Evaluating the Explanatory Value of Brahimi and Ahmed’S Seven Deadly Sins of Mediation: the Case of the Malagasy Mediation of 2009-2014

Total Page:16

File Type:pdf, Size:1020Kb

Load more

EVALUATING THE EXPLANATORY VALUE OF BRAHIMI AND AHMED’S SEVEN DEADLY SINS OF MEDIATION: THE CASE OF THE MALAGASY MEDIATION OF 2009-2014 by Nthati Masupha Student number: 29400512 A dissertation submitted in partial fulfilment of the requirements for the degree MASTER OF SECURITY STUDIES Department of Political Sciences, Faculty of Humanities, University of Pretoria Supervisor : Prof. M Schoeman APRIL 2019 DECLARATION I declare that this dissertation, which I hereby submit for the degree Master of Security Studies at the University of Pretoria, is my own work and has not been previously submitted by me for a degree at this or any other university. …………………………… Nthati Masupha April 2019 i ACKNOWLEDGEMENTS The completion of this dissertation would not have been possible without the insightful guidance and patience of Prof. Maxi Schoeman, my supervisor. I gratefully acknowledge the support I received from Mastory, Mantsekhe and Kholu Masupha, together with Pati Mota, in believing that I would complete this piece of research. Thabo Khoboko, thank you for following up on my progress incessantly, and Mr Henwood, thank you for your support as well. Most importantly, I acknowledge that God’s grace has proved enough in the completion of this dissertation, and His power has been perfect through the challenges of this work. ii ABSTRACT The pursuit of international peace and security continues to lead international actors to pacify conflicts that could potentially evolve into or have already employed violence. In line with this pursuit, international mediation practitioners, Lakhdar Brahimi and Salman Ahmed, have observed seven variables, which they refer to as ‘The seven deadly sins of mediation’, that contribute to ineffective mediation and consequentially jeopardise the quality of the resultant peace. Testifying that mediation is a difficult undertaking, the 2009-2014 mediation process in Madagascar experienced multiple challenges and the resultant peace has been described as fragile. Brahimi and Ahmed’s work is applied in this study as an analytical framework to evaluate the mediation process in Madagascar during the period 2009-2014, and thus indicate the explanatory value of the framework itself. The research links challenges faced by the Malagasy mediation to six of the seven original sins in the framework, indicating that the framework has some explanatory value. The research further demonstrates that the identification of the sins in a mediation process forebodes a strong predisposition to ineffective mediation, yet each mediation case may present an additional sin or sins to append to Brahimi and Ahmed’s original list. Through scrutinizing the events of the Malagasy mediation, the study identifies an additional problem; the lack of a clear mandate, to have been catalytic to the mediation’s challenges and ineffectiveness, as well as the fragile resultant peace. Key terms: International mediation, conflict management, Madagascar iii TABLE OF CONTENTS ACKNOWLEDGEMENTS ............................................................................................................... ii ABSTRACT ..................................................................................................................................... iii LIST OF ABBREVIATIONS .......................................................................................................... vii LIST OF FIGURES ....................................................................................................................... viii CHAPTER 1: INTRODUCTION ................................................................................................... 1 1.1. Research Theme .................................................................................................................. 1 1.2. Literature Review ................................................................................................................ 2 1.2.1. Brahimi and Ahmed’s seven deadly sins of mediation ....................................................... 3 1.2.2. International mediation in Africa ........................................................................................ 3 1.2.3. The mediator’s agency ........................................................................................................ 4 1.2.4. Mediation dynamics ............................................................................................................ 5 1.2.5. Mediation strategies ............................................................................................................ 8 1.2.6. The Malagasy crisis and peace process ............................................................................... 9 1.3. Research question ............................................................................................................. 10 1.4. Research design and methodology .................................................................................... 11 1.4.1. Limitation of the study ...................................................................................................... 12 CHAPTER 2: CONCEPTUAL FRAMEWORK .......................................................................... 13 2.1. Gauges of effective mediation .......................................................................................... 15 2.2. Brahimi and Ahmed’s constraints to effective mediation ................................................. 16 2.2.1. Ignorance ........................................................................................................................... 17 2.2.2. Arrogance .......................................................................................................................... 17 2.2.3. Partiality ............................................................................................................................ 19 2.2.4. Impotence .......................................................................................................................... 20 2.2.5. Haste.................................................................................................................................. 21 2.2.6. Inflexibility........................................................................................................................ 24 Issue inflexibility............................................................................................................... 24 Procedural inflexibility ..................................................................................................... 24 2.2.7. False promises ................................................................................................................... 25 CHAPTER 3: THE MALAGASY CRISIS AND MEDIATION TIMELINE ............................. 28 2008 – 2009: Foundations of the conflict ................................................................................... 28 March 2009: Ravalomanana ousted ........................................................................................... 29 March 2009: De-facto reign of the HAT .................................................................................... 29 March 2009: International response ........................................................................................... 30 April 2009: The JMT-M ............................................................................................................. 31 July 2009: The ICG-M ............................................................................................................... 33 December 2009: Disengagement with the mediator .................................................................. 35 December 2010: Re-engagement with the mediator .................................................................. 36 September 2011: The SADC Roadmap ...................................................................................... 37 December 3013/January 2014: Crisis exit elections .................................................................. 38 CHAPTER 4: THE SEVEN DEADLY SINS IN MADAGASCAR ............................................ 40 4.1. Rajoelina’s intransigence .................................................................................................. 40 4.1.1. Impartiality ........................................................................................................................ 41 Content bias....................................................................................................................... 41 Source bias ........................................................................................................................ 42 4.1.2. Impotence .......................................................................................................................... 43 Material and financial resources ....................................................................................... 44 Diplomatic resources......................................................................................................... 45 Military resources ............................................................................................................. 46 4.1.3. Arrogance .......................................................................................................................... 47 4.1.4. Ignorance ........................................................................................................................... 49 4.2. Multiple unmet and unenforced
Recommended publications
  • Andry Rajoelina

    Andry Rajoelina

    Andry Rajoelina Andry Rajoelina ([ˈandʐʲ radzˈwelna]), né le 30 mai 1974 à Antsirabe, est un homme d'État malgache, Andry Rajoelina président de la République de Madagascar depuis le 18 janvier 2019. Chef d’entreprise, il est élu maire d'Antananarivo en 2007. Il mène le mouvement de contestation aboutissant à la crise politique de 2009 et au renversement du président Marc Ravalomanana. À la suite de ces événements, considérés comme une arrivée au pouvoir anti-constitutionnelle par plusieurs pays, il devient président de la Haute autorité de la transition et chef de l'État de facto. Il quitte le pouvoir en 2014, après avoir accepté de ne pas se présenter à l'élection présidentielle de 2013 dans le cadre d'un accord politique. Il se présente à l'élection présidentielle de 2018, qu’il remporte au second tour face à Marc Ravalomanana. Sommaire Andry Rajoelina en 2013. Biographie Fonctions Origines et vie familiale Président de la République de Carrière professionnelle (avant 2007) Madagascar Maire d'Antananarivo (2007-2009) En fonction depuis le 18 janvier 2019 Président de la Haute Autorité de transition (2 ans, 1 mois et 9 jours) (2009-2014) Élection 19 décembre 2018 Élection présidentielle de 2018 Premier ministre Christian Ntsay Président de la République (depuis 2019) Prédécesseur Rivo Rakotovao Publication (intérim) Prix et récompenses Hery Rajaonarimampianina Notes et références Président de la Haute Autorité de Voir aussi transition de Madagascar Articles connexes (chef de l'État) Liens externes 17 mars 2009 – 25 janvier 2014 (4 ans, 10 mois et 8 jours) Premier ministre Roindefo Monja Biographie Eugène Mangalaza Cécile Manorohanta (intérim) Origines et vie familiale Albert-Camille Vital Jean-Omer Beriziky Prédécesseur Hyppolite Ramaroson (intérim, de facto) Andry Nirina Rajoelina est né au sein de l'ethnie merina des Marc Ravalomanana Hauts-Plateaux de Madagascar.
  • Madagascar's 2009 Political Crisis

    Madagascar's 2009 Political Crisis

    Madagascar’s 2009 Political Crisis Lauren Ploch Analyst in African Affairs October 7, 2009 Congressional Research Service 7-5700 www.crs.gov R40448 CRS Report for Congress Prepared for Members and Committees of Congress Madagascar’s 2009 Political Crisis Summary Political tensions on the Indian Ocean island of Madagascar between President Marc Ravalomanana and Andry Rajoelina, the former mayor of the capital city, escalated in early 2009, culminating in the President’s forced removal from office. In preceding weeks, over 135 people had been killed in riots and demonstrations. Under intensifying pressure from mutinous soldiers and large crowds of protestors, Ravalomanana handed power to the military on March 17, 2009. The military then transferred authority to Rajoelina, who has declared a transitional government. Rajoelina’s “inauguration” as president of the transitional authority was followed by days of protests by thousands of supporters of Ravalomanana. Several subsequent demonstrations have led to violent clashes with security forces. Negotiations in August between the parties led to the signing of an agreement in Mozambique to establish an inclusive, transitional government, but Rajoelina subsequently appointed a new government seen to be primarily composed of his own supporters. Southern African leaders and Madagascar’s opposition parties rejected the proposed government, and negotiations in Mozambique resumed. On October 6, the parties announced that they had reached agreement on posts in the new government, which will be led by Andry Rajoelina until new elections are held. Ravalomanana reportedly agreed to the arrangement on the condition that Rajoelina would not vie for the presidency in those elections. The agreement must now be implemented, and some observers question whether members of Rajoelina’s former administration will adhere to the new arrangement.
  • JACARANDA Les Journalistes a Été Tiré À 150 Exemplaires

    JACARANDA Les Journalistes a Été Tiré À 150 Exemplaires

    Dossier : l’histoire de N°5- GRATUIT Fév./mars 2009 la société CODAL Rencontre Mathieu Auger, Changement de président journaliste à RSR, page 2. à Madagascar Monde Assassinat du président de la Guinée Bissau, page 3. Écologie La disparition des orangs-outangs, AFP page 6. Marc Ravalomanana a cédé aux pressions. Culture Après plusieurs semaines de crise politique, 8 oscars pour Slumdog, page 7. Andry Rajoelina est devenu le président de la Haute Autorité de la Transition. Sport L’arrivée du Ven- Disponible en couleurs à la BCD de l’école et sur le site de l’école dée Globe, page 7. http:/www.lft.mg/epf MATHIEU AUGER À J KELY Le 4 février Mathieu Auger est venu à notre émission pour témoigner des événements qui se sont déroulés le 26 janvier dernier à Tananarive. Imtiaz : Pour quelle radio travaillez-vous ? M.A. : Je travaille principalement pour RSR qui veut dire Radio Suisse Romande. Un magasin Magro incendié Imtiaz : Quel évènement vous a le plus frappé lors des au pied de la tour Zital. émeutes de la fin du mois de janvier à Tananarive. M.A. : C’est cette fameuse journée de lundi 26 janvier puisqu’on ne savait vraiment pas ce qui allait arriver. La manifestation s’est plutôt bien passée et un moment quand tout le monde est parti, nous reporters, on s’est demandé ce qui allait se passer. On sentait une certaine tension au niveau de la population donc on a choisi d’aller sur la terrasse du Carlton pour suivre les évène- ments. Nous avons alors vu l’incendie et le pillage de la radio nationale.
  • Global Journal of Human Social Science

    Global Journal of Human Social Science

    Online ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS The Politics of Labeling An Appraisal of Voters National Election of Ethiopia Implications on Nigeria Democracy VOLUME 17 ISSUE 1 VERSION 1.0 Global Journal of Human-Social Science: F Political Science Global Journal of Human-Social Science: F Political Science Volume 17 Issue 1 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Sponsors:Open Association of Research Society Social Sciences. 2017. Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO ® 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG 945th Concord Streets, XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO Framingham Massachusetts Pin: 01701, 6FLHQFHV´ 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO USA Toll Free: +001-888-839-7392 -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free Fax: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ G lobal Journals Incorporated SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG
  • Marc Ravalomanana Est Un « Auto-Putschiste » Selon Hyppolite Rarison Ramaroson

    Marc Ravalomanana Est Un « Auto-Putschiste » Selon Hyppolite Rarison Ramaroson

    Marc Ravalomanana est un « auto-putschiste » selon Hyppolite Rarison Ramaroson Extrait du Madagascar-Tribune.com http://www.madagascar-tribune.com/Marc-Ravalomanana-est-un-auto,13617.html Passation de fonctions aux Affaires Étrangères Marc Ravalomanana est un « auto-putschiste » selon Hyppolite Rarison Ramaroson - Politique - Date de mise en ligne : vendredi 26 février 2010 Madagascar-Tribune.com Copyright © Madagascar-Tribune.com Page 1/3 Marc Ravalomanana est un « auto-putschiste » selon Hyppolite Rarison Ramaroson Marc Ravalomanana s'est renversé lui-même de son trône. C'est ce qu'a voulu dire le Vice amiral chef d'escadre Hyppolite Rarison Ramaroson, le plus haut gradé au sein de l'armée malagasy et nouveau vice Premier Ministre chargé des Affaires Étrangères. Ce dernier a fait cette déclaration lors de la passation de service entre lui et le vice premier ministre sortant, Ny Hasina Andriamanjato. Une passation qui s'est déroulée dans la matinée de ce jeudi 25 février 2010, au siège du vice primature à Anosy. L'utilisation de certains mots en français au cours de cette cérémonie n'était certainement pas anodine et visait à faire passer un message à l'Union Africaine et au Groupe International de Contact. Ainsi, le VPM sortant, Ny Hasina Andriamanjato, a expliqué les motifs de sa démission et dit qu'il avait démissionné « pour aider le Président Rajoelina dans sa décision de mettre en place un gouvernement d'union nationale ». Les mots qu'Hyppolite Ramaroson a quant à lui utilisé sont « Marc Ravalomanana s'est auto-putsché ». Un journaliste étranger s'est interrogé sur la signification de ce néologisme que le nouveau responsable des affaires étrangères venait d'inventer.
  • Madagascar's 2009 Political Crisis

    Madagascar's 2009 Political Crisis

    Madagascar’s 2009 Political Crisis Lauren Ploch Analyst in African Affairs May 18, 2009 Congressional Research Service 7-5700 www.crs.gov R40448 CRS Report for Congress Prepared for Members and Committees of Congress Madagascar’s 2009 Political Crisis Summary Political tensions on the Indian Ocean island of Madagascar between President Marc Ravalomanana and Andry Rajoelina, the former mayor of the capital city, escalated in early 2009, culminating in the President’s forced removal from office. In preceding weeks, over 135 people had been killed in riots and demonstrations. Under intensifying pressure from mutinous soldiers and large crowds of protestors, Ravalomanana handed power to the military on March 17, 2009. The military then transferred authority to Rajoelina, who has declared a transitional government. Days prior to President Ravalomanana’s resignation, the U.S. Ambassador to Madagascar had expressed concern that the country could face civil war; some believe that may still be a possibility. Rajoelina’s “inauguration” as president of the transitional authority was followed by days of protests by thousands of supporters of Ravalomanana. Several more recent demonstrations have led to violent clashes with security forces. The political uncertainty has strained relations between international donors and Madagascar, which was the first country to sign a U.S. Millennium Challenge Account compact, worth an estimated $110 million. Following coups in Mauritania and Guinea in 2008, the African Union, the United States, and the European Union, among others, warned against an unconstitutional transfer of power on the island nation and have threatened sanctions and a suspension of foreign aid. The African Union and the Southern African Development Community have suspended Madagascar until constitutional order is restored.
  • Madagascar : Sortir Du Cycle De Crises

    Madagascar : Sortir Du Cycle De Crises

    MADAGASCAR : SORTIR DU CYCLE DE CRISES Rapport Afrique N°156 – 18 mars 2010 TABLE OF CONTENTS SYNTHESE ET RECOMMANDATIONS ............................................................................. i I. INTRODUCTION ............................................................................................................. 1 II. LA CRISE DE 2009 ........................................................................................................... 2 A. COMMENT MOBILISER LA FOULE : LES ELEMENTS DECLENCHEURS ............................................... 2 B. LES VIOLENCES DE JANVIER-MARS ............................................................................................... 4 1. Manifestations et répression ........................................................................................................ 4 2. Le rôle de l’armée ........................................................................................................................ 5 3. La passation de pouvoir ............................................................................................................... 6 C. ECHECS INITIAUX DE MEDIATION ................................................................................................. 7 1. Manque de consensus et de crédibilité de l’initiative des Eglises .............................................. 7 2. Manque de coordination de la communauté internationale ........................................................ 8 D. LA HAT : UN AN AU POUVOIR .....................................................................................................
  • Le Vice-Amiral Hyppolite Ramaroson Ministre Des Affaires Étrangères

    Le Vice-Amiral Hyppolite Ramaroson Ministre Des Affaires Étrangères

    Le vice-amiral Hyppolite Ramaroson ministre des Affaires Étrangères Extrait du Madagascar-Tribune.com http://www.madagascar-tribune.com/Le-vice-amiral-Hyppolite-Ramaroson,13613.html Le vice-amiral Hyppolite Ramaroson ministre des Affaires Étrangères - Politique - Date de mise en ligne : jeudi 25 février 2010 Madagascar-Tribune.com Copyright © Madagascar-Tribune.com Page 1/3 Le vice-amiral Hyppolite Ramaroson ministre des Affaires Étrangères Il est officiel maintenant que c'est le vice-amiral chef d'escadre, Hyppolite Rarison Ramaroson, qui succède à Ny Hasina Andriamanjato au poste de vice premier ministre chargé des affaires étrangères du gouvernement de la Haute Autorité de la Transition (HAT). La passation de service entre les deux hommes est prévue se tenir dans la matinée de ce jeudi 25 février 2010, à la Salle de Conférence de ce département ministériel à Anosy. Cette passation intervient à la suite de la nomination annoncée lors du conseil des ministres qui s'est tenu au palais d'Ambohitsorohitra ce mercredi 24 février 2010. Annonce qui officialise des rumeurs déjà véhiculées dans la presse ces deux derniers jours. Le vice amiral chef Hyppolite Ramaroson fait partie des généraux auxquels l'ancien président déchu Marc Ravalomanana avait transmis le pouvoir lors de sa démission le 17 mars 2009. Ces généraux avaient dans la même journée transmis le pouvoir à Andry Rajoelina, à l'issue de l'épisode mouvementé de l'épiscopat d'Antanimena et du camp du Capsat. Le nouveau vice premier ministre chargé des affaires étrangères est également un conseil du même président de la HAT Andry Rajoelina.
  • Peace and Conflict Impact Assessment (PCIA) Madagascar

    Peace and Conflict Impact Assessment (PCIA) Madagascar

    Peace and Conflict Impact Assessment (PCIA) Madagascar Oliver Jütersonke and Moncef Kartas with Isabelle Dauner, Julie Mandoyan and Christoph Spurk Peace and Conflict Impact Assessment (PCIA), Madagascar Published by the Centre on Conflict, Development and Peacebuilding (CCDP) Graduate Institute of International and Development Studies Rue de Lausanne 132, P.O. Box 136 1211 Geneva 21, Switzerland E-mail: [email protected] Website: http://www.graduateinstitute.ch/ccdp Acknowledgements: The authors would like to thank all their colleagues who have collaborated on this project or provided valuable feedback and support – notably Victorine Andrianaivo, Lyna Comaty, Klaus Heimer, Keith Krause, Robert Muggah, Thania Paffenholz, Jeannot Ramiaramanana, Jean Claude Ramandimbiarison, François Randrianarivo, Lovamalala Randriatavy, Michel Razafiarivony, Marie Jeanne Razanamanana, Sandra Reimann, Dennis Rodgers and Achim Wennmann. Gratitude also goes to the Délégation InterCooperation (DIC) in Antananarivo for their logistical assistance, as well as to Dorothée Klaus (UNICEF), Bruno Maes (UNICEF), Christophe Legrand (UNDP) and the Embassies of France and Norway for making this assessment possible. Finally, our thanks go out to all the stakeholders who had the patience to meet and engage in fruitful discussion. Disclaimer: The statements in this publication are the views of the authors and do not necessarily reflect the policies or the views of UNICEF. Design: Latitudesign Copyright: © 2010, Centre on Conflict, Development and Peacebuilding (CCDP) at the Graduate Institute of International and Development Studies, Geneva. Peace and Conflict Impact Assessment (PCIA) Madagascar Mandated by UNICEF for the United Nations Office of the Resident Coordinator in Madagascar with the support of the Embassies of Norway and France 2 Table of Contents Executive Summary ..................................................................................
  • African Postal Heritage; African Studies Centre Leiden; APH Paper 40; Ton Dietz Madagascar After 1958; Version January 2019

    African Postal Heritage; African Studies Centre Leiden; APH Paper 40; Ton Dietz Madagascar After 1958; Version January 2019

    African Postal Heritage; African Studies Centre Leiden; APH Paper 40; Ton Dietz Madagascar after 1958; Version January 2019 African Studies Centre Leiden African Postal Heritage APH Paper Nr 40 Ton Dietz Madagascar after 1958 January 2019 Introduction Postage stamps and related objects are miniature communication tools, and they tell a story about cultural and political identities and about artistic forms of identity expressions. They are part of the world’s material heritage, and part of history. Ever more of this postal heritage becomes available online, published by stamp collectors’ organizations, auction houses, commercial stamp shops, online catalogues, and individual collectors. Virtually collecting postage stamps and postal history has recently become a possibility. These working papers about Africa are examples of what can be done. But they are work-in-progress! Everyone who would like to contribute, by sending corrections, additions, and new area studies can do so by sending an email message to the APH editor: Ton Dietz ([email protected]). You are welcome! Disclaimer: illustrations and some texts are copied from internet sources that are publicly available. All sources have been mentioned. If there are claims about the copy rights of these sources, please send an email to [email protected], and, if requested, those illustrations will be removed from the next version of the working paper concerned. 1 African Postal Heritage; African Studies Centre Leiden; APH Paper 40; Ton Dietz Madagascar after 1958; Version January
  • 12 Chroniques Mars

    12 Chroniques Mars

    .. .. P'A G E 5 L'EXPRESS DE MADAGASCAR DU· LUNDI 16 MARS 2009 MAHAZOARIVO Monja Roindefo prends ses quartiers . L'équipe d’Andry Rajoelina a déposé samedi à la HCC une résolution sur la sortie de crise. Elle rendra sa décision dans les prochains jours. E sort de Mâda- gascar est entre les mains de la Haute cour cons- L titutionnelle, (HCC). Pour certifier l'authenti- cité de son acte, " la Haute autorité de transition (HAT)" présidée par Andry Nirina Rajoelina, a de posé samedi, au greffe de la HCC à Ambohidahy une résolution sur la sortie de crise. Monja Roindefo Zafitsimivalo, "Premier minis- tre du gouvernement de la transition" en remettant la résolution à la presse, au palais de Mahazoarivo a déclaré que le président de ~ la République n'est plus en ~ mesure d'exercer les attri- ~ butions qui lui sont dévo- ~ lues par la Constitution. S Monja Roindefo s'est it reféré aux dispositions de Monja Roindefo installé dans le fauteuil dù Premier ministre samedi à Mahazoarivo. l'article 44 de la Constitution qui énoncent les attributions réclame en revanche la du président de la Répu- déchéance du président de se passe actuellement, c'est la repression pour survivre. blique en l'occurence : la République, de le peuple souverain qui rep- Une autoproclamation ne veiller au respect de la l'Assemblée Nationale, du rend son pouvoir. Donc ça donne pas de pouvoir constitution, garantir Sénat, du gouvernement n'a rien à voir avec un coup légal... l'indivisibilité de la tout en gardant la HCC en d'État.
  • RP Mada MARS 2010 BIS.Doc Page 1 Sur 49 31/03/2010

    RP Mada MARS 2010 BIS.Doc Page 1 Sur 49 31/03/2010

    MADAGASCAR Revue de Presse mars 2010 SOMMAIRE Page La crise politique .............................................................................................................................. 01 04/03 : ouverture de l’Atelier « Teny ifampierana » de la HAT, ultimatum de la FIGN de Fort Duchesne ...................................... 06 06/03 : la HAT dispose d’une feuille de route avalisée par les participants à l’Atelier ..................................................................... 09 08/03 : la réunion d’urgente de l’UA à Addis-Abeba annulée.............................................................................................................. 11 11/03 : le conflit de la gendarmerie désamorcé. Consultations pour la constitution d’un gouvernement « d’ouverture » ............ 14 18/03 : l’UA met en application ses menaces de sanctions.................................................................................................................... 20 20/03 : La HAT réplique aux sanctions internationales – mesures de représailles ............................................................................ 25 24/03 : nouvelle condamnation pour Marc Ravalomanana .................................................................................................................. 30 25/03 : nomination de 16 des 19 membres de la CENI .......................................................................................................................... 32 30/03 : tensions et controverses pour la commémoration de l’insurrection