicate entire urdesignmag.com, a web magazine that more natural light into their homes rooms of a home to a single purpose. RENOVATIONS & BOBCAT WORK • Concrete driveways, walks & garage pads installed • Paving stone driveways & walks installed • Paving stones releveled • Yard clean-up 3 questions to ask a contractor before you hire them Brian Gordon Fort Qu’Appelle, SK To hire the right contractor for What could cause costs to rise? so fi nd out which one is a home renovation project, you’ll Ask your contractor if there are offered. need to interview several candi- circumstances in which the cost of Lastly, it’s a good 1-306-530-4550 dates. In addition to fi nding out if your renovation might increase. Af- idea to ask your po- they’re licenced and insured, make terall, it’s best to be prepared. You tential contractor how sure you ask the following three should also be wary of contractors long they’ve been in questions. who hook clients with a lowball business for. Hiring a Who will be my point of con- price only to nail them with extra local company with tact? charges later on. a longstanding Sometimes the person you sign What type of warranty do you reputation for the contract with isn’t the person offer? excellence is a UG$YH:HVW0HOYLOOH6. who becomes your main point of Warranties vary from one con- good way to en-  contact during the project. To avoid tractor to the next, so you’ll need to sure you end up ž,'#8!2&9@3<023>W miscommunications that could lead ask each one what their warranty with the best ž,'9'8=-$'@3<;8<9;W to mistakes, it’s best to have one covers. Also, there’s a difference contractor for ž,'=!£<'@3<&'9'8='W person who you relay information between a warranty for the work your home reno- to. done and a warranty for materials, vation project. Mon., Tues., Wed. & Fri. 9:00 a.m. to 5:30 p.m. Thurs. 9:00 a.m. to 6:00 p.m., Sat. 9:00 a.m. to 3:00 p.m. Mr T’s Plumbing J&V ELECTRIC Pole Buildings and Heating Todd Th rossell Journeyman Plumber Jamie Sebastian Licensed Gas Fitter Owner/Journeyman 813 Desmond St., Box 2388, Fort Qu’Appelle, SK S0G 1S0 P.O. Box 296, TREE SERVICE Grenfell, SK [email protected] S0G 2B0 306-331-8742 - 306-331-8732 3062I¿FH Ph.: 1-306-697-2727 Fort Qu’Appelle, SK 306-331-8827 Cell Cell: 1-306-697-7749 [email protected] www.whitingtreeservice.ca Serving Fort Qu’Appelle and area for over 25 years

-LP·V5RRÀQJ “We specialize in all your building needs” +RW5RRÀQJ6KLQJOLQJ 197 Victoria Ave. We’re here to HELP! 6QRZ5HPRYDOIURP5RRIV Fort Qu’Appelle Your Success is Our Success. ‡7UDFNKRH‡'R]HU‡/RDGHU )5(((VWLPDWHV ‡*UDGHU‡6NLG6WHHU HOURS Your support makes our community ‡+\GUR‡9DF7UXFN‡%DFNKRH Mon. - Fri. 7 a.m. - 5 p.m. stronger by shopping locally! Jim Anderson ‡7UXFNV *UDYHO /RZ%R\  ‡6SHFLDOL]LQJLQEDVHPHQWVVHZHUDQGZDVWH Sat. - 8 a.m. - 4 p.m. Cell: 1-306-621-6372 ‡&RPPHUFLDO UHVLGHQWLDOIDUPVGXJRXWVHWF 1-306-332-2833 We take pride in servicing MLPVURRÀQJ#OLYHFD 306-740-7805 or 306-745-7226 and serving our community! Whitewood, SK Melville, Sk www.friestallman.com FlatLand Home - Kitchen - Bath Plumbing & Heating Whitewood, SK Everything for your home under one roof.

• HARDWOOD • CARPET • LAMINATE • LUXURY VINYL • TILE • AREA RUGS & MORE Whitewood, SK.

110 - 3rd Ave. W., Melville, SK | 306.725-5432 | 1.877.728.5432 Phone: 306-735-4328 carpet1melville.com 12 Livingstone St., Yorkton, SK | 306.782.6556 | 1.888.782.6556 carpet1yorkton.com [email protected] Photos for illustrative purposes only. ©2017 Carpet One Floor & Home. All Rights Reserved. 16 February 26, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News

Local content at Scotties Tournament of Hearts

By Alan Hustak Zacharias, Wildcard2 team. Erickson Grasslands News has enjoyed the tough competition. “It’s been amazing so far,” Erickson says, “We had two tough teams out of the The 2021 Scotties Tournament of gate but that’s honestly been the best Hearts is taking place this week in Cal- part. I’ve always dreamed about play- gary. There is plenty of local content at this year’s event including Chaelynn ing against these big name teams and to Kitz, Rachel Erickson and Val Sweeting. see us hold our own against them really Chaelynn Kitz is from Oxbow; her puts into perspective that we deserve to parents are from Langenburg and be here. We picked up our first W Sun- Churchbridge. She is the second on day night which was a huge confidence team Saskatchewan which is skipped boost for us. I was even put in to play by Scotties’ veteran Sherry Anderson. at the end so that was a special moment Kitz is a Scotties’ rookie and is taking in for me. Curling Canada has done a great the entire experience. She is learning a job making this experience as “normal” as it can be considering all that is going lot from skip Sherry Anderson. “Sherry CHRIS ASHFIELD | GRASSLANDS NEWS FILES is so awesome on and off the ice,” Kitz on in the world. We are definitely miss- Anderson at Scotties says, “She has so much experience and ing having all of our family, friends, and Sherry Anderson screams to her team to sweep while playing at the Viterra is willing to share it whenever she can. fans there with us, but we are just so Scotties that was held in Melville in January 2020. I feel fully confident in her ability and happy to be playing!” strategy. I can only hope to be as half as Val Sweeting of Maryfield has a long successful as her!” list of accomplishments in the sport, in- representing team Canada. “There are However, we are grateful for the chance Another local Scotties’ rookie is Ra- cluding being part of last year’s cham- many differences,” Sweeting says, “We to be wearing the maple leaf on the na- chel Erickson. Erickson is from Mary- pionship winning team with Kerri are missing our families and the fans tional stage.” field and is the alternate on Mackenzie Einarson. This year she is back and and the energy they bring to the arena. The Scotties wrap up on Sunday. Melville midget team to hold 60-year reunion

By Chris Ashfield sibility of a reunion in the late fall,” Grasslands News said Champagne. According to Champagne, mem- bers of the team who have been found The Melville Midget hockey champi- alive and well and residing through- onship team from 1960-61 are holding a out Canada include Bev Hicke, Kelly virtual 60th anniversary reunion next Exner, Ken Dietrich, Don Gelowitz, weekend and are hoping to be able to meet face to face later this year. Bob Taylor, Orville Ottenbreit, Dan Led by the capable coaching of Nick Skihar, Merv Exner, Don Stradeski, Osicki and manager Archie Thompson, Peter Champagne, Ted Mucha, Gay the 1960-61 team was the first midget Patrick, and Don Osicki. The team will team to win a provincial championship also be remembering and honouring for Melville. On their road to victory, the memory of players, coach, and the Melville midgets defeated teams managers such as Brian Bartake, Cliff from Yorkton, Weyburn, Regina, and Kurtz, John Lautner, Scott Turner, North Battleford. The team also had a Don Zawodski, Nick Osicki and Archie very successful season that year with Thompson. The team is still looking for all their other exhibition games. information on the whereabouts and of According to reunion organizer and two missing players. They are Scott member of the championship team, Turner, who was from Goodeve at the Peter Champagne, the 1960-61 team will time, and former Melville player Don hold a reunion Zoom meeting on March Zawodski. 6-7 to celebrate the 60th anniversary of Anyone with information on the the team’s championship win, which missing players or who has artifacts, happened on March 19, 1961. stories or memorabilia from the 1960-61 “Depending on the roll out of the championship period is asked to con- COVID-19 vaccines and the contain- tact Peter Champagne at 306-728-8543 Front page of the March 22, 1961 Melville Advance. ment of the pandemic, there’s the pos- or 306-728-3617. PUT YOUR MONEY WHERE YOUR HOUSE IS Support the local businesses that keep your community and its newspapers thriving. www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV February 26, 2021 17 Sports Column – Darcy Gross Goaltending boosts Habs’ fortunes Gross Misconduct If goaltending quality were used to rate the Canadian pionships, though, and Montreal has it. teams in the National Hockey League, mark the Mon- • Patti Dawn Swansson, aka the River City Renegade: treal Canadiens down as the presumptive champion of “The only thing that surprised me about the Buccaneers the North Division this summer. championship boat parade was seeing Tom Brady on Are the Leafs for real? As the seven teams approached the one-third mark of one of the boats. I thought for sure he’d be walking on It’s February and the Toronto Maple Leafs are at the 56-game regular season, with nary a postponement the water.” the top of the NHL standings. due to COVID-19 (as teams in the other three divisions • Swansson again: “I understand why the NFL used Nineteen games into the season, the Leafs have put had all suffered), a few things are becoming obvious. faux fans, but Patrick Mahomes is demanding to know up a gaudy 30 points and the closest team to them in Such as: It’s a wide-open race for the top four playoff why Kansas City coach Andy Reid used cardboard cut- the entire league is the Carolina Hurricanes who have spots, with perhaps only Montreal and Toronto in safer outs instead of his regular offensive linemen.” compiled 25 points in three fewer games. positions than the others; on any given • Dwight Perry of the Seattle Times: By no means am I prepared to hand the Stanley night …. any team can beat any other “Skateboarding has been added to the Cup to the Leafs, nor am I willing to say that they’ve team; and pencil in Montreal’s Marc Ber- Sports Column medal events for this year’s Olympics, got an inside track to the league final, but you can’t gevin as the general manager who made By Bruce Penton and break dancing will likewise be in argue with the numbers. the biggest splash in roster construction. the lineup at the 2024 Paris Games. I suppose the Leafs have almost made a habit of Thanks to Bergevin’s moves in the Somehow not passing IOC muster: a being in the thick of things near the middle of the off-season, his Canadiens appear to be motion to change the Olympic motto to NHL season and this year is no exception. neck-and-neck with the Maple Leafs as ‘Sicker, Hipper, Gnarlier.’” People who follow the team, those long suffering fans who live and die with their favourite team, might the North Division’s No. 1 team, which • Blogger Chad Piscasner, on Trevor be getting a little comfortable at this point in time. brings great joy to fans of the Habs, with- Bauer’s new Dodger contract penciling Based on their recent – and not so recent – past, out a Stanley Cup since 1993. out to $10,000-plus per pitch this season: you’d think that there’s a collapse coming at any time. Strength in goal is the foundation of “Which could lead to this conversation Is there a chance that this is the year that the team Montreal’s good start (9-5-2), thanks to on the mound: Manager: ‘How do you from the centre of the universe gets to measure itself Bergevin’s acquisition of Jake Allen from feel, Trevor?’ Bauer: ‘I think I got about against some of the legendary Toronto squads who St Louis in the off-season. The Carey $40,000 left in me, Skipper.’ ” dominated the National Hockey League in the 1950s Price-Allen combo is the division’s best, by far, and • Gambling Mad blogger Norman Chad, on Twitter: and 1960s? the envy of other teams. Toronto has the overworked “If Tom Brady ran a stoplight, they would say the stop- It’s hard to find a reason not to this time around. Frederik Andersen in goal, backed up by Michael (Five light was wrong.” They seem to have it all. They’ve got a solid blue Hole) Hutchinson or Jack Campbell. Winnipeg has the • Chad again: “Elected officials have term limits – it line corps that can get up with the offence and score great Connor Hellebuyck and the unproven Laurent is time to apply them to Tom Brady.” points and they’ve gotten solid goaltending from Broissoit. In Calgary, No. 1 guy Jacob Markstrom gives • David Staples of the Edmonton Journal, on a sugges- Frederik Andersen. the Flames quality but the backup is the dreadful David tion for a catchy nickname for the line featuring Jujhar Add the one-two punch of forwards Mitchell Rittich. Up in Edmonton, coach Dave Tippett cannot Khaira and linemates Tyler Ennis and Josh Archibald: Marner and Auston Matthews, who incidentally might fully depend on either Mikko Koskinen or Mike Smith. “The Sweet Khaira Line.” have the combination of best wrist shot and worst Vancouver’s goaltending duo of the aging Braden Holtby • From Dan Robson in The Athletic, on what former moustache you’ll see on any rink. and youthful Thatcher Demko is probably the division’s NHL enforcer Donald Brashear tells players in pre-game Sure, there’s no Red Kelly or Davey Keon or even second-best unit. chats now that he is refereeing beer league games in Wendell Clark, but these guys look pretty good so far, but here’s the thing. Just like quarterback in football or pitching in base- Quebec: “I have one rule: If you guys start fighting, I Every division in the NHL is completely locked, ball, a hockey team’s strength begins in goal. And the don’t give out penalties. I jump in the fight.” so how can one compare any of the Canadian teams Habs have it. • Comedy writer Alex Kaseberg: “Texas got so much against any of the other squads, since the only way Bergevin’s off-season moves also resulted in the sign- snow, the Houston Texans traded J J. Watt for 10 snow they’ll end up playing each other is to make it to the ing of free agent Tyler Toffoli from Vancouver (16 points shovels, two sacks of salt and a snowblower to-be-named- playoffs? in 16 games) and winger Josh Anderson from Columbus later.” It just so happens that the NHL’s top-5 point-getters (for Max Domi and a draft pick), who had nine goals in • Dwight Perry again “Those wild and crazy Houston all play in the North Division which is, of course, Montreal’s first 16 games, providing added life to a de- Texans agreed to release star pass-rusher J.J. Watt — completely comprised of Canadian teams. veloping offence that also includes former first-rounder still under contract — instead of trying to get some re- Does this speak to all the fire power that these Nick Suzuki, Jonathan Drouin, Brendan Gallagher, turn value in a trade. Veteran team watchers say you’d teams have or does it mean that the Canadian clubs Jesperi Kotkaniemi and Tomas Tatar. And on defence, have to go back weeks — weeks — to find a Texans move have some difficulty keeping the puck out of the net? stalwarts Shea Weber and Jeff Petry are backed by an- this confounding.” It’s a bit of a mystery at this point of the season, other Bergeven pickup, Joel Edmundson, and rookie Al- RJ Currie of sportsdeke.com: “The Indianapolis Colts but it’s sure going to be interesting when teams have exander Romanov, who is being given rookie-of-the-year acquired QB Carson Wentz from the Eagles for a third- to face off against unfamiliar opponents. consideration for his strong play. round pick, a second-round pick and a thank you note Who knows? Maybe the Leafs have a shot. Overall, the Habs are solid. Toronto is off to a great from Wentz to be sent later.” start and if its high-powered offence had Montreal’s Care to comment? R.I.P. Bill Greschuk goaltending, the Leafs would romp. Defence wins cham- Email [email protected] If you knew Bill, chances are you had the opportu- nity to get the sharp end of the needle from him once or twice, and he probably skunked you in cribbage at some point. I first met Bill at an age when all men were ad- WHL returns; Regina a hub city dressed as ‘mister’ and he was just the nicest guy you could meet. He, with his family, lived in a little house on King Street when I first met him. There wasn’t much room By Travis Longman Moose Jaw,” says Daemon Hunt, BC division is still waiting for for a yard, but the Greschuks had an awesome plot Grasslands News captain of the Moose Jaw Warriors. approval. The Central division that was used for gardening, and it was from there “It’s going to be a great time with returns on February 26th. The that I got my first, right-out-of-the-garden cucumber. all the guys and playing again. It’s Eastern Hub begins March 12 then The Western Hockey League Another first with Bill came when he taught me definitely interesting playing like a week later the U.S. division opens how to shell sunflower seeds, or as we all called them had good news last week. It was this. For me, I experienced a bubble up on March 19. back in the day, ‘sheemies.’ announced that the league will re- earlier this year in World Junior In winter, that little plot became an ice rink full of turn with an eastern hub city. Re- Camp. But I’m just thrilled to get children from Fourth, Fifth and Sixth Avenue, skating gina will be where the Regina Pats, back and play. The bubble can be SHOP until our feet ached in the middle of a Saskatchewan Moose Jaw Warriors, Saskatoon a bit intimidating at first because LOCAL. winter. Blades, Swift Current Broncos, we can’t be in the outside world, Anyone could make a rink, but it’s not like every- Prince Albert Raiders, Winnipeg but your perspective changes really SAVE one did it. I recall Bill out in the yard flooding the Ice and Brandon Wheat Kings will fast and it’s going to be an awesome rink a few times, the steam pumping out the back of LOCAL all battle it out for supremacy in a time.” his jacket, at the hood, as he sprayed the water on the Support the local businesses that keep your 24 game schedule. The east joins the central and community and its newspapers thriving. rink, his eyelashes as frosty as a Christmas card. “For me, it’s extremely exciting When you’re a kid, you don’t forget that sort of U.S. divisions that have been kindness. to finally get back playing with granted permission to play. The He was just a great guy; a gentleman and a gentle man and he’ll certainly be missed. Heavy Duty Mechanics required: Late model, clean CAT, Currently accepting JD equip; winch, dump, applications for HIP/KNEE gravel trucks, and CROP HAIL Replacement? Integrity Post trailers. Both camp and ADJUSTERS shop locations; R & B Other medical for the 2021 hail season. Frame Buildings provided conditions causing (July - October) BELIEVE IT? SINCE 2008 TROUBLE WALKING Wage negotiable. Semi-retired or retired or DRESSING? Built with Clean drivers abstract this job is for you! Don’t fall victim to The Disability Tax Concrete Posts a must. Competitive salary, all sharing fake news expenses & mileage Credit allows for about COVID-19 Barns, Shops, Send resume and paid, health spending $2,500 yearly tax work references to: online. Riding Arenas, account and pension credit and up to Bryden Construction plan. We provide $50,000 Lump sum Machine Sheds )V_(YIVYÄLSK:R extensive training using Learn the four refund. and More :,(" our industry leading simple steps that Fax: 306-769-8844 crop hail adjusting Apply NOW; quickest will help you sales@ ,THPS! program. refund Nationwide! SPOT fake news Integritybuilt.com brydenconstruct@ Email: Providing assistance xplornet.ca [email protected] online. 1-866-974-7678 during Covid. www. for application form and Expert Help: job overview. Watch the video at www. brydenconstruction andtransport.ca 306-569-1852 ext 170. 1-844-453-5372 SPOTfakenews.ca integritybuilt.com 18 February 26, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Grenfell Museum Assoc. discuss opening in 2021 By Sarah Pacio leaking into the basement. The furnace has been total assets of $17,107 as of December 31, 2020. This Grasslands News functioning better than previously; however, the includes an anonymous donation of $1,000 and $85 basement remains significantly colder than the rest donated in memory of individuals associated with of the building. Since the property is owned by the the museum who passed away last year (Alvin Gall- Grenfell Museum Association met for its annual meeting on Wednesday, Feb. 17. Seven members town and operated by the museum association, the inger, Don Kent, Ruth Yule, Cathie Cox, Ethel Box). gathered in the Roman Catholic Church basement, Town of Grenfell will be consulted regarding poten- The museum anticipates it will receive approx- enabling them to comply with physical distancing tial solutions. imately $4,400 in grant funding from Sask Lottery regulations. The group reviewed business from the In the absence of new nominations for 2021, Leslie and Sask Culture for use in 2021. This will be helpful previous year, elected new leaders, and discussed the McGhie agreed to remain president for another year. for repairs that need to be done to the ceiling of the feasibility of opening the museum this summer. Bernice Jones was elected vice president and Debra annex building and elsewhere around the property. Although the museum could not open to the pub- Pekrul was elected secretary-treasurer. Florine Discussion followed regarding how to proceed in lic in 2020 due to COVID-19, various projects were Campion had resigned as treasurer and the group the upcoming year. Even if the government permits completed at the property. Cataloging of artifacts expressed appreciation for her service. In addition to museums to open this summer, it would be nearly continued and Cecil Leech built a sign providing the executive members, the following were appointed impossible to adhere to physical distancing rules in information about the miniature elevators on the to the board of directors: Joan Velestuk (past pres- the Adare House or the annex. Sanitizing artifacts front lawn. The eavestroughs on the Adare House ident), Lucille Wolfe, Ron Wolfe, Lynne Reeve, and after visitors handle them would also pose a chal- were replaced, with financial support from the Town Mary Christie. lenge. Members agreed to remain closed to the public of Grenfell, and this seems to have reduced water The financial report was reviewed, indicating and focus on maintenance projects in 2021. Theft of firearms near Fenwood investigated

Sgt. Travis Adams Grayson Fire Dept. contacted the RCMP to report Yorkton Research Farm Webinar Melville-Ituna Detachments they were attending a vehicle fire at a location in Grayson. There were no injuries as a result of the fire. Join Parkland College and the East Central Research RCMP continue to investigate. Reporting period: Foundation for a live webinar to share the results of A call was placed to RCMP to report a suspicious Feb. 17 to Feb. 24 some projects recently conducted at the Research Farm small black four-door car in her driveway near Fen- Melville and Ituna detachments dealt with 64 occur- near Yorkton. wood, SK. The male driver appeared to be waiting for rences over the past week. another male that was inside the residence. The male Research coordinator Mike Hall will present on these Traffic suspect exited her residence and stolen five firearms topics: During this time, Melville and Ituna detachments before leaving. The firearms are described as a 30-30 • Do Newer Malt Barley Varieties Require More responded to 27 reported occurrences or traffic stops lever action rifle, .22 rifle with scope, 10 gauge shot- Nitrogen? that resulted in 13 Charges and 10 Warnings. gun, 30-06 rifle and, 12 gauge shotgun. Both males are • UAN vs. Dissolved Urea for Increasing RCMP responded to three collisions involving deer. described as caucasian and clean-shaven. The male Wheat Grain Protein (2019 and 2020 results) • Oat Test Weight No injuries at either accident. leaving the residence was described as 6’-0” tall, me- A person contacted the RCMP to report a red Mus- dium build, wearing a dark hoodie, and black track pants. Vehicle headed west bound. RCMP continue to Date: Friday, March 5, 2021 tang hit his tractor-trailer unit and continued driving. Time: 10:00 a.m. (40-minute webinar) investigate. RCMP continue to investigate. Hosted On: Zoom Mischief/Theft/Assault/Fraud A woman contacted the RCMP to report receiving a call from Publishers Clearing House stating that she It’s free to attend, but space is limited. Learn more and A security company contacted the RCMP to report had won $900,000.00 but they required 1 per cent from sign up at www.parklandcollege.sk.ca. Melville Fire was attending a fire at a residence in her. RCMP continue to investigate. Melville. The homeowners were not home at the time If you have information related to these mischiefs, and no injuries as a result of the fire. The interior of thefts, or frauds please contact your local RCMP De- the residence had spray painting mischief. RCMP con- tachment, call 310-RCMP for immediate response, or 1.866.783.6766 | parklandcollege.sk.ca tinue to investigate. you can call Crime Stoppers at 1-800-222-TIPS (8477).

Directory

Fisher & Schmidt Miller Moar Grodecki Kreklewich & Chorney CHARTERED PROFESSIONAL ACCOUNTANTS – www.millerandco.ca /DZ2IÀFH MELVILLE OFFICE – 306-728-4525 FORT QU’APPELLE OFFICE – 306-332-6651 128 - 4th Ave. East, Melville, SK 32&!@;3 8-&!@¥VŠ‡!W1W;3ŒVŠ‡6W1WTˆŒŒfŠ8&='W W '&2'9&!@ŽVŠ‡!W1W;3ˆ‰332Tˆ‰‰316!2@='WW !=-&W 83&'$0-TT-2!ħ'2&!2$' &0LFKDHO)LVKHU4٘ ESTERHAZY OFFICE – 306-745-6611 INDIAN HEAD OFFICE – 306-695-2303 8!2&='W Š‰Œ '&2'9&!@ˆVŠ‡6W1W;3‹VŠ‡6W1W, 8-&!@¥VŠ‡!W1W;3‹VŠ‡6W1WT‹‰‡!-2;W +RQV 32&!@;3 DUQHW)LVKHU%$* ٘ //%&ROODERUDWLYH/DZ\HU GRENFELL OFFICE – 306-697-3558 !=-&W 83&'$0-TT-2!ħ'2&!2$' 32&!@;3 8-&!@¥VŠ‡!W1W;3‹VŠ‡6W1WTˆ¤'9132&;W BALCARRES OFFICE – 306-334-2923

'$'&2'9&!@ˆ‡V‡‡!W1W;3‹V‡‡6W1WT!£$!88'93>2ă -2!ħ'2&!2$' UDQW6FKPLGW//% !88@W-££'8TTT* ٘ Wednesday and Thursday £!-8W!2!'9''£'TTT-2!ħ'2&!2$' Michael Fisher & Garnet Fisher Grant Schmidt 306-728-4581 306-728-5481 WHITEWOOD OFFICE – 306-735-2385 ITUNA OFFICE – 306-795-3190 <'9&!@;3 8-&!@ŽV‡‡!W1W;3ŒV‡‡6W1WT‡!£32&';W Melville and Esterhazy Melville <'9&!@ˆ‡V‡‡!W1W;3‹V‡‡6W1WT3( ;<2!ă$' !8@W8'0£'>-$,TTT-2!ħ'2&!2$' )9,'8£!>|9!90;'£W2'; 93£!>|9!90;'£W2'; !=-&W,382'@TT-2!ħ'2&!2$',<89&!@ ;!8ধ2+!; GARY MOORE LL.B. Balcarres $10*/week Barrister, Solicitor, Notary Public Agencies Ltd. Box 610, 616 Main St., Phone 306-332-4666 1-800-563-4608 Broadview, SK S0G 0K0 Off ering a wide selection of products and expertise 122 Company Ave. S., Fort Qu’Appelle, SK *Must be prepaid, plus 0RQGD\)ULGD\DIWHUKRXUVE\DSSRLQWPHQW • Personal Insurance • Commercial Insurance For all your Insurance needs! • Specialty Products • Agri-Business GST, based on 12 SUB-OFFICE: Representing: • SGI Canada • Wawanesa • SMI • Wynward Insurance Company :KLWHZRRG7KXUVGD\DIWHUQRRQ 216 Main St. Balcarres, SK • Germania Mutual • Aviva • Oasis • Intact 132;,9!&='8ধ9-2+W )ODWODQG3OXPELQJ%XLOGLQJ Phone: 306-334-2401 Fax: 306-334-2705 • HUB Life and Financial Services $480 plus GST Email: [email protected] • Portage Mutual • Group Medical Services CALL FOR APPOINTMENTS: • Red River Mutual and Many More. www.balcarresagencies.saskbrokers.com • Saskatchewan Blue Cross 306-696-2454 or 306-696-6704 • SGI Motor License Issuer GRASSLANDS BOCK & COMPANY DIRECTORY LAW OFFICE NEWS GROUP PATTY WELCH LYNNETTE BOCK, B.A., J.D. Publishers of the Melville Advance, &RQVXOWDQW ADVERTISING Fort Qu’Appelle Times and the 0DSOH6WUHHW32%R[ Phone: (306) 728-4998 $ ,-;'>33& 8'2('££ '8!£&<2 WK$YH(DVW0HOYLOOH for only 10* / week (VWHUKD]\6.6$; EDFNGRRUHQWUDQFH 0XVWEHSUHSDLGSOXV*67 3DWW\:HOFK#,*FD PHONE: (306) 745-3952 Time... to think about keeping the family dream home, 5HJXODUUDWHLVSOXV*67SHU\HDU FAX: (306) 745-6119 1-844-464-6397 no matter what (PDLOERFNODZ#VDVNWHOQHW 7UDGLWLRQDOPRUWJDJHOLIHLQVXUDQFHLVGHVLJQHGVSHFLÀFDOO\WRUHWLUHRQO\WKHEDODQFH Grasslands News Group Ext. 230 RZLQJWRWKHPRUWJDJHOHQGHULIVRPHWKLQJKDSSHQVWR\RX,QYHVWRUV*URXSFDQVKRZ \RXKRZDQLQGLYLGXDOSODQWKDWSXWV\RXLQFRQWUROFDQKHOSHQVXUHWKDWLQWKHHYHQW %UDQFK2IÀFH GHDWKGLVDELOLW\RUFULWLFDOLOOQHVV\RXUIDPLO\FDQVWLOOOLYHLQWKHLUKRPH 1-844-464-6397 /HWXVVKRZ\RXKRZEXLOGLQJLQVXUDQFHLQWR\RXUSODQFDQSUHVHUYHÀQDQFLDOVHFXULW\ Rocanvile, Friday Afternoons !&9|+8!99£!2&92'>9W$! Œ7UDGHPDUNVRZQHGE\,*0)LQDQFLDO,QFDQGOLFHQVHGWRLWVVXEVLGLDU\FRUSRUDWLRQV ext 230 Phone: (306) 645-4552 ZZZJUDVVODQGVQHZVFD 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV )HEUXDU\ 19 Neighbourly Advice According to ED - Ray Maher All people are like grass, they wither and die

My old neighbor Ed, aration we cannot fix. press their feelings with the Father except through are lost in grief and its weary and increases the who lives in Melville, We can attend our best acceptance. Jesus.” (John 14:6) power. He leads us gently power of the weak. Those is blunt about death. I friend’s funeral, but our What can you say to Jesus is our Good as he restores our souls, who hope in the Lord will shared with him that best friend cannot be at those sorrowing over the Shepherd in life and calming our fears and renew their strength.” someone I treasured as our funeral. death of a loved one? death. As we live, Jesus sorrows. (Isaiah 40:28-29) my good friend died re- The death of a mate, I suggest the words of tends us like a shepherd. Thankfully, we can The Lord is the ever- cently. I quoted Ed, the parent, sibling or close Winnie the Pooh; “There He gathers us in his arms hold our heads up in the lasting God who increases German Proverb, “That friend hurts and is pain- is something you must al- and carries us close to his death of a loved one for, the power of those griev- the death of a friend is ful in its own awful way. ways remember, you are heart, especially when we “God gives strength to the ing. equivalent to the loss of a It can leave us without braver than you believe, limb.” words, in shock, and feel- stronger than you seem, “No point in getting ing a significant loss. smarter than you think.” bent out of shape about Death changes those As Christians, we your friend’s death. Even left without their loved grieve in the truth that Melville’s Churches as your best friend, you ones. There is stress, per- Jesus Christ is our Good Welcome You couldn’t prevent his haps some guilt that more Shepherd who has lain death or have healed him. might have been said or down his life for us as Suck it up, as death is in- done. Loneliness, anger, sinners. “He is the way, 0HOYLOOH$QJOLFDQ/XWKHUDQ(FXPHQLFDO %(7+$1<(9$1*(/,&$/ evitable and no one gets emptiness, fear and tears and the truth, and the &RPPXQLW\0$/(& 0,66,21$5<&+85&+ out of life alive,” Ed said can overwhelm those * * * WK$YH: 4XHHQ6W²&KXUFK2IÀFH3K life. No one comes to God $//6$,176·$1*/,&$1&+85&+ unsympathetically. heartbroken by grief. Corner 6th Ave. E. & Main St. )HE Worship Service 10:30 a.m. &KXUFK2IÀFH 0DUFKNo Service Ed was right in that to Grief is personal, and die is as natural as being we cannot fix someone VALLEY ALLIANCE 673$8/·6/87+(5$1&+85&+ born. The Bible makes else’s grief. It is a process UG$YH(2IÀFH3K 0(/9,//(3(17(&267$/&+85&+ CHURCH Fort Qu’Appelle 2IÀFH+RXUV0RQ7KXUVDPQRRQ 115 - 11th Ave. W. it clear that “All people or an experience a person 3DVWRU.LP6KHUZLQZZZVWSDXOVPHOYLOOHFD 3DVWRU'RXJ%UDXQ²2IÀFH3K are like grass, and their works through at their Sunday service 10:30 a.m. HPDLOPSF#VDVNWHOQHW glory is like the flowers of own pace. Service is also available on YouTube and will be )HEDP3DULVK:RUVKLSDQG6XQGD\6FKRRO www.facebook.com/melvillepentchurchsk the field. The grass with- Those grieving need livestreamed. Please call the church at 306-332-5807 DW6W3DXO·V )HE,Q3HUVRQ6HUYLFH for information regarding COVID-19 regulations AOO6DLQWV·UHPDLQV&/26('IRULQSHUVRQZRUVKLS 3OHDVHMRLQXVRQ)DFHERRNDW0HOYLOOH3HQWHFRVWDO&KXUFK ers and the flowers fall the kindness of others or check our website: valleyalliance.ca 6W3DXO·VUHPDLQV23(1IRULQSHUVRQZRUVKLSZLWKDPD[LPXP because the breath of the who allow them to ex- capacity of 30 people. All services can be streamed live on Facebook page Sunday mornings. *22'6+(3+(5'/87+(5$1&+85&+ Lord blows on them.” (Isa- Sunday morning live streams start at 10:50 a.m. WK$YH:²3K iah 40:6-7) 3DVWRU'RXJ6FKPLUOHU facebook.com/gslcmelville To be born and to die ),56781,7('&+85&+ 0DUFKSP&RQÀUPDWLRQ&ODVV &RPS6WXGHQWV are both parts of God’s 5th Ave. E. & King St. 0DUFK 7:00 p.m. Midweek Lenten Devotions online timing. 2IÀFH+RXUV 0DUFKSP&RQÀUPDWLRQ&ODVV 6W+HQU\·V6WXGHQWV Mother Treasa said, Mon., Tues., Thurs., 9 a.m. - 12 noon 3K “Death is nothing else 5HY%ULDQ0HH3K 67*(25*(·68.5$,1,$1 but going home to God.” ZHEVLWHÀUVWXQLWHGPHOYLOOHRUJ &$7+2/,&&+85&+ WHITEWOOD AND AREA Corner of 3rd Ave. E. & Manitoba St. )HE 11:00 a.m. Worship Service with Ray Yost I think these words are Fr. Basil Malowany KNOX ST. JOSEPH’S ROMAN 0DUFK Annual Meeting Following Church Service comforting when we are EDVLOPDORZDQ\#JPDLOFRP² PRESBYTERIAN CHURCH CATHOLIC CHURCH grieving the death of a Services - 10:00 a.m. *February Saturday Mass )HE 7XHVGD\ 6:30 p.m. Stations of the Cross Rev. Seon Ok Lee 7+(5,9(5&+5,67,$1&(17(5 0DUFK 0RQGD\  Lenten Akhatist followed by AGM friend, mate, family mem- 5:00 p.m. (A Church with a Caring Heart) 6:30 p.m. Stations of the Cross NEW LIFE 0DUFK 7XHVGD\  ber, etc. In one sense, ev- 3rince Edward St. (Melville Comm. Works) eryone knows death is COMMUNITY CHURCH ST. JOHN’S LUTHERAN Please 1RWH3DULVKLRQHUV0867UHJLVWHUKRXUVLQDGYDQFHIRU CHURCH, WAPELLA 3K3DVWRU7LP2HKOHU each service. Contact 306-728-3813. Worship Service ~ 10:30 a.m. 6XQGD\ 10:00 a.m. Doors Open – 10:30 a.m. Worship Service inevitable, but like taxes *No Services until futher notice or a toothache, we try to Wed. ~ Kids Club ~ 3:30 - 5:00 p.m. 3UHUHJLVWUDWLRQLVZHOFRPHGEXWQRWUHTXLUHG Held at New Life Church ST. MARY’S More information available online at: 67+(15<·6520$1 ignore the truth that it (Ages 5 - 10) ANGLICAN CHURCH Website: www.melvilleriverchurch.org &$7+2/,&&+85&+ Fri. ~ Youth Group ~ 7:00 p.m. will happen to others and *Services CANCELLED )DFHERRN3DJH#PHOYLOOHULYHUFKXUFK 0DLQ6W²2IÀFH3K (Ages 11 & Up) 5HFRUGHGVHUYLFHVZLOOFRQWLQXHWREHSRVWHGRQOLQH 5HV3K²WK$YH: ourselves eventually. until further notice Pastor Doug Lancaster )DWKHU$QGU]HM6RZDOMI Death means a sep- 6DWXUGD\0DVV: 7:00 p.m. EVANGELICAL MISSIONARY WHITEWOOD 0(/9,//(%$37,67&+85&+ 6XQGD\0DVV 10:00 a.m. Sunday School – 10:30 a.m. UNITED CHURCH 473 - 8th Ave. W. Sunday Service – 10:30 a.m. *Feb. 28 – 10:00 a.m. 2IÀFH3K3DVWRU-RQ3HWWLQJHU LOOK! Friday Youth Bible Study – =,21/87+(5$1&+85&+ 9:30 and 11:15 a.m. 6:00 p.m. Worship Service 6XQGD\6HUYLFH7LPHV (Lutheran Church - Canada) Pastor Samuel Jung 3UHUHJLVWUDWLRQLVUHTXLUHG WK$YH:²&KXUFK2IÀFH3K You just proved even Online services can be found at: (PDLO]OFSDVWRU#P\DFFHVVFD small ads get noticed. WAPELLA CHURCH www.melvillebaptist.com Website: www.zionlutheranmelville.com OF THE NAZARENE 6XQGD\)HE 11:00 a.m. Worship Service Service – 11:00 a.m. 1-844-GNG-NEWS Church of the Lutheran Hour heard Sundays at 9:00 a.m. Sunday School – 10:00 a.m. *URZLQJLQ)DLWK7RJHWKHU DGV#JUDVVODQGVQHZVFD on 940 CJGX Radio, Yorkton

TYMIAK’S MONUMENTS & GRAVE SURFACING CO. Granite, Bronze, Marble Monuments, Grave Covers, Vases, $UWLÀFLDO)ORZHUV&HPHWHU\,QVFULSWLRQVDQG&UHPDWLRQ8UQV GRANITE, MARBLE, • Monument Sales )8//<*8$5$17(('²/,&(16('$1'%21'(' BRONZE MONUMENTS 6HH2XU Second Inscriptions • Lettering on /DUJH'LVSOD\ Vases, Cremation Urns Monuments & Markers 529 Main St. South, /LFHQVHGDQG%RQGHG Box 476, Ituna, Sask. S0A 1N0 CAROLE ARMSTRONG Directory Ph. (306) 795-2428 'HQQLV7HPSOH 306-332-1335 Serving Surrounding Areas Since 1960 or 306-728-8197   

Tubman Funeral Home Check our pricing – You will be Cremation and Funeral Services glad you did! Family Owned and Operated Located at 5th Ave. W and Main St., Melville, SK Denton Keating 210 Claude Street “Treating Your Family like a part of P.O. Box 351, Wolseley, SK S0G 5H0 Did You Y Know? K ? If you have h a prearranged funeral plan with another funeral Ours for 4 Generations” Tel.: 1-306-698-2557 home you have the right, by law, to transfer that plan to any other funeral  1-800-667-8962 home in the province, often at no charge to you. Fax: 1-306-698-2559 Raymond and Crystal Bailey, Honoured Provider Dignity Memorial® Call us for details! Don Klus and Len Varga [email protected] Authorized agent for Canada Purple Shield / Familyside. Elden Conley LFD / LE / CCT - Owner / Manager

Authorized Agents for www.tubmanfh .com ZZZEDLOH\VIXQHUDOKRPHFRP Summit Memorials Ltd. FORT QU’APPELLE – 306-332-0555 WOLSELEY – 306-698-5000 266 Boundary Ave. N. 900 Front Street Matthews Funeral Home Melville’s only locally-owned funeral home. %UDQFKRI¿FHLQ:KLWHZRRG %XULDODQGFUHPDWLRQVHUYLFHVJULHIVXSSRUW FHPHWHU\PHPRULDOVQRWDU\SXEOLF 0HOYLOOH²:KLWHZRRG Mark and Gaylene Matthews and staff www.conleyfuneralhome.ca RAYMORE – 306-746-1000 116 Main Street PDWWKHZVIXQHUDOKRPH.ca Like and follow us on facebook for the latest obituary updates. 20 February 26, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News

WEEK OF FEBRUARY 28 TO MARCH 6, 2021

THE LUCKIEST SIGNS THIS WEEK: CAPRICORN, AQUARIUS AND PISCES ARIES This will be a week when emo- tions run high. Be careful not to put yourself in situations where you have to make all the de- cisions, as you’re likely to be CROSSWORDS PUZZLE NO. 063 Copyright © 2018, Penny Press criticized. ACROSS TAURUS 42. Halt 7. Brat 44. Untangle 8. Golfers’ pegs You’ll need to jockey your way 46. Sharp knock into a better position; don’t he- 1. Cabbage salad 9. Request 5. Landed 47. Week part 10. Crevice sitate to show your true char- 48. Function acter. You’ll have the opportu- 9. Behave 11. Hauled 49. Make a living nity to travel and discover new 12. Contain 19. Out of bed 13. Moniker 51. Mr. Ellington cultures. 21. Ground beef dish 14. Master 52. Toe count 24. Casper’s call GEMINI 15. Mellowed 53. Catch sight of 54. Cake decorator 27. “____ Did Our You’ll stand out considerably 16. Variety among your friends and collea- 17. Handle roughly 55. Road bend Love Go” gues. These people are likely to 18. Took first place 56. Makes a dress 29. Boggy area offer a helping hand as you go 19. Intention 57. Confusion 31. Defective bomb through a number of transfor- 20. Site 33. Stops mations. 22. Record 34. Shelters 23. Wound covering 35. Take for a time CANCER 25. Laborer DOWN 37. Diminish If you open your home to loved 26. Small salamander 38. Pythons, e.g. ones, don’t expect them to help 28. In a prying way 39. Cruel person you out with household tasks. 30. Disguised 1. Wool wrap They might even want to be wai- 32. Hooter 2. “The Blue ____” 41. Speaks wildly ted on. Fortunately, good times 33. Celestial being 3. Exact retribution 43. Color changers are on the horizon. 36. Broadcasts 4. Join in marriage 45. Not quite as much 39. Yogi, e.g. 5. Caper 50. Gorilla or orangutan LEO 40. College housing 6. Nonprofessional 51. Faded You’ll have to deal with people who are all talk and no action. Go with your initial idea; it’s the right one, and you’ll avoid being led astray by people who don’t know what they’re talking about. VIRGO You certainly appreciate the fi- nancial stability and indepen- dence that your job provides. With the salary earned, you’ll be able to travel and explore. LIBRA You’ll be overflowing with great ideas and initiatives. In addi- tion, you’re constantly changing your plans to suit your mood, which may irritate certain peo- ple around you. SCORPIO Confusion is possible in a chao- tic universe. Fortunately, all you need is a second cup of coffee to help you regain your energy and complete a number of small miracles every day. SAGITTARIUS After an intensely stressful pe- riod, you’ll certainly need to take a step back and get some rest. You’ll need to recharge your bat- teries in order to feel like you’re getting a fresh start. CAPRICORN You’ll likely work a lot of over- time. Fortunately, you’ll even- tually manage to let loose and enjoy yourself with loved ones, who’ll invite you to participate in fun activities. AQUARIUS FAVORITES Whether it’s imagining a vacation Pasta Primavera or a quick romantic getaway, Submit your favorite recipe to [email protected] you’ll have your head in the clouds. You might have thoughts 2 ;!£-!2T[68-1!='8!\1'!29[968-2+T\1!0-2+;,-9$£!99-$T='+';!#£'f-2(<9'&6!9;!&-9,!(!=38-;';,-9ধ1'3(@'!8W,'='+';!#£'-2$£<9-329 of moving abroad or going on some type of expedition. #'£3>$!2#'9>-;$,'&3<;(38@3<83>2(!=38-;'683&<$'!9>'££W PISCES Changes are inevitable. Tigh te- ning your circle of friends will INGREDIENTS DIRECTIONS: help relieve some of your stress, Makes 8 Cups 1. Combine the seasoning mix ingredients Seasoning Mix: making it easier to pursue as- thoroughly in a small bowl. pirations that are more in line j‰fˆ‰;'!96332&8-'&9>'';#!9-£ with your needs. leaves 2. Heat olive oil in a 12-inch skillet over high jˆfˆ‰;'!963329!£; heat. When oil is very hot, add the • 1 teaspoon dried thyme leaves 6839$-<ħ3T$!<£-*3>'8T1<9,83319T jŠ‹;'!96332>,-;'6'66'8 jˆ‰;'!96332+!8£-$63>&'8 $!883;9T!2&A<$$,-2-W&&;,'#<ħ'8!2&T jˆ‰;'!9633232-3263>&'8 !9-;1'£;9T9ধ8-2;,'+!8£-$!2&;,' • 2 teaspoon olive oil 9'!932-2+1-?Wধ8-2!96!8!+<9ধ6938 jˆ$<6;,-29;8-696839$-<ħ3 923>6'!9!2&+8''232-329Wধ8>'££!2& j‰$<69$!<£-*3>'8*38';9 $330/<9;<2ধ£;,'='+';!#£'9!8' • 2 cups sliced fresh mushrooms $8-96f;'2&'8T!#3<;‹;3Œ1-2<;'9Wধ8-2 jˆ‰$<69£-$'&$!883;9 (cut on the diagonal) the cream and bring to a boil. Lower the • 2 cups sliced zucchini ,'!;;31'&-<1!2&$330<2ধ£;,'9!<$' j¤;!#£'963329<29!£;'&#<ħ'8 has thickened a bit, about 3 minutes. • 1 teaspoon minced fresh garlic jˆ$<6!96!8!+<9ধ6938 3. Cook the pasta according to package  Š‹$<69923>6'!9 &-8'$ধ329U&8!-2W&&;,'$330'&6!9;!;3 • 1 cup chopped green onions the skillet, toss well and remove from the • 2 cups heavy cream • 9 ounces of your favorite pasta heat. Serve immediately. ZZZJUDVVODQGVQHZVFDCLASSIFIEDS0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV )HEUXDU\  ONE AD, THREE NEWSPAPERS: All classified ads appear in the Melville Advance, Fort Qu’Appelle Times and Whitewood/Grenfell Herald Sun

Wilhelmine “Gladys” McDade Eleanor Niebergall Werner Zerbin Obituary April 5, 1930 – Feb. 12, 2021 Obituary July 9, 1931 – Feb. 12, 2021 Obituary March 17, 1932 - Feb. 19, 2021

It is with great sadness It is with sorrow that the Werner Zerbin passed that the family of Wilhelmine family of Eleanor Niebergall away on the morning of Fri- “Gladys” McDade (nee Gross) announces her passing on Fri- day, Feb. 19, 2021 at 88 announces her passing at St. day, Feb. 12, 2021, at the age years of age. Paul Lutheran Home in Mel- of 89 years. Werner was predeceased ville, SK, on Friday, Feb. 12, Eleanor Barbara Maur- by his parents, John and 2021, at the age of 90 years. er was born on July 9, 1931, Auguste; his wife Lillian; Gladys was born on April 5, to Fred and Barbara (nee step-son Russell Hack;, 1930, at Earl Grey, SK, to Ber- Bauer) Maurer on the family step-daughter Joyce Hand- tha and George Gross. She farm in the Neudorf district of ke; step-son-in-law Irvin attended Sweet Hill School. Saskatchewan. She was bap- Handke and grandson Brian Gladys met her future hus- tized on July 12, 1931, in the Handke. band at the age of 13 years Lutheran faith. She later con- He is survived by his sister, Vera Palmer; nephew Frank at a school dance. They at- ¿UPHGKHUIDLWKDW6W3HWHU¶V and niece Shaelene and families; grandchildren, Laurie and tended a box social, where Bill bought Gladys’ box lunch Lutheran Church, Duff, SK. Darcy Rist, Melvin Handke, Donna and Murray Whitelaw, so that they could spend time together. They were united The family moved to the Duff district of Saskatchewan in and Garth and Karen Handke; great-grandchildren, Lianne in marriage in Watrous, SK, on Oct. 25, 1952. The couple 1932. Eleanor attended Colmer School and then continued and Leyton Plett, Tanice and Trevor Fraser, Jennifer and farmed for two years in the Simpson district, welcoming a her schooling at Duff. She started work at Bokay Florists in Don Strickland, Jason and Cassandra Whitelaw, Amanda son, George Alexander, in 1953. The small family moved 1959. In 1962 she began working for the Melville Medical and Derek Baumgartner, Greg and Ivana Whitelaw, Ryan to Simpson in 1954, where Bill started working as a me- Association until her retirement in 1995. Handke, and Samantha Handke; great-great-grandchil- chanic. They welcomed a daughter, Valerie Jean, in 1957. Eleanor married Ervin Niebergall on May 25, 1974, at St. dren, Mackenzie and Dallas Wishloff, Jonathan Gooding, The family then moved to Watrous in 1962, where Gladys Paul’s Lutheran Church, Melville, SK. Together they found Austin and Brooke Strickland, Sage and Jade Fraser, worked as a cook for the Manitou Mineral Spa, and Bill con- great pleasure in travelling. Ervin and Eleanor travelled Zachary Whitelaw, Jessica, Carson and Bailey Baumgart- tinued to work as a mechanic. The family moved to Melville, throughout Canada and most of the United States, while ner, and Liam and Felix Whitelaw; great-great-great-grand- SK, in 1969, where they settled for the remainder of their also making trips abroad. Eleanor also spent a lot of time, children, Sophia and Beau Wishloff. lives. DQGWRRNJUHDWSULGHLQERWKKHUYHJHWDEOHDQGÀRZHUJDU It was his wish that donations in his memory be made to Bill worked as a mechanic, eventually having the op- dens. She always had enough produce to give to family and Peace Lutheran Church Memorial Fund (Box 520, Grenfell, portunity to work as the head mechanic for the Deer Park friends. SK, S0G 2B0). School Division. Gladys worked in the kitchen at St. Paul In 2017 Eleanor’s health deteriorated, resulting in her re- A private funeral service was held in the Peace Lutheran Lutheran Home for one year. She then decided to open a quiring long-term care. She spent a short time in the Gate- Church, Grenfell, SK on Tuesday, Feb. 23, 2021. Private foster home in 1971 with Bill, where they served children way Lodge in Canora, SK, and then transferred to St. Paul interment followed. A video of the funeral service will be and some adults with intellectual disabilities, as well as oth- Lutheran Home in Melville. Eleanor enjoyed all the activities made available to the public on Go Forth in Peace Lutheran ers who were in a time of need. Bill continued to work as a and entertainment provided by the nursing home. Prior to Parish’s facebook group for all those who could not attend mechanic while also helping Gladys with the foster home. and while she was in the nursing home, church services the funeral. Online condolences may be made at: Gladys had a servant’s heart and wanted to help others were very important to her. She looked forward to visits with www.tubmanfh.com in need. She cared for many people over the years, about other family and friends and especially “the little ones”. She 100 in total. At one time, they took care of 12 people at once entered her eternal rest on Friday, Feb. 12 with family by but usually had 6 people in their home at one time. Gladys her side. was always there for people in need and never made any- Eleanor was predeceased by her husband, Ervin, in one feel less of themselves for asking for help. Some of the 2004; her parents, Fred and Barbara; two brothers-in-law, people who stayed in their home stayed for months, some Elmer Lang and Bert Horgas; nephew Richard Horgas for years. Their home was a place of refuge where foster and niece Janice Mehling. She was also predeceased by children were loved like family. Gladys and Bill were foster Ervin’s parents, Peter and Matilda Niebergall, and his sib- parents for decades until the passing of Bill in 1987, after lings and their spouses: Caroline Niebergall, Mary (Albert) Memorium which Gladys continued until she had health issues at the Rosen, Edith (Richard) Sitz, Barbara (John) Potyondi and end of 2002. She ran the foster home for 31 years in total. Ernest (Agnes) Niebergall. She is survived by her three To this day, foster children and people who stayed at her sisters, Louise (Gilbert) Lang of Yorkton, Esther Horgas of house were still in contact with Gladys, which is a testament Yorkton and Alvina Lang of Melville; numerous nieces and to the positive impact that she had on so many lives. nephews, great-nieces and -nephews, and great-great- Gladys spent her remaining years at St. Paul Lutheran nieces and -nephews. Home, where she continued her ministry of helping others. We thank all her family and friends for keeping in touch She always helped the staff and residents as she was able. with her over the years, both far and near. To the nursing Gladys enjoyed the activities at the nursing home, including home staff on Academy Road where she lived, thank you dances, adopt-a-grandparent, bingo, bowling and musical for providing care and comfort when she needed it. Thank performances. She also enjoyed many visits with family and you to the activity department and spiritual care for the ac- friends over the years during her stay at the nursing home. tivities and services that she was able to attend. Thank you The staff loved her like family, as did Dr. Eshawesh, who HERMAN – Garry, April 13, 1946 - to Pastor Phil at the nursing home, Pastor Kim for leading cared for her for decades. Feb. 15, 2013. the funeral service, the staff at St. Paul’s Lutheran Church, Tenderly we treasure the past Gladys will be lovingly remembered by her children, Memories that will always last, George (Betty) and Valerie (Dennis); her brother, Ervin and Matthews Funeral Home. Eleanor was blessed to have many family members and When we cease to think of you (Carol); sisters-in-law Doreen and Nancy; her grandchil- DODD – George William, June 25, Will be when God has called us too. friends in her life; she will be missed by all. 1955 - March 2, 2020. –Lovingly remembered by Shirley, dren, Raquel, Carlene (Lloyd), Derek, Crystal (Brian), Ter- Brent and Dana. 4-1nc ence (Dee-Anna), Joseph, Melissa (Darryl) and Paige; nu- A private family funeral service for Eleanor was held on We miss you now, our hearts are Thursday, Feb. 18, 2021, at St. Paul’s Lutheran Church, sore, merous great-grandchildren; two great-great-grandchildren; As time goes by we miss you and numerous nephews and nieces, foster children, foster 0HOYLOOH ZLWK WKH 5HY .LP 6KHUZLQ RI¿FLDWLQJ ,QWHUPHQW more. family members and friends. Gladys was predeceased by took place in the Melville City Cemetery with Dave Lang, Your loving smile, your gentle Keith Lang, Glenn Lang, Garrett Lang, Robert Horgas and face, her parents, Bertha and George Gross; her loving husband, No one can fill your vacant place. William (Bill); sister Annie (Bernie); brothers Sigfried (Frie- Carson Sass acting as pallbearers. –Forever in our heartsy, Bev, Kelly da), Alfred and Edward (Lois); brothers-in-law Robert (Shir- Arrangements were entrusted to Matthews Funeral and Ashley. 46-1c ley) and James; and her best friend, Edith (Harold). Home, Melville and Whitewood. A funeral service was held for Gladys on Saturday, Feb. 20, 2021, at Matthews Funeral Home, Melville, with Pas- WRU7LP2HKOHUDQGWKH5HY'DYH7D\ORURI¿FLDWLQJ6RORLVW Carlene Schwartz sang “Amazing Grace” and “How Great HELP STOP THE Thou Art” accompanied by Gaylene Matthews. Several trib- SPREAD OF FAKE utes to Gladys were presented by family members. Inter- NEWS! ment took place in the Melville City Cemetery with Dennis The global COVID-19 Exner, George McDade, Randy Gross, Terence McDade, pandemic means Brian Garrett and Lloyd Schwartz acting as pallbearers. learning how to SPOT fake news has STARCHUCK – In loving memory Arrangements were entrusted to Matthews Funeral never been more of Ted, April 18, 1938 - March 1, &ODVVLÀHGDQG 2012. Home Melville and Whitewood. important. Nine years have passed Protect yourself since we sadly said our last 2ELWXDU\'HDGOLQH with media literacy good-byes, in 4 simple steps. But our great memories and loving thoughts of you, 7XHVGD\VQRRQ Watch the video at will be in our hearts forever. SPOTfakenews.ca –Deeply missed and always loved by Marg and all our family. 4-1p

CLASSIFIED RATES 1 week: $12.00 • 2 weeks: $18.00 • 3 weeks: $24.00 • 4 weeks: $28.00 1-844-GNG-NEWS (based on 25 words or less) Additional weeks: $2.50 • Deadline: Tuesdays at 12 noon Email: [email protected] 22 February 26, 2021 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV Grasslands News Bill Greschuk Wanted - Class Photo For Rent Province Wide Obituary March 14, 1936 – Feb. 17, 2021 /22.,1* )25 D FODVV SKRWR IURP $%(51(7+< +286,1* $XWKRULW\ $J352 6HHGV EX\LQJ +($7(' 0HOYLOOH·V 0LOOHU 6FKRRO  KDV RQH  EHGURRP VHQLRUV VXLWH &$12/$ 723 35,&(6 3$,' ,1 Bill was born on March 14, 1936 on a George, auc-  *UDGH  ZLWK WHDFKHU 0UV DQG WZR  EHGURRP GXSOH[ DSWV 6. )25  +($7(' 2Q farm in the Goodeve district in Saskatche- tion sales, 7LO3UHIHUDEO\ZLWKVWXGHQWVQDPHV DYDLODEOHIRUUHQW)RUPRUHLQIRUPD IDUPSLFNXSSURPSWSD\PHQW3ULFH wan to George and Eva (nee Wadiuk) Gre- and Millionaire 3KRWRWRLQFOXGH5KRQGD6PLWK  WLRQ FRQWDFW $QQH 0DULH 0RXOGLQJ LQTXLULHV    RU HPDLO     S KRXVLQJPDQDJHUDW DJSURVHHGV#JPDLOFRP schuk. games always   WIF Bill took his schooling at Tarnaville School came in sec- $'9(57,6(0(176 DQG VWDWH )25 5(17 ² %DOFDUUHV +RXVLQJ PHQWVFRQWDLQHGKHUHLQDUHWKHVROH and later at the Hubbard High School. Even ond. His family Livestock $XWKRULW\ KDV D  EHGURRP VHQLRUV UHVSRQVLELOLW\RIWKHSHUVRQVRUHQWL though he only completed his Grade 8, he was his priority. VXLWH DYDLODEOH IRU UHQW )RU PRUH WLHV WKDW SRVW WKH DGYHUWLVHPHQW took great pride in his penmanship and the Any opportu- HOLLINGER LAND & CATTLE LQIRUPDWLRQ FRQWDFW $QQH 0DULH DQG WKH 6DVNDWFKHZDQ :HHNO\ WK $QQXDO %XOO DQG )HPDOH 6DOH 0RXOGLQJDW  1HZVSDSHU $VVRFLDWLRQ DQG PHP fact that he often passed exams in later life nity to gather 7XHVGD\ 0DUFK   SP DW WKH     WIF EHUVKLS GR QRW PDNH DQ\ ZDUUDQW\ with a perfect grade. with his broth- UDQFK1HXGRUI6.:LWKJXHVWFRQ DV WR WKH DFFXUDF\ FRPSOHWHQHVV )25 5(17 ²  DQG EHGURRP VLJQRU 1X+RUL]RQ $QJXV 2IIHULQJ WUXWKIXOQHVV RU UHOLDELOLW\ RI VXFK He was an avid ball player and continued ers, sisters, DSDUWPHQWV LQ 6TXLUH·V &RXUW  %ODFN $QJXV \HDUOLQJ EXOOV SOXV DGYHUWLVHPHQWV )RU JUHDWHU LQIRU 0HOYLOOH$SSOLDQFHVLQFOXGHG3KRQH to play the sport into adulthood. children, and SXUHEUHG IHPDOHV DQG VHOHFW SHQV PDWLRQ RQ DGYHUWLVLQJ FRQGLWLRQV   RU Farm life called to Bill. It was in his blood grandchildren RI FRPPHUFLDO RSHQ KHLIHUV )RU SOHDVH FRQVXOW WKH $VVRFLDWLRQ·V  WIS and along with his Dad and brothers, he was when he PRUH LQIRUPDWLRQ RU D FDWDORJXH %ODQNHW $GYHUWLVLQJ &RQGLWLRQV RQ FRQWDFW &KDG DW  RU RXUZHEVLWHDWZZZVZQDFRP worked hard to help provide for his family. was truly happiest. 7 %DU & &DWWOH &R DW  He also spoke often about the love of cook- Bill was becoming forgetful in the last de-  7R YLHZ WKH FDWDORJXH RQOLQH Notice to Creditors 3529,1&(:,'( &/$66,),('6

ing that he acquired from watching his Mom cade. We called him the Six Million Dollar JRWRZZZ%X\$JURFRP 5HDFKRYHUUHDGHUVZHHNO\ Watch and bid online at:  ,Q WKH (VWDWH RI Vern Appel, &DOO WKLV QHZVSDSHU 12: RU  in the kitchen. 0DQVLQFHKLVNQHHVDQGKLSVZHUHDUWL¿FLDO ZZZ'/06FD 3/  ODWH RI 0HOYLOOH LQ WKH SURYLQFH RI IRUGHWDLOV 6DVNDWFKHZDQGHFHDVHG In the 1950s Bill made his way to Sas- And his diabetes took a toll. He had a great     F NOTICE TO CREDITORS katoon where he worked for Early Seed & sense of humor which never ceased, despite  $OO FODLPV DJDLQVW WKH DERYH Feed, drove cab, and was willing to work at KLVKHDOWKGLI¿FXOWLHV (VWDWH GXO\ YHULILHG E\ VWDWXWRU\ Farmland GHFODUDWLRQDQGZLWKSDUWLFXODUVDQG anything that helped pay the bills. It was in Maryann became ill in 2014 and when YDOXDWLRQ RI VHFXULW\ KHOG LI DQ\ Saskatoon that he met the love of his life, she passed away the following Valentine’s :$17(' 72 5(17 ² )DUPODQG PXVW EH VHQW WR WKH XQGHUVLJQHG Maryann Schimnosky. They were engaged Day, it became apparent that Bill would not QHDU0HOYLOOH&DVKUHQW3UHIHU EHIRUHWKHWKGD\RI0DUFK ),6+(5 6&+0,'7 \HDUWHUP S in a restaurant on 20th Avenue and the ad- be able to live on his own. /$:2)),&(  venture began. They both enjoyed bowling, He took up residence at Westview Man-  %DUULVWHUV 6ROLFLWRUV %R[  curling and socializing with friends. or in 2015 under the loving care of Thelma Auctions WK$YH(DVW 2Q0D\WKH\ZHUHWKH¿UVWFRX and Vince Raczynski and staff. He remained 0HOYLOOH6DVN ple to be married in the new Hubbard church with them until his health concerns became QUICK SOLD AUCTION 6$3 6HUYLQJ 6RXWKHDVW 6DVNDWFKHZDQ (he happily reminded us of this every time overwhelming. At that he made the move to /HWXVKHOS\RXVHOO\RXULWHPVJHW we drove past). The couple began their life Ituna Pioneer Lodge in the summer of 2020. WLQJ\RXWKHEHVWSRVVLEOHSULFHLQ Notice together in Saskatoon. He was generous to a fault. You only had WKHOHDVWDPRXQWRIWLPH,WHPVZLOO JHW&DQDGDZLGHFRYHUDJHZLWKRXU NOTICE Maryann’s sister, Genevieve and her to TRY to pay for a bill when you went for 2QOLQHDXFWLRQ  $QQXDO PHHWLQJ RI WKH 7HWORFN husband made the move to Thompson, dinner to know that it just was NOT hap- 6SHFLDOL]LQJ LQ DQWLTXHV YLQWDJH &RQVHUYDWLRQ DQG 'HYHORSPHQW Man. where the men both began work at the pening. He held strong opinions and let you DQGFROOHFWLEOHLWHPVRIDOONLQGV $UHD$XWKRULW\1R &HUWLILHGSHUVRQDOSURSHUW\DS 1RWLFH LV KHUHE\ JLYHQ WKDW WKH mine. But in 1961, Maryann’s sister, Eleanor, know when he felt passionate about a cer- SUDLVHU'RQ·WWKURZDQ\WKLQJDZD\ $QQXDO 0HHWLQJ ZLOO EH KHOG RQ passed away suddenly. They gave Bill the tain subject. If anyone needed a hand, he XQWLO\RXWDONWRXV 7XHVGD\ 0DUFK   DW  SP choice of leaving and losing his job or stay- was always available, whether it was for ad- )UHHFRQVXOWDWLRQVFDOO ORFDO WLPH 6KRXOG \RX ZLVK WR ing and missing the funeral. There was no vice or a literal “hand” with some project. RU SDUWLFLSDWH SOHDVH FRQWDFW 'HEUD TXLFNVROGDXFWLRQVFRP DW  DQG  LQIRUPDWLRQ choice. That ended Bill’s mining career. To say that he will be missed is a gross 3/ PDWHULDO ZLOO EH HPDLOHG WR \RX LQ %XW HYHQ DIWHU GLI¿FXOW FLUFXPVWDQFHV understatement. S DGYDQFH   there can be opportunities and joy. In 1962 To say that he loved and was loved… is a  /RFDWLRQ RI PHHWLQJ ZLOO EH GHWHUPLQHG RQFH ZH KDYH FRQ their son, William George (Billy) was born blessing to us all. ILUPHG QXPEHUV LQ DWWHQGDQFH and the family moved to Melville where Bill He died peacefully at the Ituna Pioneer 0DVNV DQG VRFLDO GLVWDQFLQJ DV began work with Canadian National Rail- Lodge on Wednesday, Feb. 17, 2021 at the SHU SURYLQFLDO &29,' UHJXODWLRQV UHTXLUHG   road. He took great pride in this career until age of 84, with his brother, Alex, holding his  6HFUHWDU\WUHDVXUHU his retirement in 1993. hand. F 'HEUD3HNUXO In 1967 their daughter, Sharon Marie, Bill was predeceased by his infant daugh- was born and their family was complete. ter Mary; his wife of 54 years, Maryann; In the decades that followed Bill and parents, George and Eva; baby sister Pearl NOTICE Maryann enjoyed a wonderful life. Bill transi- and baby brother Michael in infancy; sisters, tioned from steam locomotives to the newest Ann and Rose; brother John; brothers-in-law, The Tax Enforcement Act models and was admired and respected by Michael Stelmacowich, Russell Stelma- KENNETH JAMES HUNTER his co-workers and superiors. covich, Mel Schlahetka, Sandy Schimnosky, TAKE NOTICE that the Village of Lipton intends to be reg- He built three homes in Melville with Norbert Gerwing, Bernie Loewen and Al- istered as owner under the above Act of the land described skills not many knew he possessed. Two on fred Schimnosky (and son Jason); also as LOT 1-BLK/PAR 15-PLAN ER1478 EXT 0, Title No’s Montreal Street and, of course, their dream sisters-in-law, Clara Saretski (daughter Mary FARMLAND 107587020, 126939280 home on a quarter section of land just a few Frances), Margaret Gerwing (son Doug), miles west of the city. Farming the quarter Eileen Kerr, Frances Loewen, Genevieve WANTED The municipality claims title to the land by virtue of an section on an open-air tractor is where he Uliski and Eleanor Kuzma. interest based on the tax lien registered against the exist- was happiest. Filthy… but happy. This farm He leaves to mourn and giggle while ing title to the land in the Land Titles Registry as Interest I am currenlty Number 170824091, 170824080 and you are required to home became the location for many joyous sharing memories: his son, William (Janis); PURCHASING single TAKE NOTICE that unless you contest the claim of the Christmas, Easter and family celebrations. and daughter, Sharon (James Flett); grand- to large blocks of land. municipality or redeem the land pursuant to the provisions He enjoyed Yahtzee with Eddie Oystreck, FKLOGUHQ 0HODQLH *UHVFKXN ¿DQFp &KULV of the above Act within six months from the service of this and playing cards until all hours of the night +DUNHPD  5REHUW .DF]XU ¿DQFp $VK NO FEES OR notice on you and, subject to the further provisions of The with friends and family. On his last visits, he ley Brisebois), Christopher Greschuk, COMMISISONS Tax Enforcement Act, a certificate of title will be issued to was still skunking whoever had the courage and Brayden Kaczur (Cara Maleschuk); Saskatchewan born the applicant and you will thereafter be forever estopped to take him on in cribbage! brothers, Nick (Martha) and Alex (Diane) and raised, I know and debarred from setting up any claim to, or in respect of, +HHQMR\HGKXQWLQJDQG¿VKLQJDWWKH(Q Greschuk; and many nephews, nieces and land, farming and the land. deavor cabin. Trips with his brothers, friends, friends and family. farmland and can help you every step The amount required to redeem the land may be ascertained and nephews to Ukraine and meeting many The family would sincerely like to thank of the way. on application to the Clerk, Treasurer or Administrator of family members provided many wonderful the owners and staff at Westview Manor and the municipality. For any questions about the tax enforce- experiences and memories. Ituna Pioneer Lodge for loving our Dad like Doug Rue, ment process please contact Taxervice at 1-877-734-3113. He was at every one of Billy’s games he was your own. for further information 306-716-2671 when not working, whether it was ball or Funeral mass was celebrated on Tues- [email protected] Dated this 19th day of February 2021. hockey, and dragged himself to a yearly day, Feb. 23, 2021 at 10 a.m. from St. Hen- www.sellyourfarm Wanda McLeod dance recital for Sharon. His love of coach- ry’s Roman Catholic Church in Melville with land.com Village of Lipton ing and cheering led the family to give up Rev. Father Andrew Sowa OMI as the Cele- their cabin at Crooked Lake in return for brant. The interment followed in the Hubbard social time with friends at local sports days Holy Cross Cemetery, Hubbard, Sask. TAX ENFORCEMENT LIST in the summer heat! In later years, it didn’t ,Q OLHX RI ÀRZHUV WKH IDPLO\ UHTXHVWV TOWN OF LEMBERG matter if it was hockey, ball, lacrosse or Air donations be made to the Hubbard Holy Cadets, they travelled to attend all of Sha- Cross Cemetery, Box 58 Hubbard, Sask., Notice is hereby given under The Tax Enforcement Act that unless the arrears and costs ron’s son’s events. S0A 1J0. appearing opposite the land and title number described in the following list are fully paid He became an avid Snooker player which Arrangements were by Bailey’s Funeral before the April 28, 2021, an interest based on a tax lien will be registered against the earned him senior provincial championships Home, Melville. land. in the early 2000s. He also put his stamp on Note: A sum for costs in an amount required by subsection 4(3) of The Tax Enforcement Act is several trophies at Matty’s pool room when included in the amount shown against each parcel. participating in their Memorial tournament. The social activities, coffees at the King www.baileysfuneralhome.com DESCRIPTION OF PROPERTY $VVHVVPHQW Lot %ORFN 3ODQ([W7LWOH1R 7RWDO $GYHUWLVLQJ 7RWDO$UUHDUV 1XPEHU $UUHDUV &RVWV &RVWV 505007900-01 15 6 62664 152737599 $533.25 $16.63 $549.88 16 6 62664 152737601 $533.25 $16.63 $549.88 17 6 62664 152737612 $533.24 $16.63 $549.87 Subscribe today 505010050-01 16 8 E347 139971796 $1,041.14 $16.63 $1,057.77 17 8 E347 139971820 $1,041.13 $16.63 $1,057.76 505010450-01 25 8 E347 141994255 $801.21 $16.63 $817.84 505015556-01 6 13 E5040 144485220 $1,280.81 $16.63 $1,297.44 for as little as $37.80 a year! 7 13 E5040 144485253 $1,280.82 $16.63 $1,297.45 146626308 1-844-GNG-NEWS – 505049650-01 2 G 65R11845 $850.61 $16.63 $867.24 FRQWDFW#JUDVVODQGVQHZVFD Dated this 28th day of February, 2021. Nancy Duns, Treasurer www.grasslandsnews.ca 0HOYLOOH$GYDQFH‡:KLWHZRRG*UHQIHOO+HUDOG6XQ‡)RUW4X·$SSHOOH7LPHV February 26, 2021 23 Sask Parks campsite reservations set for April

Reservations for the • April 16 - Bronson Moose Mountain The new full-service 2021 camping season Forest, Meadow Lake, Fee changes for 2021 seasonal sites offered at at Saskatchewan’s Pro- Makwa Lake, Lac La include a $1 increase in Greenwater Lake and vincial Parks are set to Ronge nightly electric sites, Meadow Lake provincial begin April 12 for sea- • April 19 - Saskatch- now $33 a night, and a $1 parks are $3,400. sonal campsites and on ewan Landing, Douglas, increase in full-service April 14-23 for nightly Danielson nightly sites, now $43 a All other fees remain and group campsites. • April 20 - Buffalo night. the same from 2020. “With the recent cold Pound, Rowan’s Ravine, snap across the province, Echo Valley, Crooked many folks are antici- lected as the vendor and plete reservation sched- Lake NOTICE OF PREPARATION pating summer and this comes with more than 30 ule is as follows: • April 21 - Cypress year’s camping season,” years of experience pro- • April 12 - Seasonal Hills OF ASSESSMENT ROLL Parks, Culture and Sport viding reservation plat- campsites for all parks • April 22 - Duck Moun- Minister Laura Ross said. forms for government offering seasonal camping tain, Good Spirit Lake, RM of Grayson No. 184 “Our provincial parks park agencies across • April 14 - Pike Lake, Greenwater Lake Notice is hereby given that the assessment roll for the provide many options for North America. The Battlefords, Narrow • April 23 - Candle RM of Grayson No. 184 for the year 2021 has been pre- safe and local summer va- Prior to reservations Hills, Blackstrap Lake, Great Blue Heron, SDUHGDQGLVRSHQWRLQVSHFWLRQLQWKHRI¿FHRIWKHDVVHV cations, with so much to opening, customers sor from 9:00 a.m. to 12:00 p.m. and 1:00 p.m. to 4:00 see and do. Sask Parks should plan to create a p.m. on the following days: Monday to Friday, February staff are looking forward new account once the site 26, 2021 to April 28, 2021. A Bylaw pursuant to section 214 of The Municipalities to welcoming visitors and is available in April. On- Assessment Roll Act has been passed and the Assessment Notices have their families back to the Rural Municipality of Wolseley No. 155 line tutorials will be of- been sent as required. parks for another memo- fered to help guide users Notice is hereby given that the assessment roll of the Any person who wishes to appeal against his or her rable year.” through this process. Rural Municipality of Wolseley No. 155 for the year 2021 has DVVHVVPHQWLVUHTXLUHGWR¿OHKLVRUKHUQRWLFHRIDSSHDO In early 2020, Sask Customers will also been prepared and is now open to inspection at the offi ce of accompanied by a $200.00 per parcel appeal fee which Parks launched a compet- want to note that reserva- the assessor from 8 a.m. until 4 p.m. o’clock on the following days: Monday to Friday, Feb. 26, 2021 to April 26, 2021. will be returned if the appeal is successful, with: itive process for a vendor tions will begin at 7 a.m. A bylaw pursuant to section 214 of The Municipalities Act Secretary of the Board of Revision, that could provide an en- each day - there is no lon- has been passed and the assessment notices have been sent RM of Grayson No. 184, hanced reservation and ger a need to log on at 6:40 as required. P.O. Box 69, Grayson, Sask. S0A 1E0 campground management a.m. in order to be placed Any person who wishes to appeal against his or her system. Aspira was se- in the queue. The com- assessment is required to fi le his or her notice of appeal with: by the 28th day of April, 2021 The Assessor, RM of Wolseley No. 155, Box 370, Wolseley, Sask., S0G 5H0, by the 26th day of April, 2021. Dated this 26th day of February, 2021. Dated this 26th day of February, 2021. Sarah Dietrich, The March N Rose Zimmer, Assessor Assessor atching ite Skie W By James Edgar s TAX TITLE PROPERTY 2021 Assessment Roll for Grasslands News FOR SALE BY Village of Lebret The MoonLVMXVWSDVWIXOO  1RWLFHLVKHUHE\JLYHQWKDWWKHDVVHVVPHQWUROOIRUWKH SKDVHDWWKHEHJLQQLQJRIWKH PUBLIC AUCTION 9LOODJHRI/HEUHWIRUWKH\HDUKDVEHHQSUHSDUHGDQG PRQWK2Q0DUFK6DWXUQ The RM of Cana No. 214 offers for sale the following LVRSHQWRLQVSHFWLRQLQWKHRIÀFHRIWKHDVVHVVRUIURP property: SPWRSPRQ0RQGD\VWR)ULGD\V0DUFK VKDUHVWKHVSRWOLJKWZLWKWKH WR$SULO 0RRQDQGRQWKH0DUFK Civic Address: 15 Main Street, Otthon, SK Legal Address:  $E\ODZSXUVXDQWWR6HFWLRQRIThe Municipalities -XSLWHUKDVWKHKRQRXUVERWK Lot 8, Block 2, Plan W2614 Act KDV EHHQ SDVVHG DQG WKH DVVHVVPHQW QRWLFHV KDYH GHJUHHVDZD\IURP/XQD Lot 9, Block 2, Plan W2614 EHHQVHQWDVUHTXLUHG 0HUFXU\DOVRLVGHJUHHV Lot 10, Block 2, Plan W2614  $Q\SHUVRQZKRZLVKHVWRDSSHDODJDLQVWWKHDVVHVV north of the Moon on March Lot 11, Block 2, Plan W2614 PHQWLVUHTXLUHGWRÀOHDQRWLFHRIDSSHDODFFRPSDQLHGE\ VRDOOWKUHHSODQHWVZLOOEH Lot 12, Block 2, Plan W2614 DWRWKHDVVHVVRUE\SPRQ$SULOWRWKH LQDWLJKWJURXSLQJ²FRXOGEHDJRRGSKRWRRSSRUWXQLW\ The property is five 25’ x 130’ lots and includes a 600 ft² DGGUHVVEHORZ7KHIHHZLOOEHUHWXUQHGLIWKHDSSHDOLV dilapidated building. %\0DUFKWKH0RRQLVGHJUHHVVRXWKRI8UDQXV VXFFHVVIXO The property will be sold on an “as is” basis. The Assessor, Village of Lebret 0DUFKWKVHHV0DUVMXVWGHJUHHVDZD\0DUFK Bidding will OPEN March 20, 2021 and will CLOSE March P.O. Box 40 Lebret, SK S0G 2Y0 VWILQGVWKHFOXVWHU0GHJUHHVQRUWKRIWKH0RRQ 26, 2021 at 5 p.m. through Yorkton Auction Centre at  ,VVXHGDWWKH9LOODJHRI/HEUHWWKLVWKGD\RI)HEUX ZKLFKUHDFKHVIXOOSKDVHRQWKH0DUFK YACauctions.com DU\ Dated this 26th day of February, 2021. MercuryRQ0DUFK-XSLWHULVGHJUHHVQRUWK &DUROLQH0DF0XUFK\$VVHVVRU RQ0DUFKWKH0RRQLVGHJUHHVVRXWKRI0HUFXU\ Kali Tourney, Administrator RM of Cana No. 214 +RZHYHUWKHVSHHG\SODQHWLVSRRUO\SODFHGIRUYLHZ- LQJEHLQJVRFORVHWRWKHKRUL]RQDWVXQULVH²PRUHRID 6RXWKHUQ+HPLVSKHUHREMHFWWKDQIRUXVQRUWKHUQHUV VenusLVWRRFORVHWRWKH6XQWREHVHHQ MarsEHFRPHVYLVLEOHLQWKHVRXWKZHVWDWVXQGRZQ NOTICE OF PREPARATION DPRQJWKHVWDUVRI7DXUXVGULIWLQJRIIWRWKHZHVWDVWKH Prairie Co-op is hiring a Pharmacy Manager to join and lead our HYHQLQJSURJUHVVHV7KH0RRQSDVVHVE\RQ0DUFK OF ASSESSMENT ROLL Pharmacy team based out of our brand-new Food Centre in WRMXVWGHJUHHVWRWKHVRXWK2Q0DUFK0DUV Melville, SK. LVGHJUHHVQRUWKRI$OGHEDUDQWKHEULJKWVWDULQ+\DGHV Town of Wapella What you will do: FOXVWHU JupiterLVRQHRIDJURXSRIWKUHHSODQHWVOLQLQJXS As the Pharmacy Manager, you are responsible for developing 1RWLFH LV KHUHE\ JLYHQ WKDW WKH $VVHVVPHQW the strategic plan and overseeing the operations of the Pharmacy DORQJWKHHFOLSWLFVWUHWFKLQJRIIZHVWRIWKH6XQLQWKLV Department at our Melville Food Centre. In this leadership role, RUGHU0HUFXU\-XSLWHUDQG6DWXUQ$VQRWHGDERYH 5ROOIRUWKH7RZQRI:DSHOODIRUKDVEHHQ you will: 0HUFXU\LVDWRXJKRQHWRVHHEXW-XSLWHUDQG6DWXUQDUH SUHSDUHGDQGLVRSHQIRULQVSHFWLRQLQWKH ‡ Oversee and monitor the budget, people resources and HDV\WDUJHWV2Q0DUFKWKHWKLQFUHVFHQW0RRQVOLGHV inventory within the pharmacy. 2IILFH RI WKH $VVHVVRU RQ WKH IROORZLQJ GD\V ‡ Develop, implement, and maintain policies and procedures that E\-XSLWHU DQGWLPHV comply with legislation, bylaws and regulations, as well as SaturnLVSDUWRIWKHHFOLSWLFWULRGHVFULEHGDERYHZLWK accrediting body standards. WKH0RRQSDVVLQJE\RQ0DUFK Monday to Wednesday, 9 a.m. to 4:30 p.m. ‡ Provide leadership, guidance and mentorship to the pharmacy Uranus KDQJVLQWKHZHVWHUQVN\DWGXVNDPRQJWKH and Thursday, 9 a.m. to 3:30 p.m. team. VWDUVRI$ULHV7KH5DP2Q0DUFKWKH0RRQLV ‡ Provide patient focused services and professional advice/ from Thursday, February 25, 2021 counselling on prescriptions and over-the-counter medications, GHJUHHVWRWKHVRXWKRIWKHJUHHQEOXHSODQHW to Monday, April 26, 2021. and health related issues to patients. NeptuneLVWRRFORVHWRWKH6XQWREHVHHQ ‡ Develop and maintain strong working relationships with health  7KH=RGLDFDO/LJKWLVYLVLEOHLQWKHZHVWDIWHUHYHQLQJ care professionals in the community to ensure optimal patient WZLOLJKWIRUWKHILUVWWZRZHHNVRI0DUFK care. $ E\ODZ SXUVXDQW WR VHFWLRQ  RI The ‡ Develop, monitor, and report on key performance indicators  'D\OLJKW6DYLQJ7LPHEHJLQVRQ0DUFK7KHYHUQDO Municipalities ActKDVEHHQSDVVHGDQGWKH (KPIs) and identify areas for improvement. HTXLQR[RFFXUVRQ0DUFKDW87 DVVHVVPHQWQRWLFHVKDYHEHHQVHQWDV Who you are: UHTXLUHG ‡ You have a Bachelor of Science in Pharmacy (B.Sc.Phm), or a Doctorate in Pharmacy (Pharm.D.) from a recognized institution. WANTED ‡ You have experience in pharmacy, with exposure to leadership. Canadian Prairie Pickers $Q\SHUVRQZKRZLVKHVWRDSSHDODJDLQVWKLV ‡ You have injection certification and current licensure, and good RUKHUDVVHVVPHQWLVUHTXLUHGWRILOHKLVRUKHU standing with the provincial College of Pharmacists. DEAD OR ALIVE are once again touring the area! ‡ You have strong leadership, communication, and organizational 1RWLFHRI$SSHDOZLWK skills. Our Team Members receive competitive salaries, a Paying Cash For Coin Collections, The Assessor, Town of Wapella comprehensive benefits package and an employer-contributed Silver & Gold Coins, Royal Can. Mint Sets. P.O. Box 189, Wapella, SK S0G 4Z0 pension plan. Relocation support is available. Also Buying Gold Jewelry by the 26th day of April, 2021 For more information regarding this opportunity, please visit our Careers website at https://www.prairieco-op.crs/sites/ We purchase rolls, bags or boxes of silver coins 'DWHGWKLVWKGD\RI)HEUXDU\ prairie/careers, or contact us at [email protected]. $ $ PAYING HIGHEST PRICES Tammy Skiba How to Apply? $ To arrange a free, discrete in-home visit call Assessor Please send your cover letter and updated resume to Bonded since 1967 Kellie at 1-778-257-8647 [email protected] by March 7, 2021. 24 February 26, 2021 )RUW4X·$SSHOOH7LPHV Grasslands News

THE ALL NEW MELVILLE SARCAN

1660 QUEEN STREET AND WE CAN’T KEEP OUR EXCITEMENT BOTTLED UP!

BETTER DROP & GO! BIGGER BUILDING! FASTER SERVICE!

COME ON IN AND VISIT US! MON - FRI | 8:30 AM - 4:30 PM