CHTF18 Monoclonal Antibody (M01), Clone 1F5

CHTF18 monoclonal antibody (M01), clone 1F5

Catalog # : H00063922-M01 規格 : [ 100 ug ] List All

Specification Application Image

Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Cell lysate) Description: CHTF18.

Immunogen: CHTF18 (AAH18184, 886 a.a. ~ 975 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: GVHRPAPRNHEQRLEHIMRRAAREEQPEKDFFGRVVVRSTAVPSAGDT APEQDSVERRMGTAVGRSEVWFRFNEGVSNAVRRSLYIRDLL enlarge Western Blot (Transfected Host: Mouse lysate)

Reactivity: Human

Isotype: IgG2a Kappa

Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge Western Blot (Recombinant protein)

Sandwich ELISA (Recombinant protein)

enlarge Western Blot detection against Immunogen (35.53 KDa) . ELISA Storage Buffer: In 1x PBS, pH 7.4

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction:

MSDS: Download

Datasheet: Download

Publication Reference 1. Two Different Replication Factor C Proteins, Ctf18 and RFC1, Separately Control PCNA-CRL4Cdt2-Mediated Cdt1 Proteolysis during S Phase and following UV Irradiation. Shiomi Y, Hayashi A, Ishii T, Shinmyozu K, Nakayama J, Sugasawa K, Nishitani H.Mol Cell Biol. 2012 Jun;32(12):2279-88. Epub 2012 Apr 9. 2. Stable interaction between the human PCNA loader complex Ctf18-RFC and DNA polymerase {epsilon} is mediated by the cohesion specific subunits, Ctf18, Dcc1 and Ctf8. Murakami T, Takano R, Takeo S, Taniguchi R, Ogawa K, Ohashi E, Tsurimoto T.J Biol Chem. 2010 Sep 7. [Epub ahead of print]

Page 1 of 3 2016/12/7 Applications Western Blot (Cell lysate)

CHTF18 monoclonal antibody (M01), clone 1F5 Western Blot analysis of CHTF18 expression in HeLa ( Cat # L013V1 ). Protocol Download

Western Blot (Transfected lysate)

Western Blot analysis of CHTF18 expression in transfected 293T cell line by CHTF18 monoclonal antibody (M01), clone 1F5.

Lane 1: CHTF18 transfected lysate(107 KDa). Lane 2: Non-transfected lysate. Protocol Download

Western Blot (Recombinant protein) Protocol Download

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged CHTF18 is approximately 0.1ng/ml as a capture antibody. Protocol Download

ELISA

Gene Information

Entrez GeneID: 63922

GeneBank BC018184 Accession#:

Page 2 of 3 2016/12/7 Protein AAH18184 Accession#:

Gene Name: CHTF18

Gene Alias: C16orf41,C321D2.2,C321D2.3,C321D2.4,CHL12,Ctf18,RUVBL

Gene CTF18, chromosome transmission fidelity factor 18 homolog (S. Description: cerevisiae)

Gene Ontology: Hyperlink

Other C321D2.3 (novel protein),C321D2.4 (novel protein),CTF18, Designations: chromosome transmission fidelity factor 18 homolog,homolog of yeast CHL12,some homology with holliday junction DNA helicase RUVB like

Page 3 of 3 2016/12/7