Annual Report 2017 Malteser International for a Life in Health and Dignity Contents

Annual Report 2017 Malteser International For a life in health and dignity Contents

3 Our impact in 2017 Who we are:

Malteser International is the international humanitarian 10 Looking ahead: Interview with relief agency of the Sovereign Order of Malta – a Catho- Thierry de Beaumont-Beynac, lic religious order with a history of over 900 years of Ingo Radtke and Sid Johann Peruvemba dedicated work for the poor and sick. 14 Our global presence What we do:

We provide emergency relief in crises such as natural Our work worldwide: EJTBTUFST FQJEFNJDT BOEBSNFEDPOmJDUTBTXFMMBTJN- 15 Africa plementing long-term transitional aid and development. 22 Middle East We work to provide functioning medical structures and 27 Asia to protect health by supporting good nutrition, safe wa- 34 Europe ter, sanitation, and hygiene. We also aim to boost the 36 America resilience of vulnerable people by encouraging disaster risk reduction. Financial Report: 41 Secretary General’s Report How we work: 44 Transparency Founded on Christian values and humanitarian princip- 45 Quality les, our work now encompasses more than 100 projects 46 Financial overview 2017 in 28 countries, helping people in need without distin- 50 Annual accounts 2017 guishing race, religion, or political conviction. 52 Our donors and partners 54 Our structures 57 Our member organizations Publication details 4-year-old Linda Rasho (center) was born in Bersevi-2, a refugee camp in northern Iraq. She still lives in the camp with her family. PHOTO: IDA

Because people who have lost everything to conflict and disaster need a roof over their heads, sufficient food and water 202,000 of them received food, water, clothing, toiletries, and/or emergency shelter. 30-year-old Rajuma (name changed) received medical treatment from our staff in Bangladesh after fleeing violence in her village in Myanmar. PHOTO: NOOR AHMED GELAL

Because we refuse to accept the suffering that comes with sickness and injury 1,650,000 patients were treated in medical facilities with our support all over the world. Many people in northeastern Nigeria are facing severe drought conditions. 9-year-old Aisha Umar is happy to quench her thirst from a solar-powered water pump we helped install in Maiduguri. PHOTO: EMILY KINSKEY

Because clean water is a pre- requisite for a healthy life

192,000 people had access to clean drinking water thanks to our projects. 8-year-old Ali Mubarak from Juba, South Sudan is eager to learn in school. He gets a free lunch meal at school every day. PHOTO: NYOKABI KAHURA

Because an empty stomach hampers the carefree child- hood every kid deserves 5,000 school children in South Sudan received a warm meal at school every day – another 17,000 malnourished children under the age of ﬁve underwent intensive nutritional therapy 10 Malteser International Annual Report 2017 Looking Ahead earnestly enforced” “Protections forciviliansmustbe ahead Looking UFTFS*OUFSOBUJPOBMJTQPTJUJPOJOHJUTFMGGPSUIFGVUVSF 7JDF4FDSFUBSZ(FOFSBM 4JE+PIBOO1FSVWFNCBFYQMBJOJOBOJOUFSWJFXIPX.BM PVS1SFTJEFOU 5IJFSSZEF#FBVNPOU#FZOBD 4FDSFUBSZ(FOFSBM *OHP3BEULF BOE IVNB JDTnUIFHMPCBMDPNNVOJUZJTTUSVHHMJOHUPlOETPMVUJPOTUPUIFNPTUQSFTTJOH 8JEFTQSFBEWJPMFOUDPOmJDUT GPSDFEEJTQMBDFNFOU OBUVSBMEJTBTUFST BOEFQJEFN- OJUBSJBOJTTVFTGBDJOHPVSXPSMEUPEBZ8JUISFTQFDUUPUIFTFDIBMMFOHFT

- conditions inplace forhostingrefugees. situation, Ihope thathostcountrieshavereasonable their homeland–foranyreason! If,however,thisisthe tion, mywishisthatby2030nobody isforcedtoleave Radtke: Withregardtotheworldwiderefugee situa- standards. differences, butalsointermsoftheirideasandmoral – notonlyintermsoftheirstillenormouseconomic and thepoorcountriesofGlobalSouthreduced see thegapbetweenrichcountriesofGlobalNorth earnestly enforced!Ialsohopethatinthefuturewewill PGUIFTFDPOmJDUT1SPUFDUJPOTGPSDJWJMJBOTNVTUCF the mostvulnerableandinnocentbearbrunt suffering inmanyregionswherewework.Asalways, XJMM7JPMFOUDPOmJDUTBOEXBSTBSFUIFNBJODBVTFTPG Humani DBMSFTPMVUJPOTUPUIFNBOZDPOmJDUTXFGBDFUPEBZ Peruvemba: Ihopeforswiftandsustainablepoliti- when wemetthem. leave thepeoplewithwhomweworkbetteroffthan alleviate sufferingaroundtheworld–ourgoalisto tional, wewanttocontinuehelppeopleinneedand es, andhunger.RegardingourworkatMalteserInterna- people sufferingfromtheconsequencesofwars,diseas- de Beaumont-Beynac:Iwishtherewouldbefewer you liketoseeintheworldbyyear2030? If youcouldmakeawishwhatchangeswould tarian aidshouldnothavetoreplacepolitical African countries havealsoshownpositivedevelop - countries likeVietnam, Cambodia,andThailand. Many been takenoverbylocalinstitutions. Thisisthecasein we recognizethatourworkisno longerneededorhas increasingly closingdownourproject locationsbecause nomically abletostandontheir owntwofeet.Weare VTFEUPCFDMBTTJDCFOFlDJBSJFTPGBJEBSFOPXFDP- Peruvemba:1BSUJDVMBSMZJO"TJB NBOZDPVOUSJFTUIBU tinues tomoveinapositivedirection. due totheseverehungercrisisinAfrica,trendcon- this period.Althoughnumberroseagainlastyear GSPNTUBSWBUJPOIBTBMTPTJHOJlDBOUMZHPOFEPXOEVSJOH has beencutinhalf.Thenumberofpeoplesuffering 1990, thenumberofpeoplelivinginabsolutepoverty the developmentisactuallypositiveonwhole.Since de Beaumont-Beynac:Lookingattheoverallsituation, I don’tthinkdiplomacyhasbeenappliedeffectively. ment. Currenteffortsseemrathertriteandineffectual. Peruvemba:1PMJUJDBMMZ XFBSFIBSEMZTFFJOHBOZNPWF- forward? progress. Isthereanyreasonforhopegoing At themoment,theredoesnotseemtobemuch ple sufferedunderthemostabjectconditions. 2017 wasanotheryearinwhichmillionsofpeo- mass exodusoftheRohingyafromMyanmar. and Mosul,aseverefoodcrisisinAfrica,the Last year,wesawtheviolentbattlesforAleppo INTERNATIONAL PHOTO: MALTESER forcibly uprooted. worldwide havebeen Nearly 70millionpeople Tal AfarregioninIraq. Displaced personsinthe 11 12 Malteser International Annual Report 2017 Looking Ahead who havebeendisplaced. can satisfactorilyandeffectivelybringhelptopeople framework conditionsforourworkthroughwhichwe them futureprospects.Thesecountrieshavecreated made tosuitablyaccommodaterefugees,andgive system. InUgandaandLebanon,greateffortsarebeing Turkey, forexample,hasanexcellentrefugeesupport ing verygoodapproachesincertainprojectcountries. Radtke: Whenwelookattherefugeecrisis,aresee- and en CSJOHTBCPVUOFXDPOmJDUTPWFSSFTPVSDFEJTUSJCVUJPO class, whichononehandisablessing,buttheother ment. Globally,wearewitnessingagrowingmiddle themselves how tospendtheirmoney.Thisalso means distribution measuresthatallow peopletodecidefor PGDIPJDF5IJTBQQSPBDIJTFYFNQMJlFEJOPVSDBTI work. Forus,dignityheremeans givingpeoplefreedom people leadalifewithhealthand dignitythroughour PGEJTQMBDFNFOU JOUIFlSTUJOTUBODF XFTUSJWFUPFOBCMF refugee emergenciesistohelperadicatetherootcauses Radtke: Whileourlong-termgoalinthefaceofglobal society. a newpeacemovementthatencompassesallsectorsof DVSJUZ$PVODJMJOUIFDBTFPGTJHOJlDBOUXBSDSJNFT BOE things: suspensionoftherighttovetowithinUNSe- PGUIFXPSMETDJWJMJBOQPQVMBUJPO8FOFFEUXPTQFDJlD I seethisasasocialandmoralprojectfortheprotection lishment andimplementationofpeacefulsolutions? to askourselves:Whoiscurrentlyobstructingtheestab- tics, anthenareturntomoredecisiveaction.Wehave Peruvemba: Therehastobeaparadigmshiftinpoli- wishes? in ordertobeonestepcloserrealizingyour for thefuture–whatwouldhavetotakeplace a changeinMalteserInternational’sdirection More politicalsolutions,lessdisplacement,or vironmental challenges. PHOTO: ORDREDEMALTEFRANCE processes toinclude communitiesinregionswhere we in localstructures,butrathershifting decision-making tive. Thisdoesnotmeansimply investingmoremoney UIFTFlOEJOHT acquired informationandimprovefutureprojectsusing dures withinourorganizationinordertoprocessthe It isalsoimportantforustoestablishlearningproce need foroptimizationinthecollectionofreliabledata. project cyclemanagement,andthereisacontinuous Monitoring andevaluationarekeycomponentsofour UVSFTBOEDSFBUJOHBCSPBElOBODJBMCBTFGPSUIFGVUVSF deliver high-qualityaid,whileoptimizingourstruc this meansthatweneedtoensurecontinue we needtoreinventourselvesfacethefutureand Peruvemba: DSJUJDBMlSTUIPVSTBOEEBZTBGUFSBEJTBTUFS XJMMFOBCMFVTUPSFTQPOETXJGUMZBOEFGlDJFOUMZJOUIF full durationofanemergencyintervention.TheEMT vide allmaterialsforthetreatmentofpatients Emergency MedicalTeamwillalsoberequiredtopro- must beabletotreatatleast100patientsperday.The in theimmediateaftermathofadisaster,wherethey logistics specialists)willbedeployablewithin72hours This teamofhealthprofessionals(doctors,paramedics, &.5 DFSUJlFECZUIF8PSME)FBMUI0SHBOJ[BUJPO of 2018,weplantohaveourEmergencyMedicalTeam expansion ofouremergencyreliefcapacities.Bytheend de Beaumont-Beynac:Animportantaspectisthe opments? itself forthefutureintermsofstructuraldevel- How doesMalteserInternationalplantoposition Thierry deBeaumont-Beynac,PresidentMalteserInternational BSPVOEUIFXPSMEv JOOFFEBOEBMMFWJBUFIVNBOTVGGFSJOH h8FXBOUUPDPOUJOVFUPIFMQQFPQMF oriented, thengreaterdecentralization ofaidisimpera de Beaumont-Beynac: tantly –duringbrainstorming. the planningphaseofourprogramsand–mostimpor- that wehavetoinvolveaffectedpeoplemuchearlierin Ifourworkistobecomemore people- Attheorganizationallevel, - - - meet therequirementsandstandardsofourinstitu- and riskmanagementsystems.Wemustcontinueto our workaswelltotheestablishedinternalcontrol ensures compliancewiththedirectivesapplicableto areas ofourworkaroundtheworld.Thedepartment Additionally, ourinternalauditdepartmentinspectsall ations ensureourprogramsadheretothesestandards. such asregularprojectmonitoringandstringentevalu- national qualitystandards.Internalcontrollingsystems transparency, andhavepledgedtomeetvariousinter- Peruvemba: Wearecommittedtoahighlevelof within ourprojects? we ensureacontinuedhighstandardofquality plies lesscontrolfromheadquarters.Howdo A greaternumberoflocalstructuresalsoim- enterprises. partnerships withlocalyouthorganizationsandsocial we knowit.Inthefuture,willlooktostrengthen Finally, wehavetothinkbeyondtheconceptofaidas decisions evenifwehaveadifferenceofopinion. they needtomeettheirneedsandacceptingthese work, allowingthesecommunitiestodecidewhat Ingo Radtke,SecretaryGeneralofMalteserInternational WBMVFTv EBSET CVUUIBUUIFZBMTPFNCPEZPVS POMZJOUFSOBMJ[FPVSNFUIPETBOETUBO h*UJTFTTFOUJBMUIBUPVSFNQMPZFFTOPU - UIFZBSFDMFBSMZSFmFDUFEJOUIFJSXPSL employees feelcomfortablewiththesevaluesandthat of charityandneighborlylove.Itisimportantthatour ty, andindependence,butabovealltoChristianvalues to thehumanitarianprinciplesofimpartiality,neutrali- Catholic reliefagencythathascommitteditselfnotonly and standardsbutalsoembodyourvalues.Wearea worldwide notonlyinternalizethevariousmethods Radtke: Itisalsoimportanttousthatouremployees for thecontinuousdevelopmentofourprograms. These additionalcontrolmechanismsareveryimportant of ourworkevenmoreeffectivelywithinplanning. MPDBMBDUPST)PXFWFS XFOFFEUPJODMVEFCFOFlDJBSJFT strengths, forexample,regardingtheinvolvementof found onpage45ofthisreport.Itclearlyhighlightsour nUIFlSTUSFTVMUTPGUIFFWBMVBUJPODBOCF 4UBOEBSE according totheprinciplesofCoreHumanitarian ed acomprehensiveprocesstoevaluateourprojects de Beaumont-Beynac:Overthepastyear,weinitiat- their donations. have alegitimateinterestinknowingwhatisdonewith UJPOBMEPOPSTUPXBSEPVSQSPKFDUT1SJWBUFEPOPSTBMTP Malteser International Sid JohannPeruvemba,ViceSecretaryGeneralandProgramDirectorat UIBUTQBOTBMMTFDUPSTPGTPDJFUZv h5IFSFNVTUCFBOFXQFBDFNPWFNFOU PHOTO: FRANKLÜTKE PHOTO: JILLFLUG 13

5 4 3 2 1 14 3 5

USA Peru Mexico Haiti Colombia Americas Malteser International Annual Report 2017 Worldwide 4 1 2 Our globalpresence:

7 6 Ukraine Germany Europe

15 14 13 12 11 10 9 8 Uganda Tanzania South Sudan Nigeria Kenya Guinea DR Congo Burundi Africa 10 12 6 9 8 13 15 17 7 14 19 11 18 16

19 18 17 16 Turkey Syria Lebanon Iraq Middle East 25 22

Project countriesasof July2018 28 27 26 25 24 23 22 21 20 24 Vietnam Thailand Philippines Pakistan Nepal Myanmar India Cambodia Bangladesh Asia 20 23 27 21 28 26 BWBJMBCMFUISPVHIPVUUIFSFHJPO BSFTUSFOHUIFOJOHPVSMPOHUFSNFGGPSUTUPFOTVSFUIBUBQQSPQSJBUFIFBMUIDBSFJT BSFTQFDJlDUPFBDISFHJPO CVUUIFTJUVBUJPOJTTUJMMDSJUJDBM"UUIFTBNFUJNF XF UIFBGGFDUFEDPVOUSJFTUPDPNCBUIVOHFSBOEJUTJNQBDUFNQMPZJOHTUSBUFHJFTUIBU JUBSJBODSJTJTTJODFUIFFOEPGUIF4FDPOE8PSME8BS8FBSFXPSLJOHJONBOZPG DPOmJDUDBVTFBNBKPSGPPEDSJTJTJO"GSJDBJOXIBUXBTUFSNFEUIFXPSTUIVNBO QSPWJEFUIFNTFMWFTXJUITVGlDJFOUGPPEnTBXQSPMPOHFEESPVHIUTBOE .PSFUIBONJMMJPOQFPQMFJOOJOF"GSJDBODPVOUSJFTXFSFOPMPOHFSBCMFUP The worsthumanitariancrisis since theendofWorldWarII Africa

- 15 and Cameroon, for example, we provided emergency relief with an emphasis on the treatment of undernour- 30,000 South Sudan ished children, while improving acess to clean water and sanitation facilities for about 173,000 people. 15 In northern Kenya, we distributed cash, food vouchers, and food to 43,000 people in regions devastated by the drought. The major advantage of distributing Africa cash instead of relief supplies is that people can decide 16 for themselves how they wish to spend their money. 600 Uganda Kenya 17 According to Hansen, when the people buy from local DR Congo shops, we achieve the double impact of supporting the local economy. “We tested mobile money transfers with a group of women in Kenya, and we were very pleased with the results. Many families spent the money they received on food and on their children’s education,” Tanzania Hansen says. During the year, millions of civilians in South Sudan 9,000 100,000 DPOUJOVFEUPCFBSUIFCSVOUPGWJPMFODFBTDPOmJDUFTDB- lated in many areas of the country. We were on hand Relief for South Sudanese refugees and host

Malteser International Annual Report 2017 to respond to the resulting food insecurity and related communities of northern Uganda emergencies. Our intervention reached over 150,000 Goal: Improved health and living conditions for South people, including school children, pregnant women Sudanese refugees and host communities in the and nursing mothers. “By early 2017, the biting food West Nile region of northern Uganda During the food crisis n 2017, the Horn of Africa experienced one insecurity in South Sudan had put thousands of people Our 20 motorized boreholes provided daily access to in northern Kenya of the worst periods of drought in decades. in the country on the cusp of death by starvation,” says achievements clean drinking water for 30,000 people, 15 fruits we provided food, Many months of depressed rainfall yielded 6,060 1,052 Hansen. “Fortunately, the international community in 2017: and vegetable garden grown, 100,000 trees were cash aid and prepaid I Ethiopia planted to combat deforestation, over 9,000 water vouchers for affected poor harvests, and when the long-desired reacted swiftly to mobilize an immediate response and cannisters were distributed to households, and populations. SBJOTlOBMMZDBNF UIFZCSPVHIUEFWBTUBUJOHTUPSNTBOE the catastrophe was averted.” more than 600 latrines constructed PHOTO: NYOKABI KAHURA mPPET DBVTJOHBEEJUJPOBMEBNBHFUIBUXBTIFEBXBZ "DDPSEJOHUPUIF6OJUFE/BUJPOT0GlDFGPSUIF$PPS- Somalia Donors: AA, ADH, BMZ, ECHO, PRM and ZOA homes and crops. More than 12 million people were dination of Humanitarian Affairs (OCHA), approximate- affected by the disaster – in July 2017 alone, over 3.5 Uganda MZCJMMJPOXFSFTQFOUJOUPlHIUGPPEJOTFDVSJUZ Outlook Increased focus in climate change adaptation for 2018: and protection of biodiversity. For example, raising million people in Kenya became reliant on humani- Kenya in Africa and Yemen. youth awareness on environmental issues through tarian aid for survival. “The effects of the drought are sporting activities and social clubs, establishing the still being felt: despite the rain, water reservoirs are From emergency aid to promoting self-help: “Water Network of Rhino Camp” to ensure local Traditional survival strategies put to the test and independent maintenance of water infrastruc- OPXIFSFOFBSSFlMMFE lFMETDBOOPUCFDVMUJWBUFE BOE 27,156 tures, and cooperating with companies in the ﬁeld farm animals are only slowly recovering,” says Roland Tanzania Following the acute emergency response phase, we de- of sustainable building materials to create jobs. Hansen, Head of Malteser International’s Africa Depart- sign our programs to combat the resulting consequenc- ment. 3,500 9,300 es of the crisis, and address its root causes as far as we In many countries, the alarming food insecurity is can. In doing so, we strive to leave the people we assist What we do in the long term: one goal, regional NBJOMZDBVTFECZWJPMFOUDPOmJDU*OUIF%FNPDSBUJD stronger and better prepared for future crises. solutions Drought relief with emphasis on Cash Transfer Republic of the Congo and countries in the Lake Chad “This means increasing the resilience of people in Uganda, for example, was not directly affected by the region (Nigeria, Cameroon, Niger, and Chad), many Goal: Food and nutrition security for nomads affected by "GSJDBTDPOmJDUBOEESPVHIUQSPOFSFHJPOT v)BOTFO food crisis of 2017, but the country reached the limits the drought in northern Kenya people have lost their livelihoods due to violence and DPOUJOVFTh$POmJDUTBSFUIFESJWFSTPGGPPEDSJTFTJO of its coping capacities as it welcomed over one million forced displacements. Since 2013, South Sudan has Our 3,500 people were provided with clean drinking NPTUDPVOUSJFT BOESFTPMWJOHUIFTFDPOmJDUTJTUIFNPTU refugees from neighboring South Sudan. The construc- CFFOJOUIFHSJQTPGBDJWJMXBS BOEOFBSMZlWFNJMMJPO achievements water, 9,300 people received cash aid, 27,156 important step in addressing the root causes. However, tion of new refugee settlements also led to serious envi- in 2017: people received food vouchers, 6,060 persons people faced the prospect of starvation in 2017. The received portions of meat and 1,052 malnourished this demands a political solution, and we only have very ronmental degradation. Hundreds of thousands of trees situation was no less critical in Nigeria and Cameroon, children were provided with protein-rich food limited possibilities in this area.” were cut down to create space for shelter, farmland and supplements XIFSFNPSFUIBOlWFNJMMJPOQFPQMFXFSFEFQFOEFOU We are already working with the local population wood for cooking. on food aid for their daily survival. Donors: ADH, Futur 21, NiN, private donations, in regions that have been affected by the food crisis to In this situation, environmental protection and res- The Cologne House of Senate revive agricultural production. First, we analyze present toration activities play an important role in safeguard- Alleviating suffering, tackling the effects of the Partner: PACIDA traditional survival strategies, and then we adapt these ing food security for refugees and the local population crises strategies to the new climatic and social conditions on alike. To reverse environmental degradation in various 0VSlSTUPCKFDUJWFJOBOBDVUFFNFSHFODZJTUPTBWFMJWFT Outlook Regional expansion of Cash Transfer project ground. This leads to a range of aid measures that vary refugee settlements, we started a tree planting program for 2018: and care for people who have been affected. In Nigeria from region to region. that led to the growing of over 100,000 trees including 4FFQBHFTBOEGPSBCCSFWJBUJPOTMJTU mahogany, mango and papaya. “In addition to this, we are working to raise public awareness in various as- Central African Republic 43,000 pects of environmental conservation, while supporting UIFQFPQMFUPlOEBMUFSOBUJWFJODPNFPQQPSUVOJUJFTv says Hansen. Congo Uganda Kenya In Kenya, we employ a different approach in our work with nomads living in areas often affected by DR Congo drought. Traditionally, people in these areas raise Africa Tanzania livestock for a living, but successive periods of drought 18 have forced many to leave their homeland in search of 19 good pasture. “Our work here is focused on preparing the local population for the impacts of climate change 160 Angola Zambia by supporting them with new income opportunities 700,000 so that they can continue to live in their homeland,” explains Hansen. “One way we try to strengthen their Providing healthcare for displaced persons from the resilience to climate change is by encouraging livestock forgotten crises regions of DR Congo and Tanzania EJWFSTJlDBUJPOUPJODMVEFBOJNBMTNPSFSFTJTUBOUUP Goal: Improved access to quality healthcare for local droughts.” communities and refugees in nine health centers in the DR Congo and reduced maternal mortality for The challenge: Providing help in forgotten crises refugees from Burundi in Tanzania

Malteser International Annual Report 2017 One challenge we face in our work remains the in- Our Technical and ﬁnancial support of 160 health TVGlDJFOUMFWFMPGBJEEJSFDUFEUPIVNBOJUBSJBODSJTFT achievements centers, medical treatment for 700,000 patients, in 2017: 43,000 newborns in supported health facilities, in countries that receive limited public attention. An and construction of a new center for operative care example is the Democratic Republic of the Congo, where and birth assistance the healthcare system is poorly developed as a result “Another example of a forgotten crisis country is Burun- The “M” stands for mobile and “Afya” is Kiswahili for Refugees from Burun- Donors: AA, ADH, BMZ and EU PGNBOZZFBSTPGDPOmJDU*OOJOFIFBMUI[POFTJOUIF di,” says Hansen. “After the unrest in April 2015, more health. In Uganda, we are working with various partners di in Mtendeli Camp, Tanzania, where we Partners: CAAMENIHU, EUP FASS, Kolping Tansania, The provinces of Ituri, Haut-Uélé, and Bas-Uélé in the UIBO QFPQMFmFEGSPN#VSVOEJUPOFJHICPSJOH to strengthen emergency medical care in the country by built a maternity unit. Red Cross Tanzania, national and local health northeastern region of the country, our work is focused countries Tanzania, DR Congo, Rwanda, and Uganda. training paramedics. PHOTO: KOLPING TANZANIA institutions on improving basic healthcare. We do this by providing 1FPQMFTUJMMOFFEVSHFOUBTTJTUBODF*UJTPVSBTQJSBUJPO Solutions to the challenges faced in many African medicines and medical equipment for health centers Outlook New project in Burundi will expand aid to include and our mission to provide help, even in these crises.” countries can only be reached through effective partner- for 2018 people affected by the crisis in the country. and hospitals, supporting the renovation and construc- DR Congo: Supplementary measures in the ﬁeld of In Tanzania, where over 250,000 Burundian refugees ships, not only with grassroots organizations but also with tion of health facilities, and training health personnel. water, sanitation and hygiene for refugees. now reside in the northwestern part of the country, the private sector. In Africa, development efforts have Our aid activities in the DRC reached about 1.5 million Tanzania: Construction of an additional maternal mortality is a major problem. 45,000 refugees become interconnected, and various organizations have maternity clinic. people in 2017. live in Camp Mtendeli, and healthcare for expectant to work in close cooperation with one another to bring mothers is extremely precarious – especially with regard about a meaningful impact. “The challenges and tasks are Roland Hansen, Head to birth-related complications. In May 2017, we were simply too complex to manage alone.” Hansen concludes. of the Africa Depart- able to complete the construction of a center for surgical ment, during a project visit to Uganda. obstetric acute care. The procedures – mainly caesarean Cash assistance for Planting trees is one sections – are now carried out free of charge by highly vulnerable families proved to be an way we are helping to RVBMJlFE5BO[BOJBOEPDUPSTGSPNUIF/BUJPOBM3FE combat deforestation effective form of aid in the country. $SPTT4PDJFUZ CFOFlUUJOHCPUISFGVHFFTBOENFNCFST during the drought in Kenya. PHOTO: PETER PAULS of the local community. Since operations started in the PHOTO: NYOKABI KAHURA clinic, more than 300 babies have been delivered by caesarean section.

Outlook: Expanding networks, strengthening partnerships The hunger crisis in Africa is far from over. “Even in 2018, we are prepared to respond to expected famine conditions in South Sudan and Kenya,” says Hansen. “However, we are not losing sight of our long-term development goals.” In Kenya, for example, our neonatal health project pro- WJEFTQSFHOBOUXPNFOXJUIBmFYJCMFlOBODJOHQMBOGPS their delivery, allowing them to make pre-payments for hospital fees using a mobile-based system called M-Afya. 20 3 2 1 Projects implemented by nation- Emergency Fund International Children‘s UNICEF: UnitedNations Refugees, andMigration PRM: BureauofPopulation, OMF: OrdredeMalteFrance Relief Coalition NiN: NachbarinNot– ForgottenPeople GFFP: GlobalFundFor New Diagnostics FIND: Foundation for Aid Operations Protection andHumanitarian ECHO: EuropeanCivil Challenge Fund CICF: CountyInnovation Cooperation andDevelopment Federal MinistryforEconomic und Zusammenarbeit–German Wirtschaftliche Entwicklung BMZ: Bundesministeriumfür AMREF: AmrefHealthAfrica – Germany’sReliefCoalition ADH: AktionDeutschlandHilft Foreign Ofﬁce AA: AuswärtigesAmt–German Abbreviation listofdonors: International with supportfromMalteser local partnerorganizations Projects implementedby International with supportfromMalteser of theSovereignOrderMalta al Associationsandaidservices organizations teser Internationalandpartner Projects implementedbyMal- Malteser International Annual Report 2017 Africa Innovative Austria’s (including otherfundsfromcontractsalreadybookedinthepreviousyear) Total expenses2017: ¤14,915,459|Previousyear:9,567,803Regionalcosts:278,288 Our programsin2017 Expenses 2017 Country Expenses 2017 Country Expenses 2017 Country Expenses 2017 Country ¤ 53,121 Madagascar ¤ 2,878,986 Kenya ¤ 667,097 Guinea¹ ¤ 4,849,375 DR Congo¹ 1, 3 2 1 14 1 4 projects No. of projects No. of projects No. of projects No. of Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription – German-kenyanmulti-stakeholderinitiativeforhealthexperts1 Nationwide: – Electionpreparednessinurbanfocalpoints,Kenya2017 – – – – InvestingforimpactagainsttuberculosisandHlVinNairobicounties – M-Afya(InnovativehealthcareinNairobiinformalsettlements) Nairobi andKisumu: – Marsabit County/KenyaandOmorate/Ethiopia: – Maroantsetra (RegionAnalanjirofo,Province Toamasina): – – – – Marsabit County: – – – Bas-Uéle Province: – – – Ituri andHaut-UéléProvinces: on epidemicpreventionaftertheEbolaemergency Improving accesstohealthcareincentralGuineawithaspecialfocus 2017 toDecember Cholera emergencyhealthresponseproject,NairobiCounty,August health professionals German/Kenyan MultistakeholderPartnershipInitiativeforspecialized Diseases ininformalsettlementsofNairobi,Kenya Innovative approachtoimprovedManagementofNon-Communicable affected bydroughtinnorthernKenyaandsouthernEthiopia Cross-border foodsecuritysupportforvulnerablenomadsinareas part ofBondo Improving accesstohealthservicesintwozonesthenorthern ics health withaspecialfocusonthepreventionandresponsetoepidem Improving watersupply,sanitationandhygieneconditionsforbetter nutrition, andprevention ofwater-bornediseases) Enawo -Aidincludedprovisionofhealthcare, psychosocialsupport, and AnkofaLavacommunesinMaroantsetra districtaftercyclone Supporting reconstructionandstrengthening resilienceinMariarano Basic alphabetizationwithliverelevantmaterialsinformofebooks Resilience strengtheningofpastoralistswomengroupsthroughdigital drought inMarsabitcounty,northernKenya Mobile phonecashtransferprogrammingforfamiliesaffectedby County, northernKenya Drought interventionforsemi-nomadiccommunitiesinMarsabit madic pastoralistsinnorthernKenya Climate changeadaptationandresourceconservationforsemi-no- Healthcare servicesforrefugeesfromtheCentralAfricanRepublic South Sudanandhostcommunities Provision ofmedicalcare,foodandcleanwaterforrefugeesfrom Improving accesstohealthservicesinsevenzones 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 - 1 21, NiN Health, CICF,Futur AA, ADH,AMREF,BMZ, ADH BMZ/ADH ADH Donors Donors Donors Donors up4change health centers, state andprivate KHF/AMREF, PACIDA, health authorities, AIHD, ECCSDCO, France Order ofMalta AMALTE Guinée hospitals tal healthcentersand authorities, governmen- FASS, localhealth CAAMENIHU, EUP Local partners Local partners Local partners Local partners Expenses 2017 Country Expenses 2017 Country Expenses 2017 Country Expenses 2017 Country ¤ 44,588 Tanzania ¤ 2,409,899 Sudan South ¤ 739,521 Cameroon Nigeria/ ¤ Uganda 2,994,584 1, 3 1, 3 3 1, 3 1 11 1 projects No. of projects No. of projects No. of 5 projects No. of Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription – Kakonko District(MtendeliRefugeeCamp): – Controlofsleepingsickness – Yei andsurroundingregion: – Rumbek: – – – Juba andsurroundingregion: – – – – – Wau andsurroundingregion: – – ControlofSleepingSicknessusinganintegratedstrategy Maridi andsurroundingregion: North Cameroon – – Nationwide: – Arua, YumbeandGuluDistricts: – – – Self-helpgroupsformothersofchildrenwithphysicalchallenges Kampala:

vulnerable HHsinWau primary schoolsaswellimprovingaccesstoaidforparticularly nexus offoodandnutritionsecurityhygieneatIDPcamps Improving thelivingconditionsofIDPsandtheirchildrenthrough ing ahealthylivingenvironmentandanimprovednutritionalstatus Refugees andtheirhostcommunitiesinNorthernUgandabyestablish communities intheperi-urbanareasofJubaandforSouthSudanese Improvement ofFoodandNutritionSecurityWASHinunderserved cal andobstetriccareforBurundianrefugeesthehostcommunity Reducing maternalmortalitybyconstructionofacenterforacutesurgi- and childrentofightmalnutrition Provision ofmedicationanddistributionflourtovulnerablewomen ty, WASHandhealthtraining Improvement ofqualitylifeinaLeprosycolonythroughfoodsecuri- refugee camps Water Supply,SanitationandHygieneforpoorcommunities Lologo area Reducing foodinsecuritythroughschoolfeedingatprimaryschoolsin affected populationofWautownandgreaterBahrelGhazal Vocational TrainingandLivelihoodOpportunitiesfortheconflict friendly spaceinthediocesecompoundWau Providing psychosocialcaretoIDPchildrenbysettingupachild into thesociety the YoungatRisk(YAR)ofWauinordertosupporttheirreintegration Humanitarian Supportandprovisionofhumanitarianassistanceto Payam, WauCounty,WesternBahrelGhazal communities, Food and Nutrition security and WASH in Bussere/Bagari Strengthening ofagriculturalandmarketingcapacitiesvulnerable able groupsinMaridiCounty and of the livelihoods of the population with a special focus on vulner- Sustainable improvementofnutrition-sensitiveagriculturalproduction groups andreductionmalnutritionofespeciallyvulnerable Improving Water,HygieneandSanitationconditionsofvulnerable emergency medicalservice andanambulancesystem Contribution toanationalworkinggroupfor thedevelopmentofan various refugeecamps munity latrinesanddistributinghygienearticles andwatercanistersin gardens, plantingtrees,settingupwatercommittees, buildingcom- gees byimprovingaccesstocleandrinking water,growingvegetable Improving thehealthconditionsandhabitat ofSouthSudaneserefu- ment ofemergencymedicineandambulanceservicesinUganda Strengthen andcontributetoanationaltaskforceforthedevelop- low-income populationinKampala new-born screening,especiallyforsicklecelldiseaseasub-urban Reducing MaternalandChildmortalitymorbidityimproved 1 1 3 3 andMaiduguri,Nigeria 1 1 3 1 1/3 3 1 1 : 3 1/3 1 3 1/3 1 3 - Stiftung AA, SeligerGerhard AA Stiftung, UNICEF GFFP, SeligerGerhard AA, ADH,BMZ,FIND, Donors Donors Donors Stiftung, ZOA PRM, SeligerGerhard ADH, BMZ,ECHO, Donors Red CrescentTanzania Tanzania, Red Cross and The KolpingSocietyof Alima, CIDAR Federation, RAAH New SudanWomen authorities, MoH, DBVTC, HCO,local Wau, DonBosco CEFoRD, Dioceseof Local partners Local partners Local partners UNHCR Hospital Lubaga, Lyaffe, UgandaMartyrs Institute, OPM,Suuby GOU, MulagoTraining Local partners Commissioner ofRefugees UNHCR: UnitedNationsHigh Hunger RAAH: RuralActionAgainst Assistance Initiative Developmentand PACIDA: PastoralistCommunity Uganda OPM: OfficeofPrimeminister, MoH: MinistryofHealth Federation KHF: KenyanHealthcare HCO: Holdthechildren GOU: GovernmentofUganda d’Achat deServicesSanté d’Utilité Publique–Fonds EUP FASS:Etablissement Development Commission Catholic ChurchSocialand ECC SDCO:TheEthiopian Training Center DBVTC: DonBoscoVocational Nigeria Development andResearch CIDAR: CentreforIntegrated Development erment forRehabilitationand CEFoRD: CommunityEmpow- Nord-Ituri etduHaut-Uélé Médicaments Essentielsdu et d’Approvisionnementen CAAMENIHU: Centraled’Achat Health andDevelopment AIHD: AfricanInstitutefor Local partners: 21 22 Malteser International Annual Report 2017 Middle East CSJOHIFMQUPQFPQMFJOIBSEUPSFBDIBSFBT CZUIFDPNNJUNFOUPGPVSSFMJBCMFMPDBMQBSUOFSTUISPVHIXIPNXFBSFBCMFUP BOEUIPTFSFUVSOJOHIPNFBGUFSZFBSTPOUIFSVO5IJTXPSLJTNBEFQPTTJCMF JO4ZSJB *SBR -FCBOPO BOE5VSLFZUPQSPWJEFBOEDBSFGPSEJTQMBDFEQFSTPOT BOEUIFIVNBOJUBSJBOTJUVBUJPOJOUIFSFHJPOSFNBJOTDSJUJDBM8FBSFXPSLJOH 5IF.JEEMF&BTUJTHSJQQFECZBOVNCFSPGDPOmJDUTBGGFDUJOHNJMMJPOTPGQFPQMF the faceofsustained violence Human sufferingcontinuesin Middle East

in themostabjectconditions. homes asaresultofsustainedviolencecontinuedtolive FE4UJMM NJMMJPOTPGQFPQMFXIPXFSFGPSDFEUPmFFUIFJS close asthemajorityofIS-heldterritorieswereliberat- UIFCPSEFSJO*SBR BOPUIFSDPOmJDUTFFNFEUPESBXUPB women andchildren inneedofurgenthelp. and Lebanon,over60%ofthedisplaced populationare International’s CountryGroupManager forSyria,Turkey placed persons.AccordingtoJanine Lietmeyer,Malteser region ofIdlibisnowhometoa millioninternallydis shrinking opposition-heldterritories. Thenorth-western and arestrugglingtocareforthemselvesinincreasingly 4ZSJBOTXIPIBWFIBEUPmFFPONVMUJQMFPDDBTJPOT ternally displaced.Theplightismoredesperateforthose lion peoplelivingasrefugeesabroad,andmanymorein- IBWFCFFOGPSDFEUPmFFUIFJSIPNFT XJUIPWFSlWFNJM half ofthecountry’spre-warpopulation20million outbreak ofthecountry’sCivilWarin2011,morethan pendent onhumanitarianassistancetosurvive.Sincethe In Syriaalone,about13millionpeoplearecurrentlyde- Millions arestillbearingthebruntofwar T de-escalation zones.AlsoinSyria,andacross resulting fromtheestablishmentofso-called of hostilitiesintheSyrianCivilWar,mostly he year2017sawsomereductioninthelevel - - strengthening structuresinneighboringcountries Providing life-savingaidinconﬂictregions, centers andtwo hospitalsinthecountry.By end partner organizations,weoperate eightprimaryhealth stroyed infrastructure.Incooperation withourlocal have lostaccesstomedicalcare asaresultofde- the availabilityofhealthcareservices forpeoplewho supplies. Weareprimarilyconcerned withensuring providing urgentmedicalcareanddistributingrelief MJWFTPGQFPQMFDBVHIUJOUIFDSPTTlSFPGDPOmJDUCZ Our workinSyriacontinuestofocusonsavingthe 1SPHSBN.BOBHFSGPS*SBRBU.BMUFTFS*OUFSOBUJPOBM lenge fortheIraqigovernment,”saysStefanieHeil, the destroyedinfrastructureisstillanenormouschal- internally displacedpersonsandthereconstructionof daunting taskofrebuilding.“Facilitatingthereturn continues tobedire.Today,thecountryfaces humanitarian situationinmanypartsofthecountry victory inthewaragainstIslamicState,but cember 2017,theIraqigovernmentdeclaredcomplete the cityinruins,withmanyciviliancasualties.InDe- largest city,cameatanincrediblyhighcost,leaving terror. TheJuly2017liberationofMosul,Iraq’ssecond begun aftermorethanthreeyearsofIslamicState In neighboringIraq,thejourneytowardsstabilityhas INTERNATIONAL PHOTO: MALTESER people inIraq. lion internallydisplaced home tosome2.6mil- Camp (pictured)are Camps likeBerseviII

23 – our program in Turkey promotes the integration of Syrian refugees into the Turkish society through various educational programs such as language courses and 355,000 Turkey 21 vocational training. Challenge: Access to conﬂict areas Syria Our work in the Middle East continues to face a variety Lebanon Iran of complex challenges. With a confusing array of bellig- Middle East Iraq FSFOUTBOEUIFNVMUJEJNFOTJPOBMOBUVSFPGUIFDPOmJDUT 24 in the region, the long-term planning of projects is 25 JNQPTTJCMFh"WFSZIJHIEFHSFFPGmFYJCJMJUZJTSFRVJSFE Saudi Arabia from all parties involved,” says Cordula Wasser, Head 29,000 of Malteser International’s Middle East program. “The extremely limited access to our project regions in Syria 350,000 BOEDFOUSBM*SBRNBLFEBUBBDRVJTJUJPOEJGlDVMU4P JO 2,400 addition to the immense scale of need, we are constantly struggling with the reliability of the information we Medical care in conﬂict regions in Syria and Iraq receive.” We therefore rely on the combined efforts of Goal: Access to medical care for displaced persons in Iraq and Syria our teams and local actors. “When selecting partner

Malteser International Annual Report 2017 organizations, we do not only assess their potential to Our achieve- Syria: Medical treatment for 355,000 patients in successfully carry out projects, but also take into consid- ments in 2017: 2 hospitals and 8 basic health stations, 29,000 women received prenatal care and aftercare, 2,400 eration the shared understanding of values with regard newborns in our health facilities. to humanitarian principles,” says Wasser. “This is all the Iraq: 350,000 treatments were carried out in 13 health stations and with six mobile medical teams, more important in countries where we have no direct 21 health training courses for medical personnel. access to the project regions and only control projects from neighboring countries via a so-called Remote Con- Donors: AA, ADH, BMZ, ECHO, Lachen Helfen, Orienthelfer trol System, as is the case in Syria.” Partners: AMF, CADUS, DAMA, DoH Dohuk, IDA, Mercy The Remote Control System is fundamentally based Hands for Humanitarian Aid, Maram Foundation on the close support of local partners. Our teams in for Relief and Development Gaziantep and Kilis in Turkey, Erbil and Dohuk in Iraq, Outlook Further focus on emergency medical aid in Syria and in Lebanon are constantly in contact with our part- Interaction via modern technologies are complimented selves. Moreover, in some regions there are no legiti- Along with our local for 2018: and Iraq, as well as transitional aid in Iraq ner organizations, conducting on-the-job training, and by a detailed reporting system. An example of the sys- mate state authorities to collaborate with for measures partners, we provided care for injured and 4FFQBHFGPSBCCSFWJBUJPOTMJTU helping to solve practical and administrative problems. tems is an online platform that allows real-time access centered on reconstruction. sick children at Hope to patient data and diagnostic information in medical Children’s Hospital in Janine Lietmeyer, of 2017, around 355,000 people had received medical facilities. Outlook for 2018: Humanitarian aid and transi- East Aleppo, Syria. PHOTO: IDA County Group Man- treatment in these facilities. tion scenarios ager for Syria, Turkey Challenge: Attacks on aid workers, inadequate and Lebanon during In 2017, our work in Iraq was also characterized Our efforts to strengthen the capacities of local civil a visit in Turkey. by emergency aid measures, particularly in the health structures, corruption society actors will continue even in urgent, time-critical PHOTO: GONZALO BELL sector. Our support and operation of 13 health stations An increasing animosity towards humanitarian aid emergency relief missions. A strong emphasis will be and six mobile medical teams enabled us to provide workers is another problem we face in the Middle East placed on involving the people for whom the projects access to medical care for around 350,000 people. We region. As a result of the highly politicized nature of are planned. “Their feedback, complaints or suggestions also distributed urgently needed relief supplies such as UIFDPOmJDUTJOUIFSFHJPO UIFOFVUSBMJUZBOEJOEFQFO- for improvements help us and our partner organizations blankets, mattresses, water canisters and kitchen uten- dence of aid is often questioned. This puts aid workers to adapt our aid programs to their needs in the best sils to about 20,000 people. “Our future plans include at risk. “In a situation where warring parties continue possible way,” Wasser says. providing training on health and psychosocial care for to violate international humanitarian laws by carrying While our aid activities in Syria will continue to refugees to ease their reintegration into the labor mar- out chemical attacks against civilians, bombing hospitals focus mainly on ensuring survival by providing medical ket,” says Heil. and schools, and besieging whole cities for years as a care and distributing relief supplies in the medium term, We are working to support existing structures in combat tactic, the security of aid workers cannot be we are gradually transitioning from urgent emergency Lebanon and Turkey, where institutional capacities have guaranteed,” says Wasser. aid to measures geared towards rebuilding. This means CFFOQVUVOEFSNBTTJWFQSFTTVSFCZUIF4ZSJBODPOmJDU 5IFDIBPTPGDPOmJDUJONBOZQBSUTPGUIF.JE- IFMQJOHTVSWJWPSTPGUIFDPOmJDUUPEFBMXJUIUSBVNB While our joint projects with the Lebanese Association dle East, particularly in Syria, has led to corruption, and return to their normal lives. “Although the road to of the Order of Malta are aimed at strengthening the JODSFBTFEBDUJWJUJFTPGXBSQSPlUFFSTBOEBOFYQBOEFE normalcy for many in Iraq is a very long one, we are Lebanese medical system in the long term – to the shadow economy. For this reason, and to ensure better looking into the future with a sense of optimism that we CFOFlUPGCPUI4ZSJBOSFGVHFFTBOEIPTUDPNNVOJUJFT control of our projects, we procure aid supplies our- have not had in a long while,” says Heil. 26 Relief Coalition NiN: NachbarinNot–Austria’s Aid Operations Protection andHumanitarian ECHO: EuropeanCivil Development Economic Cooperationand German FederalMinistryfor Zusammenarbeit – wirtschaftliche Entwicklungund BMZ: Bundesministeriumfür – Germany’sReliefCoalition ADH: AktionDeutschlandHilft Federal ForeignOfﬁce AA: AuswärtigesAmt–German List ofAbbreviationsDonors: Relief andDevelopment MFRD: MaramFoundationfor Association IDA: IndependentDoctors Foundation Relief andDevelopment IBC: InternationalBlueCrescent of Health DoH Dohuk:Directorate Activities DAMA: DoctorsAidMedical for Development AMF: Al-MustaqbalFoundation Local partners: Malteser International Annual Report 2017 Middle East 3 2 1 (including otherfundsfromcontractsalreadybookedinthepreviousyear) Total expenses2017: ¤12,775,044|Previousyear:15,935,640Regionalcosts2017: ¤238,353 Our Programsin2017

Malteser International Projects implementedbylocalpartnerorganisationswithsupport from Sovereign OrderofMaltawiththesupportfromMalteserInternational Projects implementedbynationalassociationsandaidservices ofthe Projects implementedbyMalteserInternationalandpartnerorganizations Expenses 2017 Country* Expenses 2017 Country* Expenses 2017 Country* Expenses 2017 Country* ¤ 531,255 Turkey ¤ 3,440,489 Syria ¤ 3,748,461 Lebanon ¤ 4,816,486 Iraq 1 3 3 2 5 3 2 6 projects No. of projects No. of projects No. of projects No. of Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription – Kilis: – AccesstoprofessionaltrainingforSyrianrefugeesinaVocationalTrainingCenter Küçükçekmece, Istanbul: – Reyhanli: – North Syria: – Bekaa: – North Lebanon: – Provisionoftrauma-relatedmedicalcare Anbar: – Ninewa: – Erbil: – Dohuk: Syrian refugeechildrenwithspecialneeds Turkish hostcommunities–Multi-ServiceCenterinKilis-Daycarecenterfor Community Center:StrengtheningsocialcohesionbetweenSyrianRefugeesand refugees; supportforSyrianrefugeechildrenwithphysicalandmentalchallenges; Support foratemporaryrehabilitationhospitalPost-operativehealthcare tion, clothing,schoolmaterial,recreationalactivitiesandpsycho-socialcare Day carecenterforSyrianrefugeechildrenincludinghealthcareservices,educa- Thalassemia; RehabilitationoffourPHCs primary healthcenters(PHC),twobloodbanks,clinicsforchildrenwith Provision ofprimaryandsecondaryhealthcareservicesinonehospital,four munities inDeir-El-Ahmar Access toprimaryandsecondaryhealthcareservicesforrefugeeshostcom- communities throughamobilemedicalunit Provision ofprimaryhealthcareservicesforSyrianrefugeesandvulnerablehost for orphans,Cashdistribution support forIDPs,vulnerablecommunitiesinhard-to-reachareas,winterizationkits primary healthcareservicesinrefugeecamps;emergencyreliefandnon-fooditem and conflict-affectedhostpopulationwiththeaidofmobilemedicalteams, Medical humanitarianassistancetointernallydisplacedpersons(IDP),returnees the useofmobilemedicalteams Provision ofprimaryhealthcareservicestopopulationsaffectedbyconflictwith to healthfacilities camps andmobilemedicalclinics;provisionofmedicineequipment internally displacedpersons(IDPs)incampsthroughprimaryhealthcarecenters Provision ofbasichealthcareservicesforpopulationsaffectedbyconflictand

NiN BMZ, ADH, AA, BMZ ADH, AA, BMZ ADH, AA, thelfer Orien- Helfen, Lachen ECHO, ADH, AA, Donors Donors Donors Donors Orient Face and Development,The Foundation forRelief Altin Hilal,IBC,Maram opment for ReliefandDevel- IDA, MaramFoundation of theOrderMalta Lebanese Association Aid Hands forHumanitarian DoH Dohuk,Mercy AMF, CADUS,DAMA, Local partners Local partners Local partners Local partners IBWFBEJTQSPQPSUJPOBUFJNQBDUPOUIFNPTUWVMOFSBCMF DPOUJOVFUPDBVTFJOTUBCJMJUZ VOEFSEFWFMPQNFOU BOEEJTQMBDFNFOU5IFTFFWFOUT XFBUIFSFWFOUT POHPJOHDPOmJDUTJODPVOUSJFTMJLF.ZBONBSBOE"GHIBOJTUBO PWFSQFSDFOUPGUIFXPSMETEJTBTUFSBGGFDUFEQPQVMBUJPO*OBEEJUJPOUPFYUSFNF 5IF"TJB1BDJlDSFHJPOJTUIFNPTUEJTBTUFSTUSJDLFOJOUIFXPSME BDDPVOUJOHGPS and poverty of climatechange, conﬂict, Collective actionintheface Asia

27 To ensure the sustainability of our DRR measures, we also involve local, regional and national decision-mak- India ers. This is best illustrated in our work in 56 coastal villages in Thatta, a district located in Pakistan’s south- 24 18,674 ernmost Sindh province. This region is very susceptible China UPmPPEJOH ESPVHIU BOETFWFSFTUPSNT CVUJTQPPSMZ lacking in coping capacity. We have been working with both communities and the civil society organizations in Vietnam Myanmar this region since 2015 to provide specialist knowledge 28 Laos and capacity required to manage their risks effectively 29 themselves. We helped to establish and train six disaster Thailand management committees, while creating emergency 7,249 plans and early warning systems for 27 villages. These information and training campaigns can help reduce risks and potential losses, thereby improving the resil- 57,594 ience of communities to disasters. Cambodia 0VSFGGPSUTJO1BLJTUBOSFDFJWFETJHOJlDBOUOBUJPOBM recognition in 2017. As part of our DRR program, an 79 4,345 action plan to integrate disaster risk reduction into national health policies and activities was adopted by the government and implemented nationwide. Strengthening resilience of vulnerable communities in Myanmar Reducing poverty and making livelihoods resilient The mega camp in lready plagued by frequent earthquakes, Goals: Improving living conditions of vulnerable com- Although natural disasters are occurrences of the wilder munities in the areas of health, water, sanitation, Cox’s Bazar, Bangla- DZDMPOFT mPPET MBOETMJEFTBOEUZQIPPOT B forces of nature that affect everyone, widespread pover- desh is now home Turkmenistan hygiene, nutrition and disaster preparedness Tajikistan to 680,000 people A changing climate and rapidly growing expo- China ty and inequality make people more vulnerable to them. who ﬂed violence in TVSFUPEJTBTUFSSJTLTQSFTFOUUIF"TJB1BDJlD Our achieve- 57,594 people received treatment in 24 health Despite experiencing remarkable economic growth in Myanmar in 2017. ments in 2017: facilities with our support; 7,249 malnourished region with an unprecedented challenge. In May 2017, children under ﬁve years of age received food SFDFOUEFDBEFT UIF"TJB1BDJlDSFHJPOSFNBJOTIPNF PHOTO: NOOR AHMED GELAL Cyclone Mora made landfall in Myanmar, destroy- supplements, 4,345 people were able to im- to over 400 million people living in extreme poverty. prove their living conditions thanks to measures ing shelters and causing catastrophic damage. Three A majority of these people tend to live in conditions 40 in the areas of nutrition and agriculture; 18,674 NPOUITMBUFS XJEFTQSFBENPOTPPOmPPEJOHXSFBLFE people participated in education campaigns to and areas that expose them to natural hazards. For this havoc across India, Nepal, and Bangladesh, killing over Afghanistan improve hygiene and sanitation, 79 trainings in reason, our work in reducing disaster risk goes hand-in- India disaster risk reductions were organized 900 people. In total, natural disasters affected almost 70 hand with efforts geared at resilience building. million people in Asia over the course of last year. Apart Pakistan “For us, this means enabling vulnerable communities Donors: AA, ADH, BMZ, GF, GIZ, SDC, UNICEF, WFP from the human cost of these disasters, they have a dis- in Asia to improve their well-being and build back better Iran ruptive impact on livelihoods – a further disadvantage Partners: CERA, local health authorities after disasters,” says Wasser. “Our activities in this area for people already living in vulnerable conditions. span various sectors – food security, water, sanitation, Outlook Further efforts to maintain high quality of proj- The rapid and effective delivery of emergency relief for 2018: ects, continued support of local partners as well and hygiene, as well as livelihood sustenance.” In India, in the wake of disasters remains a core area of our work as further improvements in the living conditions for instance, our programs aim to tackle the causes at Malteser International. Because these events are – by 42 of impoverished communities of malnutrition by providing access to safe water and their very nature – often unexpected, thorough disaster 21 sani tation, but we are also helping to create income gen- preparation is important in order to save lives. Disaster Risk Reduction (DRR) has thus become an increas- Disaster Risk Reduction in Pakistan those affected as key partners in developing strategies Cordula Wasser, JOHMZTJHOJlDBOUQBSUPGPVSXPSLJO"TJB5PQSFQBSF related to their assistance and protection.” Head of the Asia and Goals: Strengthening resilience and improving liveli- Middle East regional our teams and partners for emergency situations, we This approach also demands that we place great hoods of vulnerable communities teams, in discussion provide regular training on disaster risk reduction. emphasis on reducing the vulnerability of most-at-risk with refugees in Our achieve- 40 Training courses on disaster preparedness; groups such as persons with disabilities, women, girls, and Bangladesh. ments in 2017: 21 Disaster Preparedness Committees were PHOTO: MALTESER Disaster preparedness for all INTERNATIONAL founded and trained, 42 Villages prepared the elderly by incorporating them in disaster preparedness “In addition to providing emergency relief, we are disaster preparedness plans. practices and policies. This is evidenced in our programs in committed to helping vulnerable communities cope and Vietnam, Myanmar, Pakistan and the Philippines where we Donors: BMZ adapt in the face of diverse catastrophes,” says Cor- work to widen the participation of persons with disabilities dula Wasser, Head of the Asia department at Malteser Partners: PFF and other vulnerable groups in community-based disaster

*OUFSOBUJPOBMÐ0VS%33QSPHSBNTBSFDPOUFYUTQFDJlD Outlook Expansion of disaster risk reduction to other risk management. By removing barriers that keep exclud- designed to meet particular risk reduction needs in each for 2018: regions affected by drought in Thatta district. ed groups out, we strive to encourage a full and meaning- country with a people-centred approach that includes ful participation of all members of the community. 4FFQBHFTBOEGPSBCCSFWJBUJPOTMJTU refugees, who, in many cases, were traumatized and liv- also makes it possible to create a meaningful transition JOHJOTRVBMJEDPOEJUJPOT8JUIJOUIFlSTUUISFFNPOUITPG between relief and long-term development.” our intervention, we were able to provide around 35,000 Malteser International has long relied on partnerships people with medical treatment for their wounds and with local partners in countries where it works, and will illnesses. We were also able to give 900 women antenatal continue to do so. The last years have seen civil society and postnatal care. Over 500 undernourished children organizations in many countries grow in strength were also restored to health thanks to our food therapy. and become more organized in their response. This “Refugees from Myanmar have lived in the camps in development presents us with a welcome opportunity to Thailand for over 20 years,” notes Cordula Wasser. This jointly address the challenges that drive our work in the 30 TJUVBUJPOTIPXTIPXEJGlDVMUJUDBOCFGPSSFGVHFFTUP region. As a result, the number of programs we imple- 31 SFUVSOIPNFBGUFSmFFJOHWJPMFODFh*UNJHIUUBLFZFBST ment in partnership with local organizations is growing before the Rohingya are able to return to safety in Myan- year by year. mar,” she adds. In the context of increasing unpredictability from DPOmJDUTBOEOBUVSBMEJTBTUFST PVSNJTTJPOUPQSPWJEF Outlook: Partnerships for collective action – as assistance to people in need remains constant and local as possible, as international as necessary challenging. While constrained access to our project Local and national civil society organizations play a MPDBUJPOTJOTJUVBUJPOTPGBSNFEDPOmJDUJTPGQBSUJDVMBS critical role in emergency contexts. They are oftentimes concern, negotiating access to people in need has be- UIFlSTUSFTQPOEFSTEVSJOHEJTBTUFST BOEBSFVTVBMMZUIF DPNFJODSFBTJOHMZPOFSPVTCFDBVTFPGTJHOJlDBOUBOEBU only ones with reasonable access to affected commu- times deliberately obstructive bureaucratic procedures. nities in remote areas. “It is of the utmost importance Despite these challenges, our work in Asia continues to to involve these organizations in all aspects of project prioritize quality, transparency and accountability. planning and implementation,” says Wasser. “Our In the coming years, we will continue to bring added local partners are able to build on their knowledge of value to communities by supporting local actors to be at the language and culture on the ground to ensure that the forefront of disaster response, expanding sustainable UIFBJEXFQSPWJEFJTUBJMPSFEUPUIFOFFETPGCFOFl- access to improved nutrition, health, water, and sanita- ciaries. Their long-term presence in the affected area tion, and fostering social cohesion for greater resilience.

Aid for refugees in Bangladesh, Thailand, and Myanmar

Goals: Improving health and living conditions of Myanmar 20,463 refugees in Bangladesh and Thailand as well as India To improve health eration opportunities for households. We also adopt this Responding to conflicts and displacement people who have remained in the conflict-affected conditions, especial- approach in countries including Cambodia, Myanmar, While extreme poverty has been shown to trigger vulner- states of Rakhine and Kayin in Myanmar; Support- ly for women, we ing communities in Kayin state for the return of Bangladesh organize trainings /FQBM BOE1BLJTUBO BCJMJUZ DPOmJDUTDBOVOEFSNJOFUIFDBQBDJUZPGTUBUFTUP Karen refugees from Thailand. 16,971 for health workers In Myanmar, improving healthcare is the overriding prevent and respond to disasters and other humanitarian China such as birth goal of our programs. In order to provide better access emergencies. Some countries in Asia remain caught up Our achieve- 137,072 patients received treatment at our attendants and ments in 2017: health facilities in Bangladesh, Thailand, and Vietnam midwives. to healthcare services for impoverished sections of the JODZDMFTPGWJPMFOUDPOmJDU MFBEJOHUPJOUFSOBMJOTUB- in Rakhine and Kayin states in Myanmar; 958 Myanmar PHOTO: population, we support the construction and equipping CJMJUZBOEDSPTTCPSEFSEJTQMBDFNFOU1SPWJEJOHBJEUP women were treated at the refugee camp in JANA AŠENBRENNEROVÁ Bangladesh; 20,463 people in Thai refugee of health facilities, and provide training for healthcare refugees and displaced persons is also a key component camps and within host communities have access Laos personnel such as obstetricians and midwives. In 2017, of our work in Asia. A good example of this effort is our to clean drinking water; 35,423 in Thailand more than 57,000 people received treatment from the work in Bangladesh, Afghanistan, and Thailand, where participated in awareness campaigns on health, water, sanitation and hygiene in Rakhine and Ka- medical facilities we support. we are working to improve the welfare of refugees and yin states; 16,971 people were tested for malaria However, there is much more to a healthy life than JOUFSOBMMZEJTQMBDFEQFSTPOTJOUIFlFMETPGIFBMUI XBUFS and received treatment, and 1,103 latrines were built. just access to medical care. A balanced diet and ade- sanitation and hygiene. Thailand quate access to water, sanitation and hygiene are also 5IFMPOHSVOOJOHDPOmJDUJOMyanmar, for example, Donors: ADH, AA, BMZ, Dr. Ulrich Reiter, EuropeAid, required. Hence, the construction of latrines and the has created protracted refugee situations in Thailand Else Kröner-Fresenius-Foundation, GF, Thai.Ger 958 Supporters, WCFF, WFP 137,072 provision of clean drinking water have become import- and Bangladesh. In August of 2017, renewed violence ant components of our work in Myanmar. Ultimately, in northern Myanmar sparked a mass exodus of over Partners: GK, HI Cambodia a long-lasting improvement in living conditions is only 680,000 members of the Rohingya ethnic minority to Outlook Continued medical support for refugees in Ban- possible when knowledge is shared. Thanks to various neighboring Bangladesh in what became known as the for 2018: gladesh and Thailand; preparation for returnees information campaigns and training sessions, we were world’s fastest growing refugee crisis. In response to the and further support for the people who remained 1,103 in Myanmar; further efforts to improve living 35,423 able to provide additional training for more than 18,000 situation, we worked with a local partner organization, conditions of impoverished communities. people in the areas of nutrition, health, and hygiene. Gonoshastaya Kendra, to provide life-saving aid for the 32 minority fromMyanmar support ofRohingyaethnic * Furtherfundsallocatedfor Emergency Fund International Children‘s UNICEF: UnitedNations Refugees, andMigration PRM: BureauofPopulation, OMF: OrdredeMalteFrance Austria’s ReliefCoalition NiN: NachbarinNot– ten People GFFP: GlobalFundforForgot- tive NewDiagnostics FIND: FoundationforInnova- Aid Operations Protection andHumanitarian ECHO: EuropeanCivil Challenge Fund CICF: CountyInnovation Cooperation andDevelopment Federal MinistryforEconomic und Zusammenarbeit–German wirtschaftliche Entwicklung BMZ: Bundesministeriumfür Coalition Hilft –Germany’sRelief ADH: AktionDeutschland German FederalForeignOffice AA: AuswärtigesAmt– List ofabbreviationsDonors: Malteser International Annual Report 2017 Asia previous years:¤147(Israel)(includingotherfundsfromcontractsalreadybookedintheyear) Total expenses2017: ¤11,717,661.12|Previousyear:15,151,680Regionalcosts2017:218,625Subsequentfromprojectsof Our programsin2017 Expenses 2017 Country Expenses 2017 Country Expenses 2017 Country Expenses 2017 Country Expenses 2017 Country ¤ 5,020,478 Myanmar ¤ 23,728 India ¤ 1,155,577 Cambodia ¤ 47,900* Bangladesh ¤ 103,500 Afghanistan 3 1, 3 1, 3 3 3 16 4 7 2 2 projects No. of projects No. of projects No. of projects No. of projects No. of Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription child healththroughbetter nutrition health centers&communitybasedapproach toimprovingmotherand HIV/AIDS andtuberculosispreventiontreatment; constructionof Shan StateandWaSpecialRegion environment forKarenrefugeesreturningfrom Thailand and childhealth,water,sanitationhygiene; creatingasuitable Improved accesstoprimaryhealthcareservices withafocusonmother Kayin State groves andcoastalzonemanagement;floodreliefrehabilitation food bridgesandevacuationparts;first-aidtraining,restorationofman- Disaster riskreductionandclimatechangeadaptation:Constructionof Central RakhineState: sanitation andhygiene treatment ofmalnutritioninchildrenunderfive;Improvementswater, infant health:Treatmentandpreventionofmalaria&tuberculosis; Providing accesstoprimaryhealthcarewithafocusonmaternaland Northern RakhineState: Emergency reliefintheaftermathofmonsoonfloodingAugust2017 in thesafeuseandmaintenanceoflatrines Construction offlood-prooflatrinesandtrainingcommunitymembers Improving resilienceforcommunitiesalongKoshiRivertoflooding: Bihar: ernment programs;trainingfemalenutritionists,cultivationofhomegardens communities; supportingsmallholderfarmerstosecurebenefitsfromgov and girlsbyintroducingdroughtresilientagriculturalpracticesfor Improving foodsecurityintheTharDesertregionwithafocusonwomen Rajasthan: adolescents Vocational skillsacquisitionandmedicalcareforunderprivileged TamilNadu: poor ruralhouseholds improved accesstowater,sanitationandhygieneforschoolchildren access tocleanwaterforvulnerablegroupslikewomenandchildren, Building resiliencetohealth-relatedimpactsofchange:Provision Siem Reap: improve hygieneandsanitaryconditions toilets, distributionofwaterfilters,supportforcommunityinitiativesto Improved accesstocleanwater,sanitationandhygiene:Constructionof Samrong: Medical care,nutrition,traumasupport Emergency ReliefforRohingyarefugeesfromMyanmar– Cox´s Bazar: from Bangladesh Winter Reliefforinternally-displacedpersonsandAfghanreturnees LanghamandKabulProvince: - GIZ, SDC,UNICEF,WFP AA, ADH,BMZ,GF, BMZ JAD HAMAP- Founda ADH, BMZ,Elysium Stiftung ADH, Gerda AA, ADH Donors Donors Donors Donors Donors tion, GIZ, Humanitaire, Henkel CHHRA, WFC,FLD Good Shepherd CERA, Sistersofthe tion, SSK Development Educa- – Organisationfor Pro-Vision, UNNATI verein, UnionAid Afghanischer Frauen- GK Local partners Local partners Local partners Local partners Local partners Expenses 2017 Country Expenses 2017 Country Expenses 2017 Country Expenses 2017 Country Expenses 2017 Country ¤ 228,882 Vietnam ¤ 2,126,584 Thailand ¤ 722,542 Philippines ¤ 1,424,044 Pakistan ¤ 645,654 Nepal 3 1 1, 3 1, 1 1, 3 1, 4 5 3 4 3 projects No. of projects No. of projects No. of projects No. of projects No. of Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription Project locationandshortdescription – Quang Nam: – – Strengtheningresilienceofvulnerablegroups tonaturaldisasters Quang Ngai: – Hanoi, QuangTriandNgai: – Inclusionofvulnerablegroupsindisasterriskreductionmeasures National Program: – Mae HongSonprovince: – EmergencyreliefforfamiliesaffectedbytheearthquakeinKananga Leyte: – NorthernSamar: – – Sindh Province,DistrictThatta(2Projekte): – Khyber PakhtunkhwaProvince(KP),Peshawar: – – Sunsari District: – Sindhulpalchowk, KavrepalanchowkandNuwakot: Emergency reliefintheaftermathofmonsoonfloodingAugust2017 pacity buildingforDSACCatarmanvolunteersinreducingdisasterrisk Inclusive DisasterRiskReductionintyphoon-pronecoastalareas:ca Cang andTraDoncommunes Providing medicalequipmentinhealthcenters inNamTraMy, Hanh Duccommunes Strengthening thecapacityfordisasterresponse inHanhNhanand ty-based disasterriskmanagement Widening participationofpersonswithdisabilitiesincommuni- healthcare forchildren training andcapacitybuilding;dentalcarehygiene;secondary itation andhygiene;preparingrefugeesforreturnthroughvocational mother andinfanthealthcare,foodnutritionsecurity,water,san- from MyanmarandhostcommunitiesontheThai-MyanmarBorder: Curative andpreventivehealthcarecapacitybuildingforrefugees nutrition invulnerablecoastalcommunities 2. Strengtheningofresilienceinhealth,water,sanitation,hygieneand vulnerable coastalcommunities 1. StrengtheningofresiliencethroughDRRandlivelihoodmeasuresin communities (2Projekte) Health andnutritionservicesforIDP,Afghanrefugeeshost methods, constructionofirrigationsystems munity members;securinglivelihoodsthroughalternativecultivation Construction of flood-proof latrines and maintenance training for com- Improving floodresilienceforcommunitiesalongKoshiRiver: communities preparedness, mentalhealthawarenessandtreatmentinschools disasters bytrainingcommunityvolunteersonfirst-aidandemergency affected bytheearthquake;strengtheningresilienceagainstfuture Construction andrehabilitationofhouseshealthcentersinareas - AA, ADH WCFF Ho-Chi-Minh-Stadt, General-Konsulat BMZ, Deutsches Dr. UlrichReiter WCFF, Thai.Ger, Fresenius-Stiftung, ADH, ElseKröner- ECHO, EuropeAid, BMZ, ECHO AA, ADH, Baden-Württemberg ADH, BMZ,Land Donors Donors Donors Donors Donors Philippines Order ofMalta DSAC Catarman, Health Center Nam TraMyDistrict DMC, DPOQuangTri, DoLISA QuangNgai, HRDI, HI MERF, PFF Koshish, ICSC RSDC, CDECF, Local partners Local partners Local partners Local partners Local partners 3 2 1

WFC: WaterforCambodia Development Education UNNATI Organizationfor SSK: SabhaghiShikshanKendra Development Centre RCDC: RuralSelf-reliance PFF: PakistanFisherfolkForum Resilience Foundation MERF: MedicalEmergency Development Institute HRDI: HighlandResearchand HI: HumanityandInclusion GK: GonoshastayaKendra Development FLD: FarmerLivelihood Center Catarman DSAC: DioceseSocialAction People Organization DPO: QuangTriDisabled Invalids andSocialAffairs DOLISA: DepartmentofLabour, Management Committee DMC: NationalDisaster Service Centre CSC: IndrawateeCommunity Human RightsAlliance CHHRA: CambodianHealthand Association Empowerment andResilience CERA: TheCommunity Conservation Forum Development andEnvironment CDECF: Community Local Partners: International with supportfromMalteser local partnerorganisations Projects implementedby International the supportfromMalteser Sovereign OrderofMaltawith services ofthe national associationsandaid Projects implementedby organizations teser Internationalandpartner Projects implementedbyMal- 33 34 Malteser International Annual Report 2017 Europe UIFTFTJUVBUJPOT UPFNFSHFODZTJUVBUJPOT5IFSFGPSF JUJTJNQFSBUJWFUIBUXFSFTQPOEUPTBWFMJWFTJO TJTUBOUTPDJBMJOFRVBMJUZBOEDPOmJDUJOTPNFDPVOUSJFTDBOJODSFBTFWVMOFSBCJMJUZ JUIBTUIFDBQBDJUZUPEFBMXJUIFNFSHFODJFTXJUIPVUFYUFSOBMIFMQ)PXFWFS QFS DPSSFDUUPBMBSHFFYUFOU&VSPQFTSFMBUJWFTBGFUZBOETUSPOHJOTUJUVUJPOTNFBOUIBU CFDBVTFNBOZBTTVNFUIFDPOUJOFOUEPFTOPUOFFEUIFN5IJTBTTVNQUJPOJT )VNBOJUBSJBOBJEJOUFSWFOUJPOTBSFSBSFMZBTTPDJBUFEXJUIDPVOUSJFTJO&VSPQF continent’s secondlargestcountry A Europe forgottencrisisinthe

- tion oftheOrderMalta,weareprovidingpsychosocial severe trauma.IncooperationwiththeUkrainianAssocia humanitarian assistance,andmanyaresufferingfrom have beendisplaced,morethan4millionareinneedof UIFDPOmJDUIBTCFFOBQQBMMJOH/FBSMZNJMMJPOQFPQMF Total expenses2017: ¤1,275,830|Previousyear: ¤ 3,092,281 Our programsin2017 Expenses 2017 Country Expenses 2017 Country ¤ 55,471 Ukraine ¤ 1,220,360 Germany A 2,3 2 rarely coveredbythemedia.Thehumantollof humanitarian situationineasternUkraineis government andseparatistforces,thedire GUFSGPVSZFBSTPGBSNFEDPOmJDUCFUXFFO projects No. of projects No. of 1 16 Project locationandshortdescription Project locationandshortdescription – Donetsk, Lugansk,Kievandsurrounding regions: – Saxony, Saxony-Anhalt: – Bavaria, Thuringia: by floods financial assistanceandpsychosocialcareforpeopleaffected support forpeopleaffectedbythe2013floods Reconstruction oftwoschools;financialandpsychosocial building tohandlemental illnessfromtrauma establishment ofafirst-aidtrainingprogram; capacity persons displacedbytheconflict;mobilemedical teams; Psychosocial andmedicalcarefortraumatized andinjured - assistance andpsychosocialcounseling. TVQQPSUQFPQMFXIPIBWFCFFOBGGFDUFEXJUIlOBODJBM of thenetworkOrderMaltaweareworkingto and Bavaria.Incoordinationwithmemberassociations regions affectedwereSaxony,Saxony-Anhalt,Thuringia, in theeasternandsouthernpartsofGermany.Themain DPOmJDUJOUIFSFHJPOTPG,JFW -VIBOTLBOE%POFUTL support forpeopledisplacedandtraumatizedbythe *O+VOF IFBWZSBJOGBMMDBVTFEFYUSFNFmPPEJOH AA Kindern Wir helfen Stiftung RTL– Bank Stiftung, ADH, Deutsche Donors Donors Malteser Hilfsdienste.V. University KievMohyla Academia) ed withtheUniversityofKiev(National ic experiences,and”Wortehelfen”, affiliat- the managementofimpacttraumat Malteser Ukraine,Ukrainiansocietyfor Local partners Local partners - 3 2 1 Projects implemented by nation- ADH: AktionDeutschlandHilft AA: AuswärtigesAmt Donors: HT:MLEE UKRAINE MALTESER PHOTO: ongoing conflict. displaced bythe families havebeen for childrenwhose psychosocial support Ukraine, weprovide In Kramatorsk, International with supportfromMalteser local partnerorganizations Projects implementedby International with supportfromMalteser of theSovereignOrderMalta al associationsandaidservices organizations teser Internationalandpartner Projects implementedbyMal- 35 36 Malteser International Annual Report 2017 America PUIFSXJTFCFDVUPGGGSPNBOZLJOEPGIFMQ UJPOT FTQFDJBMMZJOSFNPUFBOESVSBMDPNNVOJUJFTXJUIQPQVMBUJPOTUIBUXPVME XJUIPVSMPDBMQBSUOFSTJOUIFSFHJPO XFBSFXPSLJOHUPJNQSPWFMJWJOHDPOEJ BTTJTUBODF QBSUJDVMBSMZXIFOJUDPNFTUPGPPETFDVSJUZBOENFEJDBMDBSF"MPOH 1FSVMJWFVOEFSWFSZEJGlDVMUDPOEJUJPOT5IFZPGUFOMBDLBDDFTTUPTUBUFGVOEFE .BOZQFPQMFJOPVSQSPKFDUMPDBUJPOTJO$PMPNCJB )BJUJ &DVBEPS .FYJDP BOE increasing resilience Strengthening civilsocietyand America

- from theirgardens andfarms,”saysJelenaKaifenheim, grams, andhavetoliveoffwhatever foodtheyproduce from state-fundedhealthcareand othersupportpro- in certainpartsofthecountry.Many peoplearecutoff to mind,onetendsforgetthe povertystillprevalent fragile situation.“Whenacountry likeColombiacomes and landslidesfurtherthreatentoworsenthealready BOEFYUSFNFXFBUIFSQBUUFSOTMJLFIVSSJDBOFT mPPET tions. Longerperiodsofdrought,changesinrainfall, to coverthenutritionalneedsofmanyruralpopula- QSPEVDUJWFOPSTVTUBJOBCMF UIFZBSFPGUFOJOTVGlDJFOU forms ofagriculture. countries, wheremanypeoplesubsistontraditional particularly tenuousinCentralandSouthAmerican droughts andcausedcropfailures,makingfoodsecurity El Niño.Theweatherphenomenonhasalsoexacerbated to theimpactsofclimatechangeandanoddlypowerful and theCaribbean.Theseeventshavebeenattributed rocked Mexico,andastringofhurricaneshittheUS T As mosttraditionalfarmingmethodsareneither to landslides.Twoback-to-backearthquakes TVNNFSSBJOTmPPEFEQBSUTPG1FSV MFBEJOH catastrophes in2017.Heavierthannormal he Americasexperiencedseveralnatural civil societyinthelongterm.” are notpresent,andwecommittedtostrengthening come in.Weworkinregionswhereotherorganizations America andtheCaribbean.“Thisisexactlywherewe Malteser International’sRegionalManagerforLatin BDDPSEJOHUPUIFJSUSBEJUJPOT5IJTNBLFTJUEJGlDVMUGPS The Wayuuhavetheirownlanguage andlivemostly remote areasasaresultofviolence anddisplacement. like theWayuu,manyofwhom havehadtosettlein especially forAfro-Colombiansand indigenouspeoples long yearsofwarwillcontinue to befeltforalongtime, has broughtsignsofcalminthecountry,effects hood asaresult.”Althoughthepeaceagreementof2017 seven millionpeoplewhohavelosttheirmeansofliveli- mJDUJOColombia haveledtothedisplacementofaround on marginalizedpeople.Over50yearsofinternalcon- says Kaifenheim.“Ourprogramsareprimarilyfocused NVTUlSTUHBJOBDDFTTUPUIPTFJOOFFEPGBTTJTUBODF v conditions inthelongrun.Inordertoachievethis,we solutions thatwillenablethemtoimprovetheirliving “We worktogetherwiththelocalpopulationon conditions Colombia: Workingtogethertoimproveliving PHOTO: EMILYKINSKEY prove theirlivelihood. helps localstoim- program inColombia Our apiculture 37 38 4FFQBHFGPSBCCSFWJBUJPOTMJTU Malteser International Annual Report 2017 America 5,333 31 Ecuador 275 Peru our projects. promoters andmultiplierswerealsotrainedaspartof their respectivecommunities.Morethan275health methods, andarenowabletobringthesemethods 100 smallholdersweretrainedinsustainablecultivation convey knowledge,”saysKaifenheim.In2017,about the trustofpeople,andcanthereforeeffectively itants. “Thisisespeciallyimportantbecauseonegains stand theculturalandreligioustraditionsofinhab- languages, areveryfamiliarwiththeregion,andunder- local partnerorganizationswhosestaffspeakthe Their trainingtakesplaceinclosecollaborationwith to improvenutritionandhealthintheircommunities. acquired tootherswhilebecomingmultipliers,helping this trainingtransmittheknowledgeandexpertise health promoters.Inturn,peoplewhohavereceived and trainingtraditionalbirthassistants,aswell sustainable formsoffarming,buildinghealthstations, project activitiesincludetrainingsmallholdersinmore out oftwochildrensuffersfromundernourishment. tality areparticularlyhighduetomalnutrition,andone state-sponsored healthcare.Maternalandinfantmor- two thirdsoftheruralpopulationdonothaveaccessto regions inthenorthernpartofColombia,approximately Kaifenheim. InLaGuajiraandMagdalena,ourproject them toaccessgovernmentservicesandprograms,”says cal populationtosustainablyimprovelivingconditions Our commitmenttoworkingincooperationwiththelo- Haiti: Supportinglocalinitiatives To improvelivingconditionsinthelong-term,our 515 Colombia 1,622 Brazil 450 Venezuela 424 3 ments in2017: Our achieve- Goal: displaced people Climate changeadaptationandhealthcarefor for 2018: Outlook Partners: Donors: up thesewersafterheavyrains. neighborhoods havealsotakenuptheroleofcleaning of hygieneseriously.Volunteercommitteesfromthe UJOVFUPmPVSJTI BOENBOZMPDBMTIBWFUBLFOUIFJTTVF actively committedinensuringcommunitygardenscon- unfolding exactlyaswashoped:urbaninitiativesare own initiative,”saysKaifenheim.Inmanycases,thisis projects, andcancontinueworkingonthemtheir people arethemselvesinvolvedandcommittedinthe communal andschoolgardens.“Wewanttoseethat nal purposes.Wearealsoworkingtocreateandsupport security. Themoringatreecanalsobeusedformedici- deforestation, improvesoilfertility,andincreasefood moringa tree,forexample,weareworkingtoreverse says Kaifenheim.Byintroducingthecultivationof now upscalingprojectsthathaveprovensuccessful,” several pilotprojectscenteredonfoodsecurity,weare families fromTabarreandCitéSoleil.“Buildingon sanitation, andhygieneconditionsforabout6,000 improving foodandnutritionsecurity,aswellwater, JTBMTPFYFNQMJlFECZPVSQSPHSBNJOHaiti. Thecountry struggle, andmanypeopledonothaveenoughtoeat. like TabarreandCitéSoleil,wheresurvivalisadaily The situationisevenworseindenselypopulatedslums inequality –thecountryispoorestinAmericas. pounded byissuesofpoverty,poorinfrastructure,and earthquake. Haiti’svulnerabilitytodisastersiscom of theisland,settingbackprogressmadeafter2010 October 2016,HurricaneMatthewdevastatedlargeparts is alltooaccustomedtonaturalhazardsanddisasters.In Along withlocalpartners,wearecommittedto hygiene). in trainingsonhealthorWASH(water,sanitation,and food securitytraining;and5,333peopleparticipated with supplementaryfood;424peopleparticipatedin tors; 515childrenundertheageofﬁvewereprovided training of275healthpromotersandskillspropaga- health centersinwhich450patientsweretreated; people; reconstructionof31houses;supportforthree Distribution offoodandhouseholditemsto1,622 Strengthening capacity anddisasterpreparednesstraining their knowledgeandskills,developingemergency aid Strengthening oflocalpartnersbyfurthersupporting ation oftheOrderMalta,MalteserColombia, PDPC ABIUDEA, American,CanadianandColombian Associ- ADH, BMZ,GFFP of foodsecurityandhealthcare Colombian communitiesforthelong-termimprovement theresilienceofindigenousandAfro- - Cuba Jamaica Goal: Ensuring self-sufﬁciencyintheslums 2018: Outlook for Partners: Donors: ments in2017: Our achieve- 800 55 ness trainings emergency aidcapacities,anddisasterprepared- improvement ofthefoodsecurity,expansion Continuationofsuccessfulpilotprojectsforthe La Différence,PENAH,RRHCIPROG BMZ, GFFP were implemented. the improvementofwater,sanitation,andhygiene constructed; and55trainingsessionspertainingto 54 schoollatrineswererenovatedand/ornewly sures suchastrainingintheareaoffoodsecurity; to improvetheirlivingconditionsthroughmea- vent denguefeverandZika;536peoplewereable kits; 800familiesreceivedmosquitonetstopre- 784 peoplereceivedhouseholditemsorhygiene sanitation, andhygieneconditions the improvementofnutritionaswellwater, Supportandpromotecivilsocietyinitiativesfor Colombia Haiti 54 Dominican Republic Venezuela 784 536 emergency response.” on disasterpreparednessarejustasimportantrapid events isincreased.Inthiscontext,regulartrainings this regiondemandsthatpopulationresiliencetothese ribbean. “Thehighvulnerabilitytonaturaldisastersin capacities, especiallyinourprojectregionstheCa- Another focusistheexpansionofemergencyresponse within ourpartnerorganizations,”saysKaifenheim. particularly interestedinbuildingupskillsandexpertise communities evenfurtherintheyearstocome.Weare “We intendtoexpandourcooperationwithlocal ing emergencyaid Outlook: Strengtheninglocalcapacities,expand- training ondisasterriskreduction. in ourprojectlocationsforfutureincidentsbyproviding emergency situations,wealsofocusonpreparingpeople relief interventions.Whilewearequicktorespond ing, hygieneproducts,orshelterthroughouremergency North andSouthAmericareceivedfood,water,cloth- a retirementhome.Lastyear,nearly100,000peoplein the OrderofMaltainreconstructionaschooland devastation, wesupportedtheMexicanassociationof Mexico, wheretwosuccessiveearthquakesbrought food aid,water,andessentialhouseholditems.In BGGFDUFECZIVSSJDBOFTJO5FYBTBOE1VFSUP3JDPXJUI the UnitedStates,wesupportedabout62,500people the naturaldisastersthathitAmericasin2017.In vital humanitarianreliefintheaftermathofmany of theOrderMalta,wewereabletobringrapidand Thanks toclosecooperationwithnationalassociations provide rapidassistanceduringcrisis Emergency aid:Workingwithreliablepartnersto PHOTO: MALTESERCOLOMBIA cultural heritage. ethnic groupanditsrich contact withtheWayuu Colombia, bringsusin Our workinLaGuajira, 39 Our programs in 2017

Total expenses 2017: ¤ 3,503,805 | Previous year: ¤ 2,201,097 | Regional costs 2017: ¤ 61,280 (including other funds from contracts already booked in the previous year)

Country* No. of Project location and short description Donors Local partners America Expenses 2017 projects

40 Colombia3 4 Magdalena and La Guajira: ADH, ABIUDEA, Colombian 41 ¤ 194,048 – Building local capacities in the area of food security, Water, Sanitation and Hy- BMZ, Association of the giene (WASH) as well as disaster preparedness in order to preserve livelihoods and GFFP Order of Malta, Malteser strengthen resilience of vulnerable indigenous Afro-Colombian communities Colombia, PDPC – Improving access to primary healthcare including mother and child health and providing psychosocial support for female survivors of violence and displacement in rural settlements for internally-displaced people – Increasing local capacities for the prevention of vector-borne diseases – Providing emergency relief for communities affected by ﬂooding in the aftermath of Hurricane Matthew; Building resilience for vulnerable families

Country* No. of Project location and short description Donors Local partners Expenses 2017 projects Malteser International Annual Report 2017

Haiti1 5 Cité Soleil and Tabarre: Strengthening resilience of urban slum commu- ADH, ASAELKAB, La Dif- ¤ 2,623,535 nities through: BMZ, férence, PENAH, – Food security measures, WASH and disaster preparedness GFFP RRHCIPROG – Natural resource management – Contribution to a child friendly environment through construction of a playground Belle Anse: – Strengthen resilience of food security through ensuring access to water for drinking and other uses and capacity building in the areas of environment, WASH and nutrition – Sustainable improvement of the water, sanitation and hygiene conditions while contributing to promote health and build skills in the ﬁeld of food security and nutrition

Country* No. of Project location and short description Donors Local partners Expenses 2017 projects

Ecuador2 1 Pedernales (Manabí): ADH Ecuadorian Association ¤ 42,044 – One-time cash distribution of approximately ¤ 200 for 172 beneﬁciary families of the Order of Malta

Local Partners: Country* No. of Project location and short description Donors Local partners ABIUDEA: Asociación de Expenses 2017 projects Biólogos de la Universidad del Atlántico PENAH: Pépinière des Enfants Mexico2 2 Mexico City: BILD hilft Mexican Association of pour l’Avenir d’Haiti RRHCIPROG: Rassemblement ¤ 29.581 – Ensuring a better future for mothers living with HIV by avoiding a vertical e.V. „Ein the Order of Malta des Rapatriés Haïtiens et des transmission; Providing sychosocial support and creating a healthy environment Herz für Citoyens Progressistes for both mothers and children Kinder“, ASAELKAB: Association des Agriculteurs et Eleveurs de Oaxaca: Donations Kadik Belle Anse – Supporting relief activities of the Mexican Association of the Order of Malta

List of abbreviations Donors: after the September 2017 earthquakes ADH: Aktion Deutschland Hilft – Germany’s Relief Coalition Country* No. of Project location and short description Donors Local partners Financial Report 2017 BMZ: Bundesministerium für Expenses 2017 projects wirtschaftliche Entwicklung und Zusammenarbeit – German Federal Ministry for Economic Peru2 1 Lima and Querecotillo: Donations Malteser Peru Cooperation and Development GFFP: Global Fund For ¤ 6,838 – Support of social program of Malteser Peru (soup kitchen and elderly people´s Forgotten People club) and support of emergency activities after heavy rains 'JOBODJBMEFWFMPQNFOUBOEBOOVBMBDDPVOUT PVSQSPHSBNT

1 Projects implemented by Country* No. of Project location and short description Donors Local partners QBSUOFST BOETUSVDUVSFTBUBHMBODF Malteser International and Expenses 2017 projects partner organizations 2 Projects implemented by national associations and aid USA3 1 Texas, Virgin Islands and Puerto Rico: Donations Catholic Charities of services of the Sovereign Order of Malta with support from ¤ 546,479 – Support local relief activities after Hurricanes Harvey, Irma and María Southeast Texas Malteser International Salt Lake Church, Order 3 Projects implemented by local partner organizations of Malta Puerto Rico, St. with support from Malteser Peter Catholic Church International 42 PHOTO: FRANKLÜTKE Malteser International Annual Report 2017 Finances continue todoso inthefuture. UIFTBGFUZPGPVSQFSTPOOFMPOUIFlFMEJO BOEXJMM sure youthatwededicatedallof oureffortstoensuring help tovulnerableremainsahuge challenge.Icanas- guaranteeing thesafetyofourteams whilebringing safe accessforaidworkers.Despite ourgreatestefforts, tarian actionwillbeineffectivewithoutunimpededand in whichweworkaregrowingcomplexity.Humani- Furthermore, humanitariancrisesintheenvironments aid whenitcomestosavinglivesincrisissituations. no alternativetothequickapolitcalhumanitarian have affectedourworkinthepastyear.Thereisstill are forcingthousandsofpeopletoleavetheirhomes. Congo, aswelltheeconomicmeltdowninVenezuela, the violenceinBurundiandDemocraticRepublicof POHPJOHDPOmJDUTBOEDSJTFT)PXFWFS OFXPOFTTVDIBT is stillgrowing.Thisincreasefueledinlargepartby people forciblydisplacedfromtheirhomesworldwide region thatweworkinfacedcrises.Thenumberof struck citiesintheUSandCaribbean–almostevery DPOmJDUJOUIFJSIPNFDPVOUSZ BOETFWFSBMIVSSJDBOFT of thousandsRohingyaweredisplacedbyviolent strategic leadership Structural developmentand Secretary General’sReport: I Globally, wecanidentifytwodevelopmentsthat lHIUJOHDPOUJOVFEJO*SBRBOE4ZSJB IVOESFET Lake Chadregionfacedseverefoodinsecurity, lions ofpeopleintheHornAfricaand n retrospect,2017wasnotaneasyyear.Mil- United NationsEconomic andSocialCouncil(ECOSOC) Agency forInternationalDevelopment (USAID)andthe with thesigningofapartnership agreementwiththeUS UPUIF6OJUFE/BUJPOT5IJTIBTBMSFBEZCPSOFlSTUGSVJU national AmericastoNewYorkCity inordertobecloser was tomovetheregionalheadquarters ofMalteserInter ers inglobalhumanitarianaid.Onesteptowardsthisgoal continue toworkoncreatingnetworksofimportantplay access toauniqueinternationalnetwork.Moreover,we need. WiththeOrderofMalta,MalteserInternationalhas JTFTTFOUJBMJOPSEFSUPlOEUIFCFTUTPMVUJPOTGPSQFPQMFJO cal players,partnerorganizations,experts,andcolleagues completed bytheendof2018. BQQSPWFEQSPDFEVSFT5IJTDFSUJlDBUJPOQSPDFTTTIPVMECF in 72hoursaccordingtostandardizedandinternationally the WHO,beabletocareforpatientsindependentlywith logistics specialistsandcoordinatorswill,uponrequestby when catastrophestrikes,ateamofdoctors,paramedics, UJlFECZUIF8PSME)FBMUI0SHBOJ[BUJPO 8)0 5IFO in placetohaveouremergencymedicalteam(EMT)cer deliver emergencyaid.Toachievethis,wehaveputplans key decisionforthefutureistoincreaseourcapacity International’s sustainabilityasanorganization.One some importantprojectsinordertoassureMalteser We madesomestrategicdecisionsin2017andlaunched Organizational Development Ingo Radtke,SecretaryGeneralofMalteserInternational UJPOTv JUDPNFTUPTBWJOHMJWFTJODSJTJTTJUVB RVJDLBQPMJUDBMIVNBOJUBSJBOBJEXIFO h5IFSFJTTUJMMOPBMUFSOBUJWFUPUIF In complexenvironments,astrongnetworkofpoliti

------development of the organisationonnextpages. learning processes. to continuallyimproveourworkanddriveforward following pages.Ourgoalistousethisasafoundation ing tothisstandard.Youcanseetheresultson we havenowbeenabletoevaluateourworkaccord- an alliancetoimprovethequalityofhumanitarianaid, 2016 commitmenttotheCoreHumanitarianStandard, development. Thisprocesscontinuedin2017.Afterour sive proceduresintheareaofqualityandorganizational with thesenationalorganizations inthecomingyears. expand andintensifyouralready valuablecooperation their supportisforthesuccessof ourwork.Wehopeto Service Austria.Theseresultsdemonstrate howessential ticular byMalteserGermanyandtheHospital by regionalorganizationsoftheOrderMalta,inpar made possiblebythesuccessfulfundraisingworkdone projects forpeopleinneedaroundtheworld.Thiswas teams wereabletoputaround€47millionuseinour our projectvolumeatahighlevelinthelastyear.Our was onceagainpositive.Thisenabledustomaintain .BMUFTFS*OUFSOBUJPOBMTlOBODJBMEFWFMPQNFOUJO Financial development positions usattheforefrontofglobalhumanitarianrelief. expert advicetotheCouncilanditssubsidiarybodies, status. Thespecialconsultativestatusallowsustoprovide granting MalteserInternationalaspecialconsultative Emergency MedicalTeam(EMT) EMT certiﬁcationshouldbereadybyyear-end2018 • • • • The team… :PVDBOlOEEFUBJMFEJOGPSNBUJPOBCPVUUIFlOBODJBM In 2016,webegantheprocessofintroducingexten- required fortheoperation will provideallmaterialandsupplies to 100peopledaily should beabletoprovidemedicalcare must beabletoworkforup6weeksonground must bereadytodeploywithin72hours Doctors Medical Coordinator Medical Technicians Nurses/Emergency

- Staff Development everyone whohas supportedusinourwork. the past.Iwouldliketogivemy mostsincerethanksto this yearwiththesamespiritthat wehaveshownin ment ofMalteserInternational. Secretariat andistaskedwithsupporting themanage- key policyquestions.ThisteamisbasedintheGeneral also createdaspecialistteamresponsibleforclarifying abreast ofthecomplexdemandsourwork,wehave ment willbeginworkinthemiddleofyear.Tostay in ordertooptimiseourinternalprocesses.Thisdepart- department ‘OrganisationalDevelopmentandQuality’ tioned in2018.Wehaveestablishedanewspecialist We willcontinuetofocusonmanyofthetopicsmen- Prospects forthecurrentyear SFTQFDUJWFlFMET recruited fromtheranksofleadingexpertsintheir it includespeoplefromover40differentcountries The MalteserInternationalteamisstillverydiverse: ployed attheheadquartersinCologneandNewYork. from thepreviousyear.Around80peopleareem- the otherhandwas–at63almostsameas64 JO 5IFOVNCFSPGFYQBUSJBUFTUBGGJOUIFlFME PO year 2017,weemployed835locals(comparedto796 our humanitarianaidworkareshowingresults.Inthe local actorsandpartnerorganizationsatthecentreof Our continuedeffortstodecentralizeourworkandput The publicfaceofMalteserInternationalischanging. Mental HealthExpert We willapproachtheissuesand tasksthatarise Team LeaderEMT Emergency Relief Coordinator (HQ) (ﬁeld) and Health(WASH) Water, Sanitation, Specialist Logistics Specialist Administration Specialists Finance/ sational development. key focusofourorgani- gency aidcapacityisa Developing ouremer- 44 Malteser International Annual Report 2017 Transparency FGGFDUJWFMZTPUIBUBJEBSSJWFTXIFSFJUJTTPWJUBMMZOFFEFE UIFNPTUWVMOFSBCMFQFPQMF*OPVSXPSL XFFNQMPZUIFTFSFTPVSDFTDBSFGVMMZBOE 1SJWBUFBOEJOTUJUVUJPOBMEPOPSTFOUSVTUVTXJUIUIFGVOETOFFEFEUPCSJOHIFMQUP Transparency PGGVOETJTTVTQFDUFE UIFSFJTBOJOUFSOBMOPUJlDBUJPO sive systemofinternalcontrols. Inthecasethatmisuse staff inthesetopicsandhaveestablished acomprehen- lOBODJBMUSBOTBDUJPOTBOEQSPDVSFNFOU8FUSBJOPVS To thisend,wehavedeveloped strictregulationsfor We areactiveintheprevention ofcorruptionandfraud. Strict CodeofConductandfrequentinspections we areabletotakeswiftactionagainsttheserisks. especially inourprojectlocations.Throughthissystem, allows ustoidentifypossibleriskstheorganization, wishes. that fundsarebeinginvestedaccordingtoourdonors’ form regularprojectcyclemonitoringinordertoverify the project.Ourteamsandpartnersongroundper- these budgetsareadheredtothroughoutthecourseof budgets andcontinuouslymonitoringensuringthat to usresponsiblyinvolvesplanningprogramswithclear It goeswithoutsayingthatinvestingthefundsentrusted Regular monitoringandriskmanagement organization readilyavailableonourwebsite. Civil Society(ITZ)bymakingkeyinformationaboutour parency InternationalInitiativeforTransparencyin We alsofollowtheguidelineslaiddownbyTrans- Conduct forTransparencyandCorporateGovernance’. ian aidNGOsinGermany,weadheretothe‘Codeof umbrella organizationofdevelopmentandhumanitar- and qualitystandards:asamemberofVENRO,the lOBODFT CPUIJOUIJTBOOVBMSFQPSUBOEPOPVSXFCTJUF our organizationalstructure,aidprogramsand This iswhywepublishallimportantinformationabout people thatwehelp,tobetransparentandaccountable. We haveanobligation,bothtoourdonorsandthe Accountability todonorsandpeopleinneed Our riskmanagementsystem,launchedin2014, In addition,wehavetakenonfurthertransparency organisational systems. UFSOBMBVEJUT DFSUJGZUIFSFMJBCJMJUZPGPVSlOBODJBMBOE Hilfsdienst. Thesedifferentaudits,inparticulartheex- Spendenrat), ofwhichweareamemberviaMalteser through theGermanCouncilfordonations(Deutscher in Germanyandourprojectcountries,aswell and byexternalauditorsfromourinstitutionaldonors JOHlSN5IFSFBSFBEEJUJPOBMBVEJUTCZUIFUBYBVEJUPST and processesareauditedannuallybyanexternalaudit- standards. Inthesameway,ourrevenues,expenditures, vision ofourprojectsaccordingtoallguidelinesand audit departmentisresponsiblefortheinternalsuper- they arise,andaddressingthem. sponsibilities includehearingsuchsuspicionswhenever system aswellanombudsmanwhosepermanentre- for Malteser International EuropeisamemberoftheGermanCouncil Donations throughthe MalteserHilfsdienste.V.: Our workissubjecttoregularcontrols:theinternal responsibly and according toethicalstandards. RVBMJlFETUBGGXIPVTFUIFSFTPVSDFTBUUIFJSEJTQPTBM thermore, ourworkiswellcoordinated, carriedoutby actors andtheirabilitytohelpthemselves. Fur relevant andeffective,they support local averages. Ourprogrammesareparticularly of whicharehigherthantheinternational we arealreadyachievinggoodresults,some six ofthenineextensivequalitystandards, quality’ isnotmerelyanemptyphrase.In show that,forus,‘ourcommitmentto Uganda andSouthSudan. four differentprojectsinMyanmar, of differentgroupsaidrecipientsfrom our projectdocumentationandasurvey different projectcountries,areviewof survey ofover70employeesfromseven an in-depthanalysisofallourpolicies,a own procedures.Thisself-evaluationincluded undergo anextensivequalityassessmentofits DBNFPOFPGUIFlSTUPSHBOJ[BUJPOTJO(FSNBOZUP own worktothetestin2017.Indoingso,webe- terms oftheseimportantqualitycriteria,soweputour We wantedtoknowwhereourorganizationstandsin while strengtheninglocalactors Our programshaveproventobehighlyrelevant Standard”. humanitarian organizationsinthe“CoreHumanitarian set asself-imposedqualitystandardsbyanumberof our aidprojects.These,andfurthercriteria,havebeen able tobepartoftheplanningandorganization be abletospecifytheirneedsthemselvesand most crucialneeds.Furthermore,wewantpeopleto this, ouraidactivitiesmustbefocusedonpeople’s time, whileachievinglastingimpacts.Inordertodo Our programsmustreachtherightpeopleat It isnotenoughforaidworktojustbewell-intentioned. $PSF)VNBOJUBSJBO4UBOEBSEPO2VBMJUZBOE"DDPVOUBCJMJUZ UPUIFUFTU0VSQSPHSBNTBMSFBEZNFFUTJYPGUIFOJOFDPNNJUNFOUTTFUPVUJOUIF 'PSVT RVBMJUZJTNPSFUIBOKVTUMJQTFSWJDF5IJTJTXIZXFQVUPVSPXOQSPDFEVSFT Quality standards The results of this evaluation clearly The resultsofthisevaluationclearly

dard • Core

do theirjobeffectively, H n Staff are supportedto a and are treated fairly um St 2,90 and equitably. a Humanitarian actors n n continuously learn in 2018and2019. launched aprogramtoimproveinpreciselytheseareas from thefeedbackwereceiveonourwork.Wehave lessons learnedmorequicklyandcomprehensively One furtherpointisthat,infuture,wewishtoapply a i ian Standard. gram evaluationaccordingtotheCoreHumanitar- The graphicbelowshowstheresultsofourpro- in This includesinvolvingpeopleinneedmoredirectly areas inwhichwewishtofurtherimproveourwork. This detailedanalysisalsohelpedustoidentifythe i and improve. t

2,57 a r 8 the planningandimplementationofourprojects. a are managedandused r responsibly fortheir

t intended purpose. i i 7 a n 2,88 n a Resources S m 9 t a coordinated and u complementary. Humanitarian • n response is ce H 3.14 n H e u d d m

n Communities 6 e a a e p and people n r i r e affected by crisis t y d Humanitarian

d and relevant. o appropriate n response is I 3.25

•

and addressed.

are welcomed

o Complaints I

m d 1.90

r p

a 5 e l

r response iseffective

l Humanitarian H

t and timely.

•

a on communication,

response isbased

participation and 2 m t

Humanitarian Humanitarian response

3.00

capacities andavoids

2.40 S feedback.

a strengthens local negative effects.

n 4

t i

r 3

t a

i quality criteria. required insixofthenine fulﬁll thehighstandards Standard: Wealready the CoreHumanitarian assessment accordingto Results ofthequality (ﬂower withscoringgrid): Diagram 3.18 n

t m

a e r r d o

C •

45 46 Malteser International Annual Report 2017 CategoryFinances Financial overview2017 tional Americas,asofDecember31,2017. and theregionalheadquartersMalteserInternationalEuropeInterna This sectionpresentstheconsolidatedannualaccountsofMalteserInternationale.V. 17.1 million.In 2016,wereceivedfundsworth tensof ropean Union,asignificantreduction fromlastyear’s€ of thisamount. lion). TheGermangovernment provided€30.1 million provided €32.3million(lastyear’s figure:€47.8 mil crued astotalrevenue,publicandinstitutionaldonors fiscal yearfortheorganization.Of€48millionac cantly comparedtothepreviousyear,2017wasagood While MalteserInternational’srevenuesfellsignifi Revenue sources Used revenue Appropriation/reversal ofliabilities Total income US DepartmentofState USA World FoodProgramme UNICEF United Nations EuropeAid ECHO European Union German Embassies and Development Federal MinistryforEconomicCooperation Federal ForeignOffice Germany public grants National andinternational Approximately €1millioneuros camefromtheEu ¤ 47,994,139 ¤ 30,102,172 ¤ 32,331,191 ¤ 47,853,035 ¤ 14,675,156 ¤ 15,394,020 ¤ 553,734 ¤ 779,446 ¤ 895,819 ¤ -141,104 ¤ 553,734 ¤ 101,253 ¤ 678,213 ¤ 395,819 ¤ 500,000 ¤ 32,996 In 2017,wereceived threemillioneurosfrom coali price, oradministrative feesfromourdonors. turnover, profitsfromcurrency exchange,changesin Added tothiswere€3million euros generatedfrom of theOrderMalta,€500,000 morethanlastyear. from privatedonorsthroughthe internationalnetwork continued in2017.Wereceived around€6.7 million booked forthefiscalyear2016,andimplementation Republic ofCongo.Theseprojectfundswerealready millions formulti-yearaidprojectsintheDemocratic Deutscher Caritasverband Lachen Helfen Gerda HenkelStiftung UAntwerp BILD hilft Orienthelfer Foundation forInnovativeNewDiagnostics Arbeiter-Samariter-Bund ZOA Stiftung Save theChildren Foundations andotherNGOs ADH -Germany‘sReliefCoalition Partnerships anddonationcampaigns Other revenue Global FundforForgottenPeople Malteser HospitaldienstAustria Malteser StiftungSeligerGerhard Donations andownfunds International OrderofMaltanetwork

¤2,920,979 ¤9,720,832 ¤ 3,021,137 ¤ 1,671,434 ¤ 3,021,137 ¤ 2,980,852 ¤ 1,000,000 ¤ 5,417,484 ¤108,495 ¤ 156,935 ¤ 307,000 ¤ 435,374 ¤ 214,001 ¤ 12,739 ¤ 35,500 ¤ 50,000 ¤ 62,409 ¤ 93,096 ¤ 96,492 - Development ofrevenue Development ofexpenses 2017 financialresults:¤465,166 2 1 ¤ 3,056,160 ¤ 41,134,971 ¤ 44,191,131 2013 and grantsfromafiscalyeararebookedasliabilities a sustainablemanagementoffunds.Unuseddonations in thefollowingyearslinewithourcommitmentto lion. Manyprojectsthatstartedin2017willbecontinued around €1.7million(2016:1.6million). the Childrenmakinghighestcontributionwith and othernon-governmentalorganizations,withSave sum of€2.9millionthroughfundingfromfoundations Relief Coalition(2016:€5.7million).Wereceiveda to thesupportofAktionDeutschlandHilft-Germany's tions andfundraisingcampaigns,thanksinlargepart in 2017,whileprojectexpensesamountedto€44.2mil ¤ 11,894,706 ¤ 32,287,206 ¤ 44,181,912 2013 Other revenue:unusedearmarked donationsfromthepreviousyear,interest,exchangegains Inclusive of“otherrevenue”prior to2014 A totalof€47.4millioninrevenuewasbooked ¤ 1,928,676 ¤ 31,540.979 ¤ 33,469,655 2014 ¤ 3,735,942 ¤ 6,049,030 ¤ 22,004,872 ¤ 31,789,844 2014 ¤ 2,438,238 ¤ 30,370,317 ¤ 32,808,555 2015 ¤ –3,380,016 ¤ 1,599,264 ¤ 9,300,341 ¤ 27,206,788 ¤ 34,726,377 2015 to €3.2million.Lastyear’scostswere 2017, managementandadministrationcostsamounted costs remainwithinanobjectivelyappropriatelimit.In while ensuringthatadministrationandmanagement economically, efficiently,andinagoal-orientedmanner, expended forprojectsinthesubsequentyears. ity ofourprojectsinthelongterm. generation. Thisway,weensurethefinancialsustainabil the reservesandcanbeusedinyearswithlowerrevenue year’s financialresults.Thesefundsaretransferredto € 3.0million. Malteser Internationalusesallfundsentrustedtoit Surplus unrestrictedfundsreflectpositivelyonthe ¤ 2,972,910 ¤ 45,948,502 ¤ 48,921,412 2016 ¤ –13,640,735 ¤ 2,610,560 ¤ 5,852,190 ¤ 55,328,316 ¤ 50,150,331 2016

¤ 3,200,069 ¤ 44,187,800 ¤ 47,387,869 2017 ¤ –141,104 ¤ 2,980,852 ¤ 5,417,484 ¤ 39,595,803 ¤ 47,853,035 2017 Used revenue Total expenses liabilities release of Appropriation/ Other revenue Private donations Grants costs and administration Management Project expenses 47 47 2 1 Expenses by region Expenses by sector and phase of relief

*O PVSUFBNTBOEQBSUOFSTXFSFPOUIFHSPVOEJODPVOUSJFTBDSPTT "GSJDB "TJB &VSPQF UIF.JEEMF&BTU BOE"NFSJDBT8FJNQMFNFOUFEPWFS QSPKFDUTBTXFXPSLFEUPCSJOHIFMQUPUIPTFXIPOFFEJUNPTU Finances Others Distribution of relief items Sectors 48 Capacity Building for Civil Society 49

Asia (¤ 11.7 million) Health 57% Disaster Risk Reduction and Climate Change Adaptation Since many countries in South and East Asia are partic- Uganda with a project volume of € 3 million in 2017. WASH 17% Nutrition 8% ularly vulnerable to extreme weather events and natural In South Sudan, our aid projects for displaced persons Disaster Risk Reduction disasters, Disaster Risk Reduction (DRR) remains an UPUBMFEÏNJMMJPO5PlHIUUIFIVOHFSDSJTJTJO and Climate Change Nutrition important area of our work in the region. However, Kenya, we expended € 2.9 million in project activities. Adaptation 7% we continue to implement projects in the sectors of In addition to our emergency relief interventions, Capacity Building for Health IFBMUIBOEIZHJFOF$POmJDUTBOEQPMJUJDBMJOTUBCJMJUZJO strengthening local health systems, and improving Civil Society 3% Distribution of relief items 2% some Asian countries continue to pose a major threat food security and access to clean water remain an im- Others 7% GPSNBOZJOUIFSFHJPO*O WJPMFOUDPOmJDUJO portant area of our work in Africa. In the Democratic

Malteser International Annual Report 2017 Myanmar forcibly displaced over 680,000 members of Republic of Congo, we are working to improve health- WASH UIF3PIJOHZBFUIOJDNJOPSJUZHSPVQ.PTUPGUIFNmFE care in rural areas. This program remains our largest to Bangladesh where we provided medical care and in the continent with a total volume of € 4.8 million. psychosocial support in the refugee camp in cooperation 5IFlOBODJBMWPMVNFPGPVSQSPKFDUTJO"GSJDBGPSUIF with a local partner. We implemented 57 projects in ten lTDBMZFBSSPTFUPBMNPTUÏNJMMJPO DPNQBSFE countries in Asia in 2017, with a total volume of € 11.7 to € 9.6 million in 2016. million – a reduction from last year’s € 15.2 million. Our The Americas (¤ 3.5 million) Long-term aid and Relief phases programs in Myanmar (€ 5 million), Thailand (€ 2.1 development NJMMJPO BOE1BLJTUBO ÏNJMMJPO BDDPVOUFEGPSUIF Our primary focus in the Americas is Latin America Emergency relief 46% largest share of the total project volume for Asia. and the Caribbean. In 2017, we implemented projects Recovery/rehabilitation 25%

with a total volume of € 3.5 million – an increase on Long-term aid and Middle East (¤ 12.8 million) last year’s total of € 2.2 million. Haiti continued to be development 29% The humanitarian situation in countries in the broader PVSNPTUTJHOJlDBOUBSFBPGBDUJWJUZJOUIFSFHJPOXJUI Middle East continued to deteriorate as violent unrest a total project volume of € 2.6 million. Our programs and political instability persisted. The ongoing war in in the country are especially focused on increasing the 4ZSJBBOEUIF*SBRDPOmJDUDMBJNFEUIPVTBOETPGMJWFT resilience of civil society organizations and the local and displaced millions of people from their homes. The population at large. This strategy is illustrated in our Emergency relief movement of refugees caused by these crises has put projects for vulnerable communities in Cité Soleil and pressure on neighboring countries like Lebanon and Belle-Anse. Turkey. In the year 2017, our work in the Middle East In 2016, our work in Latin America was focused on Recovery/rehabilitation was centered on supporting refugees and displaced per- climate change adaptation and activities in the health sons, while helping host countries strengthen existing sector, and WASH measures. medical infrastructures. The total project volume for the region amounted to € 12.8 million (last year: € 15.9 Europe (¤ 1.3 million) million). +VTUMJLFMBTUZFBS PVSmPPESFMJFGQSPKFDUTJO#BWBSJB Thuringia, Saxony and Saxony-Anhalt accounted for Africa (¤ 14.9 million) BTJHOJlDBOUTIBSFPGUIFlOBODJBMWPMVNFPGPVSQSPK- Our mandate at Malteser International is to provide rap- In 2017, emergency relief operations took up around In 2017, the lives of over 40 million people in Afri- FDUTJO&VSPQF4PNFUPXOTBGGFDUFECZUIFmPPEJOH id and effective relief in the aftermath of an emergency. 46 % of our aid activities. A further 25 % was provided ca were threatened by a severe food crisis caused by faced social and economic challenges even before the We provide medical care, clean drinking water and san- during the phase of rehabilitation and recovery, while QSPMPOHFEQFSJPETPGESPVHIUBOEWJPMFOUDPOmJDU"UUIF disaster, and for many residents the situation remains itation, and distribute food and essential supplies. Even 29 % comprised long-term aid projects in the form of start of the year, the situation had become so acute that critical. In 2017, we supported the reconstruction of in the early phase of emergency relief, our programs development. Our core sectors remain Health, and Wa- thousands of people in South Sudan were on the brink UXPTDIPPMT XIJMFQSPWJEJOHlOBODJBMBOEQTZDIPTPDJBM focus on building the resilience of affected communities ter, Sanitation, and Hygiene (WASH), with projects in of starvation. The crisis in South Sudan led to the mass TVQQPSUGPSGBNJMJFTBGGFDUFECZUIFmPPEJOH0VSQSPK- in order to ensure sustainable development. We work to these sectors accounting for 57 % and 17 % of our total movement of over a million South Sudanese refugees ect expenditures in Europe amounted to € 1.2 million. help the people improve their livelihoods, and build eco- volume, respectively. into neighboring countries. We supported refugees in OPNJDTFMGTVGlDJFODZGPSUIFNTFMWFTJOUIFMPOHUFSN 50 * OrderofMaltaWorldwideRelief MalteserInternationalAmericasInc. Assets C. Accruedanddeferredincome II. Cashinhand,bankbalancesandchecks I. B. Curentassets Tangible assets A. Fixedassets Malteser International Annual Report 2017 Accounts 5. Otherassets 4. 3. 2. 1. Tradereceivables 2. Advancepayments 1. Otherequipment,operatingandbusinessequipment Receivables andotherassets – internal Receivables fromMalteserHilfsdienste.V. Receivables fromrelatedcorporateentities interests areheld Receivables fromcompaniesinwhichparticipatory Annual accounts2017 legally dependentdivisionofMalteserHilfsdienste.V. ternational Europe.MalteserInternationalEuropeisa Inc.*, withheadquartersinNewYork,andMalteserIn- Cologne, Germany,MalteserInternationalAmericas Malteser Internationale.V.withheadquartersin tional comprisestheaccountsofthreeentities: The consolidatedbalancesheetofMalteserInterna- 64,867,429.96 16,252,989.91 48,241,564.42 40,235,945.43 5,240,373.70 2,559,120.10 169,235.64 203,639.99 206,125.19 203,639.99 MI Europe Cologne 0.00 0.00 ¤ 569,179.30 537,861.72 MI America 31,317.58 31,137.76 New York 179.82 0.00 0.00 0.00 0.00 0.00 0.00 0.00 ¤ 120,658.26 accounts. well asanoverallviewofMalteserInternational's the individualbalancesheetofthreeentities,as DZ XFIBWFQSFQBSFEUIFlOBODJBMTUBUFNFOUTUPSFmFDU consolidated balancesheet.Forthesakeoftransparen- settlements ofthethreeentitiesareeliminatedin XJUIJUTPXOBOOVBMlOBODJBMTUBUFNFOUT5IFJOUFSOBM 25,000.00 53,662.12 41,996.14 11,996.14 30,000.00 Cologne MI e.V. 0.00 0.00 0.00 0.00 0.00 ¤ -102,137.76 -102,137.76 -102,137.76 Elimination of Elimination of transactions internal internal 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 ¤ 65,455,129.76 16,844,513.75 48,212,740.38 40,248,121.39 5,240,373.70 2,518,120.10 194,235.64 203,639.99 31/12/2017 206,125.19 203,639.99 MI total 0.00 0.00 ¤ 62,267,770.27 14,701,422.33 47,222,136.54 39,519,581.07 Previous year 3,928,668.40 3,737,425.72 170,236.52 173,974.88 173,974.88 36,461.35 MI total 0.00 ¤ 0 Notes onconsolidatedbalance sheetfor2017 PODMBTTJlDBUJPO BDDPVOUJOHBOEWBMVBUJPOBQQMJDBCMF gesetzbuch –HGB),andincompliancewithregulations in accordancewithGermanCommercialCode(Handels- al e.V.andMalteserInternationalEuropewereprepared 5IFBOOVBMlOBODJBMTUBUFNFOUTPG.BMUFTFS*OUFSOBUJPO- Equities andliabilities D. Accruedanddeferreditems 6. Otherliabilities 5. 4. 3. 2. 1. Tradepayables C. Liabilities B. Accruedliabilities–Otheraccrued III. Gains/lossesfromcurrencyconversion II. Annualnetloss/netproﬁt I. Assetsoftheassociation A. Equity Liabilities onassignedrevenue Liabilities toMalteserHilfsdienste.V.–internal Liabilities torelatedcorporations interests areheld Liabilities tocompaniesinwhichparticipatory 64,867,429.96 58,654,311.17 13,457,727.09 43,266,578.42 5,043,346.38 1,084,831.63 1,169,772.41 4,661,217.40 810,546.22 382,128.98 MI Europe 34,627.81 Cologne 0.00 ¤ prepared andauditedinaccordancewithUSlaw. statements ofMalteserInternationalAmericas,Inc.are DMBTTFTJOTFDUJPOPGUIF)(#5IFBOOVBMlOBODJBM UPDPNQBOJFTPGBDPNQBSBCMFTJ[FBTEFlOFEJOUIFTJ[F 569,179.29 363,771.42 205,407.88 MI America 323,268.38 154,723.00 40,503.04 53,807.53 New York 3,122.65 0.00 ¤ 120,658.26 48,050.00 61,608.26 48,000.00 29,229.63 32,378.63 4,000.00 7,000.00 Cologne MI e.V. 50 ¤ -102,137.76 -103,223.79 -103,223.79 Elimination of Elimination of transactions 1,086.03 1,086.03 internal internal 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 ¤ 65,455,129.76 58,962,908.80 13,457,727.09 43,589,846.80 5,311,448.55 1,084,881.63 1,176,772.41 4,848,319.03 31/12/2017 810,546.22 465,166.14 19,907.06 -2,036.62 4,000.00 MI total 0.00 ¤ 62,267,770.27 56,248,690.08 10,854,684.41 43,485,415.76 4,864,244.88 Previous year 1,473,487.99 1,154,835.31 1,228,918.50 3,642,111.29 432,436.46 -6,784.91 2,485.46 MI total ¤ Income Statement from 1 January to 31 December 2017 Notes on the income statement for Malteser International for the ﬁscal year 2017 Accounts

52 5IFJODPNFTUBUFNFOUIBTCFFOQSFQBSFEVTJOHUIFDPTUTVNNBSZNFUIPE 5IFGPMMPXJOHQPJOUTFYQMBJOUIFlHVSFTQSFTFOUFEJOUIFDPOTPMJEBUFEQSPlUBOE 53 JOBDDPSEBODFXJUI4FDPGUIF(FSNBO$PNNFSDJBM$PEF )(# 5IFSFHVMB- MPTTTUBUFNFOUPG.BMUFTFS*OUFSOBUJPOBM UJPOTCZUIF"DDPVOUJOH(VJEFMJOFT*NQMFNFOUBUJPO"DU #JM3V( XFSFBQQMJFEGPS UIFlSTUUJNFUPUIFlHVSFTGSPN

1. The activities of Malteser International are generally *OUIFSFMFWBOUlTDBMZFBS UIFMJBCJMJUZGPSUIFTFVO- lOBODFECZEPOBUJPOTPSQVCMJDHSBOUT5IFTFSWJDF used donations leads to the Expenses due to addition charges referred to here as Revenue are of negligible to liabilities related to earmarked donations. volume. 1MBOOFEBOESFHVMBSAmortization and write-downs of %POBUJPOTBOEHSBOUTBSFTVCTVNFEJOUPUIFlHVSF intangible assets and depreciation and write-downs MI Europe MI America MI e.V. Consoli- MI total MI total Malteser International Annual Report 2017 Cologne New York Cologne dation 31/12/2017 Previous year for Other operating income. For the most part, this of property, plant and equipment are shown here. ¤ ¤ ¤ ¤ ¤ ¤ refers to earmarked donations and grants which 8. A number of items are included under Other operat- must be used for designated projects. These funds ing expenses. Among these are, for example, direct 1. Revenue 61,095.45 0.00 61,095.45 69,815.96 come from public donors in Germany, the EU and project costs, such as support of project partners, ve- 2. Other operating income 47,063,270.84 1,269,588.08 88,000.00 –492,518.00 47,928,340.92 63,711,519.44 other countries, as well as from private donors (see hicle expenses, cost of premises, cost of maintenance 47,124,366.29 1,269,588.08 88,000.00 –492,518.00 47,989,436.37 63,781,335.40 also the diagram Revenue Sources on p. 46). They and repair; indirect project costs such as communi- are supplemented by unrestricted donations, which cations and coordination, as well as IT infrastructure 3. Cost of materials can be used freely without reference to a particular BOElOBODFNBOBHFNFOU*O UIFTIBSFPG a) Cost of raw materials, consumables and 6,491,844.10 68,618.90 6,560,463.00 5,816,652.52 designation. administrative expenses was less than 10 % of total supply of purchased merchandise 3. Donations are expended in the course of our work expenditure. b) Cost of purchased services 2,331,543.78 6,904.49 2,338,448.27 2,654,624.98 on material costs such as medical and aid supplies, 9. Funds that are not needed for aid activities in the 4. Personnel expenditures or payment of building contractors in reconstruction short term are deposited. The resulting interest and projects. income from securities can be seen under Other a) Wages and salaries 10,184,582.82 439,573.92 10,624,156.74 12,484,032.00 4. Furthermore, we require local and international staff interest and similar income. b) Social security contributions, and expenditures 911,406.01 911,406.01 874,283.18 to carry out and coordinate our aid projects. These 10. Interest and similar expenses are as a rule the result for retirement beneﬁts costs can be seen under the item Personnel expenses. of project funds not being disbursed in a timely fash- 19,919,376.71 515,097.31 0.00 0.00 20,434,474.02 21,829,592.68 This includes a proportion of costs for personnel ion. Subtotal 27,204,989.58 754,490.77 88,000.00 –492,518.00 27,554,962.35 41,951,742.72 administration. 11. The Result from ordinary activities is the result before 5. Our aid projects often have a duration of more than taxes. 5. Income from the release of liabilities related to 43,235,022.19 233,637.12 43,468,659.31 29,832,737.33 earmarked allocations one year. Earmarked donations that cannot be com- 12. Other taxes are most often due to tax legislation in QMFUFMZVTFEEVSJOHUIFDPVSTFPGUIFSFMFWBOUlTDBM project countries. 6. Expenses due to addition to liabilities related to 43,266,578.42 343,184.71 43,609,763.13 43,473,471.79 earmarked allocations year are included as liabilities related to earmarked 13. As the income statement shows, Malteser Interna- allocations. When the project is continued in the tional was able to record a surplusGPSUIFlTDBMZFBS 7. Depreciation and amortization of intangible assets, 157,549.00 157,549.00 138,265.99 property, plant and equipment following year, this liability is resolved. This leads 2017. to the Income from release of liabilities related to 8. Other operating costs 26,551,960.58 591,135.65 58,770.37 –492,518.00 26,709,348.60 26,881,656.22 earmarked allocations seen in the statement. Subtotal 463,923.77 53,807.53 29,229.63 0.00 546,960.93 1,291,086.05

9. Other interest and similar income 4,702.36 0.00 4,702.36 9,729.82

10. Interest and similar expenses 9,997.38 0.00 9,997.38 3,814.38

11. Results from ordinary activities 458,628.75 53,807.53 29,229.63 0.00 541,665.91 1,297,001.49

12. Other taxes 76,499.77 0.00 76,499.77 68,082.99

13. Annual surplus 382,128.98 53,807.53 29,229.63 0.00 465,166.14 1,228,918.50

* incl. 8,634.46 exchange rate difference 54 advance. has beenapprovedin Malteser International the annualreportof auditors' reportin * Thepublicationofthe Malteser International Annual Report 2017 CategoryAccounts Independent auditors’report 5IFBVEJUPGlOBODJBMTUBUFNFOUTBMTPJODMVEFTBTTFTTJOH internal controlsystemoftheAssociation. to issueanauditopiniononthe effectivenessofthe appropriate underthegivencircumstances, ratherthan goal istoplanandperformaudit procedureswhichare UIFQSFQBSBUJPOPGUIFlOBODJBMTUBUFNFOUT5IFSFMBUFE account theinternalcontrolsystemwhichisrelevantto ing theserisks,the[independent]auditorstakeinto nNJTTUBUFNFOUTJOUIFlOBODJBMTUBUFNFOUT*OBTTFTT- assessing therisksofmaterial–intendedorunintended discretion ofthe[independent]auditors.Thisincludes The selectionoftheauditproceduresisatdue ing therelatedexplanatorynotes. UIFWBMVFTSFDPHOJTFEJOUIFlOBODJBMTUBUFNFOUTJODMVE- audit proceduresinordertoobtainevidencefor 5IFBVEJUPGlOBODJBMTUBUFNFOUTJODMVEFTDPOEVDUJOH reasonable assurance. BMMZBGGFDUJOHUIFlOBODJBMTUBUFNFOUTBSFEFUFDUFEXJUI UIFlOBODJBMTUBUFNFOUTTVDIUIBUNJTTUBUFNFOUTNBUFSJ- professional dutiesandplanperformtheauditof (IDW). Thosestandardsrequirethatwecomplywiththe HBUFECZUIF*OTUJUVUFPG1VCMJD"VEJUPSTJO(FSNBOZ TUBOEBSETGPSUIFBVEJUPGlOBODJBMTUBUFNFOUTQSPNVM- ments inaccordancewithGermangenerallyaccepted 8FDPOEVDUFEPVSBVEJUPGUIFDPNCJOFElOBODJBMTUBUF- lOBODJBMTUBUFNFOUTCBTFEPOPVSBVEJU Our responsibilityistoexpressanopiniononthissetof Responsibility ofthe[independent]auditors be enabled. material –intendedorunintendedmisstatementsto QSFQBSBUJPOPGlOBODJBMTUBUFNFOUTXIJDIBSFGSFFGSPN the internalcontrolstheydeemtobenecessaryfor notes. Thelegalrepresentativesarealsoresponsiblefor the accountingprinciplespresentedinexplanatory PGUIFDPNCJOFElOBODJBMTUBUFNFOUTJOBDDPSEBODFXJUI Cologne/Germany, areresponsibleforthepreparation The legalrepresentativesofMalteserInternationale.V., Responsibility ofthelegalrepresentatives lOBODJBMZFBSGSPN+BOVBSZUP%FDFNCFS statement includingrelatedexplanatorynotes,forthe the combinedbalancesheetandincome statements ofMalteserInternational,comprising 8FIBWFBVEJUFEUIFBQQFOEFEDPNCJOFElOBODJBM To MalteserInternationale.V.,Cologne/Germany (FSNBO1VCMJD"VEJUPS(FSNBO1VCMJD"VEJUPS FYQMBOBUPSZOPUFTUPlOBODJBMTUBUFNFOUT dance withtheaccountingprinciplesdescribedin national has,inallrespects,beenpreparedaccor- from 1Januaryto31December2017ofMalteseInter- DPNCJOFElOBODJBMTUBUFNFOUTGPSUIFlOBODJBMZFBS *OPVSPQJOJPO CBTFEPOUIFlOEJOHTPGPVSBVEJU UIF Audit opinion )¿MM %FMPJUUF(NC)8JSUTDIBGUTQSÄGVOHTHFTFMMTDIBGU %ÄTTFMEPSG(FSNBOZ .BZ 13 November2017,ourliabilityislimitedtomEUR5. According totheengagementletterdated20October/ Note tolimitationofliability consent, bedisclosedto,orusedby,thirdparties. Malteser Internationale.V.andmustnot,withoutour Our attestationreporthassolelybeenpreparedfor other thanthepurposereferredtoabove. lOBODJBMTUBUFNFOUTNBZCFJOBQQSPQSJBUFGPSBQVSQPTF ing internalMaltesetransactions.Consequently,the international activitiesofMalteseasawhole,eliminat- cial statementswerepreparedinordertopresentthe EFTDSJCFUIFSFMFWBOUBDDPVOUJOHQSJODJQMFT5IFlOBO- UJPOUPUIFOPUFTUPUIFlOBODJBMTUBUFNFOUTXIJDI Without qualifyingourauditopinion,wedrawatten- disclosureanddisclaimer Accounting principlesaswellrestrictionof BTVGlDJFOUBOESFBTPOBCMFCBTJTGPSPVSBVEJUPQJOJPO We believethatourauditevidenceobtainedprovides UIFPWFSBMMQSFTFOUBUJPOPGUIFlOBODJBMTUBUFNFOUT mined bythelegalrepresentativesaswellevaluating the estimatedvaluesinbooksandrecordsdeter- the accountingmethodsapplied,reasonablenessof .ÄMMFS

as welltotheassociationsandorganizationsof donors, localandinternationalpartners,schoolclasses, deepest appreciationtoallinstitutionalandprivate our donorsandpartners.Wewouldliketoexpress Our workwouldbeimpossiblewithoutthesupportof OUR VALUEDSUPPORTERS partners thatgaveustheirvaluablesupport. Below isanoverviewofthehugevarietydonorsand in needbysupportingMalteserInternational2017! providing fast,effective,andsustainablereliefforpeople Order ofMaltawhomadeavaluablecontributionto 55 55 56 Malteser International Annual Report 2017 CategoryStructures OUR STRUCTURES UIFlOBODJBMQMBOBOEUIFBOOVBMCVEHFU for theoperationalmanagement activitiesinlinewith the organization’sGeneralSecretariat andisresponsible operative tasks.ThesalariedSecretary Generalmanages bears theoverallresponsibilityfor theorganization’s auditing oftheannualaccounts. TheBoardofDirectors BOOVBMCVEHFU BTXFMMBTDPNNJTTJPOJOHUIFlOBODJBM SFTQPOTJCMFGPSBQQSPWJOHUIFlOBODJBMQMBOTBOEUIF of Directorsworksonapurelyvoluntarybasis,andis "NFSJDBT BOEGSPNUIF"TJB1BDJlDSFHJPO5IF#PBSE tatives fromtheregionalbranchesinEuropeand two additionalelectedmembers,aswellrepresen- 1SFTJEFOU UIF7JDF1SFTJEFOU UIF5SFBTVSFS BOEVQUP which iselectedforafour-yearterm,consistsofthe General Assemblyonceayear.TheBoardofDirectors, BNFOENFOUTUPUIFCZMBXT5IF1SFTJEFOUDPOWPLFTUIF BOEPSEFSJOHlOBODJBMBVEJUT BTXFMMBTQBTTJOH the BoardofDirectors,acceptingannualaccounts, eral Assemblyisresponsibleforelectinganddischarging organization’s highestdecision-makingbody.TheGen- Vice SecretaryGeneralformtheAssembly: of Malta,theChaplain,SecretaryGeneral,and Board ofDirectors,theGrandHospitallerOrder ate members.Theirrepresentatives,togetherwiththe branches inEuropeandtheAmericasserveasassoci- within theirjurisdictions.Currently,bothregional Order ofMalta,whoactivelysupporttheorganization DPOTJTUTPG/BUJPOBM"TTPDJBUJPOTBOE1SJPSJFTPGUIF The currentmembershipofMalteserInternational Malteser International Board ofDirectors Executive Director Americas President

Sovereign OrderofMalta Malteser International General Secretariat Grand Hospitaller Board ofDirectors Secretary General President Malteser International Board ofDirectors Executive Director President Europe International Europe: President, Malteser Douglas vonSaurma- Secretary General Jeltsch (Germany) Asia/Paciﬁc region Michael KhooAhLip (United Kingdom) Richard vonSteeb Raphael Vermeir Vice President Ingo Radtke (Germany) (Singapore) Delegate, (Austria) Thierry deBeaumont-Beynac(France) Board ofDirectors Management President InternationalAmericas: Charles-Louis deLaguiche Vice SecretaryGeneral Bishop MarcStenger Sid JohannPeruvemba President, Malteser Mauro Bertero (Switzerland) Tom Wessels Chaplain Treasurer (Germany) (France) Gutiérrez (Bolivia) (USA) Publishing information Date ofpublication:July2018 Printed by:VDVereinteDruckwerkeGmbH Layout/Setting: www.mwk-koeln.de Icons: OCHA,SEGD Back coverphoto:Myanmar(EmilyKinskey) Cover photo:Nigeria(EmilyKinskey) With thanksto:RobertKinsella Elena Stein Anne Hensel,KatharinaKiecol,IsaureSchützeichel, Editorial team:SusannaCho,MichaelEtoh, Responsible forcontent:IngoRadtke Internet: www.malteser-international.org E-Mail: [email protected] Grüner Weg14·50825Cologne(Germany) Malteser International Published by: More thanninecenturiesofservicetothepoorandsick a workoftheSovereignOrderMalta Malteser International– own aidorganizations. works inmorethan120countries,includingtheOrder’s in avastnumberofmedical,social,andcharitable the poor,guardandwitnessfaith.Theyareengaged motto is“TuitioFideietObsequiumPauperum“–serve the serviceofChristiancharity.Their spread throughouttheglobe,boundto lay religiousorderhas13,500members institutions oftheWesternworld.The The OrderofMaltaisonetheoldest ID

2018-702505 (as ofJuly2018) Malteser InternationalMemberAssociationsandPriories www.malteser-international.org and campaigns: Malteser Internationalisamemberofthefollowingnetworks United Kingdom Germany France Cuba Colombia Canada Bohemia Belgium Austria Australia neutral, impartial,andapolitical. the Order,andofMalteserInternational.TheOrderis supporting theactivitiesofnationalassociations ld. TheEmbassiesoftheOrderalsohavemission provide aidduringcrisesanddisastersaroundthewor- network allowstheOrderanditsagenciestorapidly range ofEuropeanandinternationalorganizations.This the UnitedNations,andrepresentativemissionstoa relations with107states,aswellobserverstatusat The Order–whoseseatisinRomehasdiplomatic Portugal Poland Philippines Netherlands Mexico Malta Lebanon Italy Ireland Hungary Western Association Federal Association American Association USA: Switzerland Spain Singapore Scandinavia 57 Malteser International We thank all of the donors, supporters Donation Account: and partners who helped us to bring Account number: 2020270 health and dignity to people in need IBAN: DE74 3706 0193 0002 0202 70 all over the world in 2017. BIC: GENODED1PAX Pax Bank Cologne www.malteser-international.org