DOCSLIB.ORG

MRTFB Suppresses Colorectal Cancer Development Through Regulating SPDL1 and MCAM

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
MRTFB Suppresses Colorectal Cancer Development Through Regulating SPDL1 and MCAM MRTFB suppresses colorectal cancer development through regulating SPDL1 and MCAM Takahiro Kodamaa,b,c, Teresa A. Mariana,b, Hubert Leea, Michiko Kodamaa, Jian Lid, Michael S. Parmacekd, Nancy A. Jenkinsa,e, Neal G. Copelanda,e,1, and Zhubo Weia,b,1 aHouston Methodist Research Institute, Houston Methodist Hospital, Houston, TX 77030; bHouston Methodist Cancer Center, Houston Methodist Hospital, Houston, TX 77030; cDepartment of Gastroenterology and Hepatology, Graduate School of Medicine, Osaka University, 5650871 Suita, Osaka, Japan; dDepartment of Medicine, University of Pennsylvania Perelman School of Medicine, Philadelphia, PA 19104; and eGenetics Department, The University of Texas MD Anderson Cancer Center, Houston, TX 77030 Contributed by Neal G. Copeland, October 7, 2019 (sent for review June 18, 2019; reviewed by Masaki Mori and Hiroshi Seno) Myocardin-related transcription factor B (MRTFB) is a candidate tumor- shown to regulate cell cycle progression (9) and HCC xenograft suppressor gene identified in transposon mutagenesis screens of the tumor growth (10). Functional validation using cell culture sys- intestine, liver, and pancreas. Using a combination of cell-based assays, tems have also shown that reduced expression of MRTFB by in vivo tumor xenograft assays, and Mrtfb knockout mice, we demon- RNA interference leads to increased CRC cell invasion (4), strate here that MRTFB is a human and mouse colorectal cancer suggesting its important role in tumor progression. (CRC) tumor suppressor that functions in part by inhibiting cell Based on these results, we decided to conditionally delete invasion and migration. To identify possible MRTFB transcriptional Mrtfb in the mouse intestine to further explore its role in CRC. targets, we performed whole transcriptome RNA sequencing in We found that tumor growth was significantly accelerated in the MRTFB siRNA knockdown primary human colon cells and identi- mouse intestine on Mrtfb knockout, which is critical for func- fied 15 differentially expressed genes. Among the top candidate tional validation. We also showed that knockdown of MRTFB tumor-suppressor targets were melanoma cell adhesion molecule expression in human CRC cells resulted in accelerated xenograft (MCAM), a known tumor suppressor, and spindle apparatus coiled-coil tumor growth as well as increased invasion and migration of protein 1 (SPDL1), which has no confirmed role in cancer. To determine human CRC cells. We then performed whole transcriptome GENETICS whether these genes play a role in CRC, we knocked down the expres- RNA sequencing using primary human colon cells with reduced sion of MCAM and SPDL1 in human CRC cells and showed significantly MRTFB expression to identify MRTFB downstream genes, increased invasion and migration of tumor cells. We also showed that which led to the identification of a number of genes, including a Spdl1 expression is significantly down-regulated in Mrtfb knockout known tumor suppressor, MCAM (melanoma adhesion mole- mouse intestine, while lower SPDL1 expression levels are significantly cule), and a candidate CRC tumor suppressor, SPDL1 (spindle associated with reduced survival in CRC patients. Finally, we show that apparatus coiled-coil protein 1). Subsequent follow-up studies depletion of MCAM and SPDL1 in human CRC cells significantly in- showed that SPDL1 has tumor-suppressor activities in both cell- creases tumor development in xenograft assays, further confirming based and xenograft assays using human CRC cells, and that their tumor-suppressive roles in CRC. Collectively, our findings demon- reduced SPDL1 expression levels are significantly associated strate the tumor-suppressive role of MRTFB in CRC and identify several with shorter overall survival in human CRC patients. Collec- genes, including 2 tumor suppressors, that act downstream of MRTFB to tively, our studies have identified the human CRC tumor sup- regulate tumor growth and survival in CRC patients. pressor MRTFB, as well as several MRTFB downstream genes, including MCAM and SPDL1. MRTFB | colorectal cancer | tumor suppressor | RNA-seq | SPDL1 Significance olorectal cancer (CRC) is the second-leading cause of Ccancer-related deaths worldwide, with 860,000 deaths and Myocardin-related transcription factor B (MRTFB) is a candidate 1.8 million newly diagnosed cases each year (1). CRC imposes a tumor-suppressor gene identified in transposon mutagenesis large burden on the health care system, with approximately $14 screens of the intestine, liver, and pancreas. Using a combina- billion spent annually to treat CRC in the US alone (2). Therefore, tion of cell-based assays, in vivo tumor xenograft assays, and numerous studies have attempted to understand the etiology of Mrtfb knockout mice, we demonstrate that MRTFB is a mouse CRC and apply the research findings to patient care and treatments. and human colorectal cancer (CRC) tumor-suppressor gene that In the last several years, cancer genomics has become a functions in part by inhibiting cell invasion and migration. Us- promising tool for furthering our understanding of CRC. Rep- ing whole transcriptome RNA sequencing in Mrtfb-knockdown resentative studies include The Cancer Genome Atlas molecular cells, we also identify several MRTFB downstream genes, in- characterization of hundreds of CRCs to identify significantly cluding a known tumor suppressor, MCAM, and a candidate mutated genes (3) and Sleeping Beauty (SB) transposon muta- tumor suppressor, SPDL1. Finally, we show that MCAM and genesis screens designed to uncover new CRC candidate driver SPDL1 are also human CRC tumor-suppressor genes that act genes in mouse models of CRC (4). A large number of candidate downstream of MRTFB to regulate CRC growth and survival. cancer driver genes have been identified by these studies, many Author contributions: Z.W. designed research; T.K., T.A.M., H.L., M.K., and Z.W. per- of which have unknown roles in CRC, such as myocardin- related formed research; J.L. and M.S.P. contributed new reagents/analytic tools; N.A.J., N.G.C., transcription factor B (MRTFB). Mrtfb also has been identified and Z.W. analyzed data; and N.G.C. and Z.W. wrote the paper. as a candidate cancer driver gene in other transposon mutagenesis Reviewers: M.M., Kyushu University; and H.S., Kyoto University. screens in the gastrointestinal (GI) tract, including hepatocellular The authors declare no competing interests. carcinoma (HCC) (5) and pancreatic ductal adenocarcinoma Published under the PNAS license. (PDAC) (6). These studies suggest a potentially important role for 1To whom correspondence may be addressed. Email: [email protected] or Mrtfb in GI tract cancers. [email protected]. Mrtfb is an essential gene, as its whole-body knockout in mice This article contains supporting information online at www.pnas.org/lookup/suppl/doi:10. leads to embryonic lethality at around embryonic day (E) 13.5, 1073/pnas.1910413116/-/DCSupplemental. due mainly to cardiovascular defects (7, 8). Mrtfb has also been www.pnas.org/cgi/doi/10.1073/pnas.1910413116 PNAS Latest Articles | 1of11 Downloaded by guest on September 25, 2021 Results Knockout of Mrtfb in Mouse Intestine Significantly Enhances Tumor Mrtfb Is a Candidate Driver Gene for GI Tract Cancers. SB transposon Development in Apc Mutant Mice. Since tumor development in mutagenesis screens performed in the intestines of mice carrying knockout mice is critical for functional validation of a tumor- suppressor gene, we decided to knock out Mrtfb in the mouse sensitizing mutations in genes that act at different stages of CRC + + + Flox Cre/ development, including APC (Apcmin/ ), KRAS (KrasG12D/ ), intestine using a conditional Mrtfb allele (8). Lrig1 was KO/+ R172H/+ used as the Cre driver to specifically induce deletion of both SMAD4 (Smad4 ), and TP53 (p53 ), identified 11 + copies of Mrtfb in the intestine, while ApcFlox/ wasusedtosensi- candidate tumor-suppressor genes that were mutated in all 4 + tize these mice to intestinal tumor development (21). Lrig1Cre/ ; cohorts (4), suggesting their critical roles in CRC. Seven of these + + + + + ApcFlox/ ;MrtfbFlox/Flox and Lrig1Cre/ ;ApcFlox/ ;Mrtfb / mice are established cancer driver genes, including Abl1 (11), were generated and treated with tamoxifen by intraperitoneal Ankrd11 (12), Arid1a (13), Ctnna1 (14), Gnb1 (15), Pik3r1 (16), injection (IP) at 2 mg/d for 3 consecutive days, beginning at age and Zfp148 (17). Mrtfb was 1 of the 4 candidate tumor- 6 to 8 wk, to activate Cre expression. Knockout of Mrtfb ex- + + suppressor genes identified, along with Dennd4c, Luc7l2, and pression in Lrig1Cre/ ;ApcFlox/ ;MrtfbFlox/Flox intestine was sub- Ppm1b, that have no clarified role in CRC or other types of sequently confirmed by quantitative reverse transcription cancer. However, a potentially important role for Mrtfb in GI polymerase chain reaction (RT-qPCR) (Fig. 3A), and the mice tract cancer has been further suggested by other SB transposon were monitored for tumor development at 4, 5, and 6 mo after mutagenesis screens, which identified Mrtfb as a candidate tamoxifen injection. As shown in Fig. 3B, control animals de- tumor-suppressor gene in HCC (5) and PDAC (6). Therefore, veloped an average of 2.4 tumors at the 4-mo time point, while we focused on Mrtfb in the present study. Mrtfb knockout mice developed 7.8 tumors, a 3-fold increase. At The insertion pattern of SB transposons in a given gene is the 5-mo time point, we observed an average of ∼13 tumors in indicative of whether it is functioning as an oncogene or a tumor- each Mrtfb knockout mouse, compared with only ∼4 tumors in suppressor gene (18–20). As shown in Fig. 1A, transposon in- control animals (Fig. 3 C and D). A similar acceleration of tumor sertions in Mrtfb in mouse intestinal tumors are distributed al- development was observed at the 6-mo time point (Fig. 3E), fur- most evenly across the gene and in both orientations, which is ther confirming Mrtfb’s role as a CRC tumor suppressor. indicative of a tumor-suppressor gene. Consistent with this, We also collected tumor samples from control and Mrtfb lower MRTFB expression levels are associated with shorter knockout mice.
Load more

Recommended publications
  • Analysis of Trans Esnps Infers Regulatory Network Architecture
    Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer Submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate School of Arts and Sciences COLUMBIA UNIVERSITY 2014 © 2014 Anat Kreimer All rights reserved ABSTRACT Analysis of trans eSNPs infers regulatory network architecture Anat Kreimer eSNPs are genetic variants associated with transcript expression levels. The characteristics of such variants highlight their importance and present a unique opportunity for studying gene regulation. eSNPs affect most genes and their cell type specificity can shed light on different processes that are activated in each cell. They can identify functional variants by connecting SNPs that are implicated in disease to a molecular mechanism. Examining eSNPs that are associated with distal genes can provide insights regarding the inference of regulatory networks but also presents challenges due to the high statistical burden of multiple testing. Such association studies allow: simultaneous investigation of many gene expression phenotypes without assuming any prior knowledge and identification of unknown regulators of gene expression while uncovering directionality. This thesis will focus on such distal eSNPs to map regulatory interactions between different loci and expose the architecture of the regulatory network defined by such interactions. We develop novel computational approaches and apply them to genetics-genomics data in human. We go beyond pairwise interactions to define network motifs, including regulatory modules and bi-fan structures, showing them to be prevalent in real data and exposing distinct attributes of such arrangements. We project eSNP associations onto a protein-protein interaction network to expose topological properties of eSNPs and their targets and highlight different modes of distal regulation.
    [Show full text]
  • List of Genes Associated with Sudden Cardiac Death (Scdgseta) Gene
    List of genes associated with sudden cardiac death (SCDgseta) mRNA expression in normal human heart Entrez_I Gene symbol Gene name Uniprot ID Uniprot name fromb D GTEx BioGPS SAGE c d e ATP-binding cassette subfamily B ABCB1 P08183 MDR1_HUMAN 5243 √ √ member 1 ATP-binding cassette subfamily C ABCC9 O60706 ABCC9_HUMAN 10060 √ √ member 9 ACE Angiotensin I–converting enzyme P12821 ACE_HUMAN 1636 √ √ ACE2 Angiotensin I–converting enzyme 2 Q9BYF1 ACE2_HUMAN 59272 √ √ Acetylcholinesterase (Cartwright ACHE P22303 ACES_HUMAN 43 √ √ blood group) ACTC1 Actin, alpha, cardiac muscle 1 P68032 ACTC_HUMAN 70 √ √ ACTN2 Actinin alpha 2 P35609 ACTN2_HUMAN 88 √ √ √ ACTN4 Actinin alpha 4 O43707 ACTN4_HUMAN 81 √ √ √ ADRA2B Adrenoceptor alpha 2B P18089 ADA2B_HUMAN 151 √ √ AGT Angiotensinogen P01019 ANGT_HUMAN 183 √ √ √ AGTR1 Angiotensin II receptor type 1 P30556 AGTR1_HUMAN 185 √ √ AGTR2 Angiotensin II receptor type 2 P50052 AGTR2_HUMAN 186 √ √ AKAP9 A-kinase anchoring protein 9 Q99996 AKAP9_HUMAN 10142 √ √ √ ANK2/ANKB/ANKYRI Ankyrin 2 Q01484 ANK2_HUMAN 287 √ √ √ N B ANKRD1 Ankyrin repeat domain 1 Q15327 ANKR1_HUMAN 27063 √ √ √ ANKRD9 Ankyrin repeat domain 9 Q96BM1 ANKR9_HUMAN 122416 √ √ ARHGAP24 Rho GTPase–activating protein 24 Q8N264 RHG24_HUMAN 83478 √ √ ATPase Na+/K+–transporting ATP1B1 P05026 AT1B1_HUMAN 481 √ √ √ subunit beta 1 ATPase sarcoplasmic/endoplasmic ATP2A2 P16615 AT2A2_HUMAN 488 √ √ √ reticulum Ca2+ transporting 2 AZIN1 Antizyme inhibitor 1 O14977 AZIN1_HUMAN 51582 √ √ √ UDP-GlcNAc: betaGal B3GNT7 beta-1,3-N-acetylglucosaminyltransfe Q8NFL0
    [Show full text]
  • LRIG1 Gene Copy Number Analysis by Ddpcr and Correlations to Clinical
    Faraz et al. BMC Cancer (2020) 20:459 https://doi.org/10.1186/s12885-020-06919-w RESEARCH ARTICLE Open Access LRIG1 gene copy number analysis by ddPCR and correlations to clinical factors in breast cancer Mahmood Faraz1, Andreas Tellström1, Christina Edwinsdotter Ardnor1, Kjell Grankvist2, Lukasz Huminiecki3,4, Björn Tavelin1, Roger Henriksson1, Håkan Hedman1 and Ingrid Ljuslinder1* Abstract Background: Leucine-rich repeats and immunoglobulin-like domains 1 (LRIG1) copy number alterations and unbalanced gene recombination events have been reported to occur in breast cancer. Importantly, LRIG1 loss was recently shown to predict early and late relapse in stage I-II breast cancer. Methods: We developed droplet digital PCR (ddPCR) assays for the determination of relative LRIG1 copy numbers and used these assays to analyze LRIG1 in twelve healthy individuals, 34 breast tumor samples previously analyzed by fluorescence in situ hybridization (FISH), and 423 breast tumor cytosols. Results: Four of the LRIG1/reference gene assays were found to be precise and robust, showing copy number ratios close to 1 (mean, 0.984; standard deviation, +/− 0.031) among the healthy control population. The correlation between the ddPCR assays and previous FISH results was low, possibly because of the different normalization strategies used. One in 34 breast tumors (2.9%) showed an unbalanced LRIG1 recombination event. LRIG1 copy number ratios were associated with the breast cancer subtype, steroid receptor status, ERBB2 status, tumor grade, and nodal status. Both LRIG1 loss and gain were associated with unfavorable metastasis-free survival; however, they did not remain significant prognostic factors after adjustment for common risk factors in the Cox regression analysis.
    [Show full text]
  • LRIG1 Inhibits STAT3-Dependent Inflammation to Maintain Corneal Homeostasis
    LRIG1 inhibits STAT3-dependent inflammation to maintain corneal homeostasis Takahiro Nakamura, … , Yann Barrandon, Shigeru Kinoshita J Clin Invest. 2014;124(1):385-397. https://doi.org/10.1172/JCI71488. Research Article Stem cells Corneal integrity and transparency are indispensable for good vision. Cornea homeostasis is entirely dependent upon corneal stem cells, which are required for complex wound-healing processes that restore corneal integrity following epithelial damage. Here, we found that leucine-rich repeats and immunoglobulin-like domains 1 (LRIG1) is highly expressed in the human holoclone-type corneal epithelial stem cell population and sporadically expressed in the basal cells of ocular-surface epithelium. In murine models, LRIG1 regulated corneal epithelial cell fate during wound repair. Deletion of Lrig1 resulted in impaired stem cell recruitment following injury and promoted a cell-fate switch from transparent epithelium to keratinized skin-like epidermis, which led to corneal blindness. In addition, we determined that LRIG1 is a negative regulator of the STAT3-dependent inflammatory pathway. Inhibition of STAT3 in corneas of Lrig1–/– mice rescued pathological phenotypes and prevented corneal opacity. Additionally, transgenic mice that expressed a constitutively active form of STAT3 in the corneal epithelium had abnormal features, including corneal plaques and neovascularization similar to that found in Lrig1–/– mice. Bone marrow chimera experiments indicated that LRIG1 also coordinates the function of bone marrow–derived inflammatory cells. Together, our data indicate that LRIG1 orchestrates corneal-tissue transparency and cell fate during repair, and identify LRIG1 as a key regulator of tissue homeostasis. Find the latest version: https://jci.me/71488/pdf Research article LRIG1 inhibits STAT3-dependent inflammation to maintain corneal homeostasis Takahiro Nakamura,1,2 Junji Hamuro,1 Mikiro Takaishi,3 Szandor Simmons,4 Kazuichi Maruyama,1 Andrea Zaffalon,5 Adam J.
    [Show full text]
  • Anti-LRIG1 Antibody (ARG43047)
    Product datasheet [email protected] ARG43047 Package: 50 μg anti-LRIG1 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes LRIG1 Tested Reactivity Hu Tested Application IHC-P, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name LRIG1 Antigen Species Human Immunogen Synthetic peptide corresponding to a sequence of Human LRIG1. (AKRAFSGLESLEHLNLGENAIRSVQFDAFAKMKNLKELYI) Conjugation Un-conjugated Alternate Names LIG-1; LIG1; Leucine-rich repeats and immunoglobulin-like domains protein 1 Application Instructions Application table Application Dilution IHC-P 1:200 - 1:1000 WB 1:500 - 1:2000 Application Note IHC-P: Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Calculated Mw 119 kDa Properties Form Liquid Purification Affinity purification with immunogen. Buffer 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. Preservative 0.05% Sodium azide Stabilizer 4% Trehalose Concentration 0.5 - 1 mg/ml Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. www.arigobio.com 1/2 Note For laboratory research only, not for drug, diagnostic or other use. Bioinformation Gene Symbol LRIG1 Gene Full Name leucine-rich repeats and immunoglobulin-like domains 1 Function Acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation.
    [Show full text]
  • Molecular Effects of Isoflavone Supplementation Human Intervention Studies and Quantitative Models for Risk Assessment
    Molecular effects of isoflavone supplementation Human intervention studies and quantitative models for risk assessment Vera van der Velpen Thesis committee Promotors Prof. Dr Pieter van ‘t Veer Professor of Nutritional Epidemiology Wageningen University Prof. Dr Evert G. Schouten Emeritus Professor of Epidemiology and Prevention Wageningen University Co-promotors Dr Anouk Geelen Assistant professor, Division of Human Nutrition Wageningen University Dr Lydia A. Afman Assistant professor, Division of Human Nutrition Wageningen University Other members Prof. Dr Jaap Keijer, Wageningen University Dr Hubert P.J.M. Noteborn, Netherlands Food en Consumer Product Safety Authority Prof. Dr Yvonne T. van der Schouw, UMC Utrecht Dr Wendy L. Hall, King’s College London This research was conducted under the auspices of the Graduate School VLAG (Advanced studies in Food Technology, Agrobiotechnology, Nutrition and Health Sciences). Molecular effects of isoflavone supplementation Human intervention studies and quantitative models for risk assessment Vera van der Velpen Thesis submitted in fulfilment of the requirements for the degree of doctor at Wageningen University by the authority of the Rector Magnificus Prof. Dr M.J. Kropff, in the presence of the Thesis Committee appointed by the Academic Board to be defended in public on Friday 20 June 2014 at 13.30 p.m. in the Aula. Vera van der Velpen Molecular effects of isoflavone supplementation: Human intervention studies and quantitative models for risk assessment 154 pages PhD thesis, Wageningen University, Wageningen, NL (2014) With references, with summaries in Dutch and English ISBN: 978-94-6173-952-0 ABSTRact Background: Risk assessment can potentially be improved by closely linked experiments in the disciplines of epidemiology and toxicology.
    [Show full text]
  • Aneuploidy: Using Genetic Instability to Preserve a Haploid Genome?
    Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Science (Cancer Biology) Aneuploidy: Using genetic instability to preserve a haploid genome? Submitted by: Ramona Ramdath In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Science Examination Committee Signature/Date Major Advisor: David Allison, M.D., Ph.D. Academic James Trempe, Ph.D. Advisory Committee: David Giovanucci, Ph.D. Randall Ruch, Ph.D. Ronald Mellgren, Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: April 10, 2009 Aneuploidy: Using genetic instability to preserve a haploid genome? Ramona Ramdath University of Toledo, Health Science Campus 2009 Dedication I dedicate this dissertation to my grandfather who died of lung cancer two years ago, but who always instilled in us the value and importance of education. And to my mom and sister, both of whom have been pillars of support and stimulating conversations. To my sister, Rehanna, especially- I hope this inspires you to achieve all that you want to in life, academically and otherwise. ii Acknowledgements As we go through these academic journeys, there are so many along the way that make an impact not only on our work, but on our lives as well, and I would like to say a heartfelt thank you to all of those people: My Committee members- Dr. James Trempe, Dr. David Giovanucchi, Dr. Ronald Mellgren and Dr. Randall Ruch for their guidance, suggestions, support and confidence in me. My major advisor- Dr. David Allison, for his constructive criticism and positive reinforcement.
    [Show full text]
  • (Kiss-1): Essential Players in Suppressing Tumor Metastasis
    DOI:http://dx.doi.org/10.7314/APJCP.2013.14.11.6215 Kisspeptins (KiSS-1) as Supressors of Cancer Metastasis MINI-REVIEW Kisspeptins (KiSS-1): Essential Players in Suppressing Tumor Metastasis Venugopal Vinod Prabhu, Kunnathur Murugesan Sakthivel, Chandrasekharan Guruvayoorappan* Abstract Kisspeptins (KPs) encoded by the KiSS-1 gene are C-terminally amidated peptide products, including KP- 10, KP-13, KP-14 and KP-54, which are endogenous agonists for the G-protein coupled receptor-54 (GPR54). Functional analyses have demonstrated fundamental roles of KiSS-1 in whole body homeostasis including sexual differentiation of brain, action on sex steroids and metabolic regulation of fertility essential for human puberty and maintenance of adult reproduction. In addition, intensive recent investigations have provided substantial evidence suggesting roles of Kisspeptin signalling via its receptor GPR54 in the suppression of metastasis with a variety of cancers. The present review highlights the latest studies regarding the role of Kisspeptins and the KiSS-1 gene in tumor progression and also suggests targeting the KiSS-1/GPR54 system may represent a novel therapeutic approach for cancers. Further investigations are essential to elucidate the complex pathways regulated by the Kisspeptins and how these pathways might be involved in the suppression of metastasis across a range of cancers. Keywords: Kisspeptins - GPR54 receptor - KiSS-1 gene - metastasis - cancer Asian Pac J Cancer Prev, 14 (11), 6215-6220 Introduction deaths (Stafford et al., 2008). There are around 20 different metastasis suppressor genes which brings a valuable Cancer is a class of disease characterized by out-of- mechanistic insight for guiding specific therapeutic control cell growth.
    [Show full text]
  • Analysis of the Indacaterol-Regulated Transcriptome in Human Airway
    Supplemental material to this article can be found at: http://jpet.aspetjournals.org/content/suppl/2018/04/13/jpet.118.249292.DC1 1521-0103/366/1/220–236$35.00 https://doi.org/10.1124/jpet.118.249292 THE JOURNAL OF PHARMACOLOGY AND EXPERIMENTAL THERAPEUTICS J Pharmacol Exp Ther 366:220–236, July 2018 Copyright ª 2018 by The American Society for Pharmacology and Experimental Therapeutics Analysis of the Indacaterol-Regulated Transcriptome in Human Airway Epithelial Cells Implicates Gene Expression Changes in the s Adverse and Therapeutic Effects of b2-Adrenoceptor Agonists Dong Yan, Omar Hamed, Taruna Joshi,1 Mahmoud M. Mostafa, Kyla C. Jamieson, Radhika Joshi, Robert Newton, and Mark A. Giembycz Departments of Physiology and Pharmacology (D.Y., O.H., T.J., K.C.J., R.J., M.A.G.) and Cell Biology and Anatomy (M.M.M., R.N.), Snyder Institute for Chronic Diseases, Cumming School of Medicine, University of Calgary, Calgary, Alberta, Canada Received March 22, 2018; accepted April 11, 2018 Downloaded from ABSTRACT The contribution of gene expression changes to the adverse and activity, and positive regulation of neutrophil chemotaxis. The therapeutic effects of b2-adrenoceptor agonists in asthma was general enriched GO term extracellular space was also associ- investigated using human airway epithelial cells as a therapeu- ated with indacaterol-induced genes, and many of those, in- tically relevant target. Operational model-fitting established that cluding CRISPLD2, DMBT1, GAS1, and SOCS3, have putative jpet.aspetjournals.org the long-acting b2-adrenoceptor agonists (LABA) indacaterol, anti-inflammatory, antibacterial, and/or antiviral activity. Numer- salmeterol, formoterol, and picumeterol were full agonists on ous indacaterol-regulated genes were also induced or repressed BEAS-2B cells transfected with a cAMP-response element in BEAS-2B cells and human primary bronchial epithelial cells by reporter but differed in efficacy (indacaterol $ formoterol .
    [Show full text]
  • The H3K9 Methylation Writer SETDB1 and Its Reader MPP8 Cooperate to Silence Satellite DNA Repeats in Mouse Embryonic Stem Cells
    G C A T T A C G G C A T genes Article The H3K9 Methylation Writer SETDB1 and Its Reader MPP8 Cooperate to Silence Satellite DNA Repeats in Mouse Embryonic Stem Cells 1,2,3,4 1 1, 1 Paola Cruz-Tapias , Philippe Robin , Julien Pontis y, Laurence Del Maestro and Slimane Ait-Si-Ali 1,* 1 Epigenetics and Cell Fate (EDC), Centre National de la Recherche Scientifique (CNRS), Université de Paris, Université Paris Diderot, F-75013 Paris, France; [email protected] (P.C.-T.); [email protected] (P.R.); julien.pontis@epfl.ch (J.P.); [email protected] (L.D.M.) 2 Faculty of Natural Sciences and Mathematics, Universidad del Rosario, Bogotá 111221, Colombia 3 School of Medicine and Health Sciences, Universidad del Rosario, Bogotá 111221, Colombia 4 Doctoral Program in Biomedical and Biological Sciences, Universidad del Rosario, Bogotá 111221, Colombia * Correspondence: [email protected]; Tel.: +33-(0)1-5727-8919 Current: Ecole Polytechnique Fédérale de Lausanne (EPFL), SV LVG Station 19, 1015 Lausanne, Switzerland. y Received: 25 August 2019; Accepted: 24 September 2019; Published: 25 September 2019 Abstract: SETDB1 (SET Domain Bifurcated histone lysine methyltransferase 1) is a key lysine methyltransferase (KMT) required in embryonic stem cells (ESCs), where it silences transposable elements and DNA repeats via histone H3 lysine 9 tri-methylation (H3K9me3), independently of DNA methylation. The H3K9 methylation reader M-Phase Phosphoprotein 8 (MPP8) is highly expressed in ESCs and germline cells. Although evidence of a cooperation between H3K9 KMTs and MPP8 in committed cells has emerged, the interplay between H3K9 methylation writers and MPP8 in ESCs remains elusive.
    [Show full text]
  • Gene Expression During Normal and FSHD Myogenesis Tsumagari Et Al
    Gene expression during normal and FSHD myogenesis Tsumagari et al. Tsumagari et al. BMC Medical Genomics 2011, 4:67 http://www.biomedcentral.com/1755-8794/4/67 (27 September 2011) Tsumagari et al. BMC Medical Genomics 2011, 4:67 http://www.biomedcentral.com/1755-8794/4/67 RESEARCHARTICLE Open Access Gene expression during normal and FSHD myogenesis Koji Tsumagari1, Shao-Chi Chang1, Michelle Lacey2,3, Carl Baribault2,3, Sridar V Chittur4, Janet Sowden5, Rabi Tawil5, Gregory E Crawford6 and Melanie Ehrlich1,3* Abstract Background: Facioscapulohumeral muscular dystrophy (FSHD) is a dominant disease linked to contraction of an array of tandem 3.3-kb repeats (D4Z4) at 4q35. Within each repeat unit is a gene, DUX4, that can encode a protein containing two homeodomains. A DUX4 transcript derived from the last repeat unit in a contracted array is associated with pathogenesis but it is unclear how. Methods: Using exon-based microarrays, the expression profiles of myogenic precursor cells were determined. Both undifferentiated myoblasts and myoblasts differentiated to myotubes derived from FSHD patients and controls were studied after immunocytochemical verification of the quality of the cultures. To further our understanding of FSHD and normal myogenesis, the expression profiles obtained were compared to those of 19 non-muscle cell types analyzed by identical methods. Results: Many of the ~17,000 examined genes were differentially expressed (> 2-fold, p < 0.01) in control myoblasts or myotubes vs. non-muscle cells (2185 and 3006, respectively) or in FSHD vs. control myoblasts or myotubes (295 and 797, respectively). Surprisingly, despite the morphologically normal differentiation of FSHD myoblasts to myotubes, most of the disease-related dysregulation was seen as dampening of normal myogenesis- specific expression changes, including in genes for muscle structure, mitochondrial function, stress responses, and signal transduction.
    [Show full text]
  • Oligogenic Inheritance of Congenital Heart Disease Involving a NKX2-5 Modifier
    bioRxiv preprint doi: https://doi.org/10.1101/266726; this version posted February 20, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Title: Oligogenic inheritance of congenital heart disease involving a NKX2-5 modifier Short Title: Oligogenic congenital heart disease Authors: Casey A. Gifford1,2, Sanjeev S. Ranade1,2, Ryan Samarakoon1,2, Hazel T. Salunga1,2, T. Yvanka de Soysa1,2, Yu Huang1, Ping Zhou1, Aryé Elfenbein1,2, Stacia K. Wyman1†, Yen Kim Bui1,2, Kimberly R. Cordes Metzler1,2, Philip Ursell3, Kathryn N. Ivey1,2,4§ and Deepak Srivastava1,2,4,5,* Affiliations: 1 Gladstone Institute of Cardiovascular Disease, San Francisco, CA 94158, USA 2 Roddenberry Center for Stem Cell Biology and Medicine at Gladstone, San Francisco, CA 94158, USA Departments of 3 Pathology, 4 Pediatrics, and 5 Biochemistry and Biophysics, University of California, San Francisco, San Francisco, CA 94143, USA † Current address: Innovative Genomics Institute, Berkeley, CA 94704 § Current address: Tenaya Therapeutics, South San Francisco, CA 94080 *Corresponding author: Email: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/266726; this version posted February 20, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Abstract Complex genetic inheritance is thought to underlie many human diseases, yet experimental proof of this model has been elusive.
    [Show full text]