May 2019

CrainsNewsPro.com

Apply Healthy Skepticism Sometimes a Scientific Medical Marijuana: Breakthrough Is Only Hype Page 8 A New Frontier

Jumping Into Cannabis Reporting Deepens As The Podcast Pool Legalization Sweeps the U.S. The Elements That Make Page 4 Series Truly Successful Page 14

Superb Stories, Great Awards AHCJ Bestows Honors On Top Stories in 2018 Page 22

The Life of a Doctor-Writer The Multiple Careers Of Fox News’ Marc Siegel Page 34

P001_NP_20190220.pdf RunDate: 02/20/19 Full Page Color: 4/C 'PXKTQPOGPVCN,QWTPCNKUO *'#&9#6'45616*'2.#+05

,),/!, Photo courtesy of Bobby Magill 9*'4'4+8'45#0&21.+6+%5%*#0)'&+4'%6+105 Hosted and Sponsored by Colorado State University (QTV%QNNKPU%QNQTCFQ1EVQDGTs

CLIMATE CHANGE FOOD AND AGRICULTURE Visit leading-edge atmospheric research centers. Massive CAFOs, regenerative ranching, natural Witness impacts from wild res, drought and foods entrepreneurism, the marijuana boom’s species loss. Learn about statewide GHG-reduction, controversial eco track record: Colorado has it all. renewable-energy initiatives and other solutions. ENVIRONMENTAL HEALTH ENERGY Lower-income metro communities su† er most The Front Range is a  ashpoint for oil and gas acutely from air pollution from vehicles, while activities and anti-fracking activism, as well as country dwellers su† er from oil and gas emissions. a hotbed for wind and solar development.

WATER It’s Colorado’s lifeblood, and it’s in short supply, inciting urban v. rural, east v. west battles. The Colorado River over ows with stories, as Society of its  ows dwindle. Environmental Colorado State Journalists University #SEJ2019 www.sej.org www.colostate.edu

Conference Chairs: Susan Moran, Independent Print Journalist; Host of “How on Earth,” KGNU Radio (Denver/Boulder/Fort Collins) Joshua Za† os, High Country News Correspondent

19np0017.pdf RunDate: 5/20/19 Full Page Color: 4/C )5207+((',725

CrainsNewsPro.com Breaking Down the Doors Back when I was a cub reporter hungry for scoops, my sense of rivalry with journalists at other news organizations was ferocious. But the times have changed, and I think a lot of journalists like me have shifted their attitudes, to an extent. &217(176 While reporters remain extremely competitive, there’s greater cooperation among them — COVERING CANNABIS ...... 4 and that certainly applies to reporters focused on health care. There Are a Host of Angles About Marijuana One impetus for this relates to tighter budgets and reduced stas. Another has to do That Health Journalists Can Explore with stonewalling (if not downright hostility) by people in seats of power. You may have BREAKTHROUGH OR SCAM?...... 8 read about Reporters Without Borders’ recently released 2019 World Press Freedom Index, Reporting on New Medical Solutions which shows that the U.S. has dropped 3 rankings, to No. 48, when countries are judged by Requires a Thorough Info Analysis the level of freedom journalists experience. CLIMATE CHANGE IMPACT ...... 10 Sometimes it takes multiple shoulders to break down the doors leading to hidden It Takes Careful Questioning to Unearth Ways information. ’at’s just what four major news organizations and 250 journalists did to That Extreme Weather Is Affecting Health unlock a story about careless oversight of defective implants, which were approved by the U.S. Food & Drug Administration. ’at outstanding work resulted in a –rst-place award THE MEDICAL IMBALANCE ...... 12 Racial and Geographic Divides Were from the Association of Health Care Journalists. Examined at the Annual AHCJ Conference Another AHCJ –rst-place award, for the story “Fatal Flaws: How Kentucky Is Failing Its Workers,” involved three dierent organizations working together. Both are described in our SOUND ADVICE ON PODCASTING ..... 14 coverage of all the AHCJ’s award winners. There’s an Art and Science to Producing Series That Attract Major Attention Rivals can bene–t from each other in other ways when they come together in a spirit of solidarity. Look no further than Dan Shelley’s column. ’e Radio Television Digital News TROUBLESHOOTING VIOLENCE ...... 17 Association executive director explains how news organizations can guard against assaults RTDNA’s Dan Shelley on Ways to Protect on journalists and change negative public perceptions. Another column in this edition about Journalists on Risky Assignments alliances comes from Stefanie Murray, director of the Center for Cooperative Media. THE SOLUTIONS APPROACH ...... 18 Journalists educating other journalists at gatherings like the AHCJ conference earlier this Pointing Out What Needs to Be Fixed Just month is another form of collaboration. ’at’s the topic of our three standout stories in this Isn’t Enough, According to David Bornstein issue, by Michele Cohen Marill and Andrew Holtz. HEALTH CARE REFORM ...... 20 Competition will always be an important element for journalists. It’s terri–c motivation Mike Cavender on Some Impactful Ways and strengthens news operations’ overall vitality. But a “team of rivals” approach can be so To Cover the Thorny Insurance Debate crucial as we strive to shed light on the world’s darkest corners. AHCJ’S ANNUAL PRIZE WINNERS .... 22 — Janet Stilson, Editor The Awards Honored Groundbreaking Stories and the Journalists Behind Them A NEWS STREAMING PLAYBOOK ..... 28 ADVERTISING SALES CBS’s Christy Tanner on Some Pioneering Ph: (212) 210-0748 Lessons Learned by Her Digital News Team EDITORIAL OFFICES Executive Producer: Phone: (212) 210-0748 CALIFORNIA COLLABORATION ...... 30 Jeff Reisman, [email protected] (212) 210-0748 Publisher: Fawn Lopez Producer: Stefanie Murray on Ways That Reporters Danny Schreiber, [email protected] (503) 723-9688 Can Uncover Big Stories by Teaming Up Editor: Janet Stilson Art Director: Elise Cozzi Production Manager: Nicole Dionne THE DOCTOR-REPORTER IS IN ...... 34 NewsPro (ISSN 2151-1764), Volume 10, Issue 2, is published regularly at Crain Communications Inc., 685 Third Avenue, New Storytelling Is Written in the DNA Yo rk, NY 10017. Periodical postage pending at New Yo rk, NY, and additional mailing offices. POSTMASTER: send address Of Fox News’ Go-To Physician, Marc Siegel changes to NewsPro, Circulation Dept., 1155 Gratiot Ave., Detroit, MI 48207-2912.

NewsPro® is a registered trademark of Crain Communications Inc. CrainsNewsPro.com

0''&#0+0(14/'& (14;1745614;10 241&7%65%+'0%'5 $'0'(+6564'0&5! i>˜ˆ˜} “iœvÌ i£™ÓÈ

2*10'ÓäÓ°ÈÈÓ°Óx£Ç'/#+.“i`ˆ>JVi>˜ˆ˜}ˆ˜Ã̈ÌÕÌi°œÀ}10.+0'Vi>˜ˆ˜}ˆ˜Ã̈ÌÕÌi°œÀ}

May 2019 | NewsPro | 3

P003_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C COVER STORY

MARIJUANA MOMENTUM 7+(&+$//(1*(6$1'5(:$5'62) 7+(0(',&$/&$11$%,6%($7

%\-DQHW6WLOVRQ

P004_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C t could be said that the medical marijuana industry is a journalist’s dream. e eld is constantly shifting and might best Ibe described as a “work in progress.” Today, some 33 states have legalized medical marijuana — 10 of which have legalized recreational usage as well, according to BusinessInsider.com. And the passage of the Farm Bill late last year cleared the way for 14 states to grow hemp legally. Hemp is used to produce some forms of cannabidiol, better known as CBD. What’s more, regulations regarding the sale and production of cannabis, and research about its medicinal e‰ects, are continuing to evolve. Consider, for example, a study led by researchers at the University of Pennsylvania’s Perelman School of Medicine. It showed a 24.8% reduction of opioid overdose mortality in states where medical marijuana was legal at the time the study took place. Gone are the days when journalists who covered marijuana were largely activists or only reporting in counter culture publications like High Times. An example of that is Ricardo Baca, who wrote for e 5,&$5'2%$&$ Denver Post from 2002 to 2016. While he was there, he founded e Cannabist news vertical. “I recently spoke at a conference in Boston, and my rst stop from the American Medical Association — have come out saying that Logan [International Airport] was e Boston Globe newsroom. marijuana is medicine for a limited number of conditions,” he said. ey have four full timers on the cannabis beat. ey’re doing great Javier Hasse, who’s written for a wide variety of news outlets, work,” said Baca, who is now CEO of Grasslands, which is described including e Wall Street Journal’s MarketWatch and CNNMoney, as a journalism-minded ad agency. said that he can’t get too upset about every piece of misinformation Despite that thumbs up for e Globe, Baca and others who write that he sees in news reports. “A lot of times, there’s just not enough deeply about cannabis say that some journalists reporting on the information and scienti c evidence to back up or contradict certain topic are sometimes misinformed. “I see that very regularly where it’s things,” he said. very clear that a journalist doesn’t have a basic understanding of the continued on page 6 subject at hand,” Baca said. at makes sense to an extent, said Baca. “We’re only beginning to emerge from the shadow of prohibition, which is ultimately a campaign of misinformation — whether we’re talking about the gateway drug theory or cannabis as a Schedule 1 substance under the Controlled Substances Act, which it still is.” Baca advises journalists who are new to the marijuana beat to forget what they think they already know when they rst start reporting. “We don’t need

to fall blindly in love with the / concept of medical marijuana.

But we do need to recognize +62 .2 that the world’s most stringent $& 2= medical journals — including e New England Journal of 3+ 27 -$9,(5+$66(6((1+(5(,1&2/20%,$127(67+$7620(7,0(67+(5(,6$/$&.2)'(),1,7,9( Medicine and the Journal of ,1)250$7,21$%287&$11$%,6723,&6

May 2019 | NewsPro | 5

P005_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Marijuana Momentum continued from page 5

e reporting is denitely getting better, as more professional ‘medicine.’ And you journalists start covering the eld, said Steve Bloom, editor in chief can’t say it replaces of FreedomLeanc.com news and product site. But he and Hasse antibiotics.” take issue with some of the slang headlines and overuse of puns — e vastness of like a recent tabloid what’s yet to become newspaper headline known about medical referencing “wacky marijuana, and the tobacky.” “When are struggles of the they going to stop with industry, make for rich these stupid pejorative journalistic material. terms?” Bloom asked. Andre Bourque, who One of the pieces of writes cannabis stories research that journalists for Forbes, noted need to do when they the ongoing struggle start writing about in California about medical marijuana laboratories that are involves the basic required to certify terminology especially marijuana products. $1'5(%28548( as it pertains to CBD. “ ere’s not enough (See sidebar, page 7.) of them. ere are at’s according to way too many producers, and a backlog because there aren’t enough Sharon Letts, who analytical labs,” he said. 67(9(%/220 specializes in writing “We’re driving the quality, proving the eŽcacy and demonstrating proles of patients who and insuring the safety of the product. But at the same time, there’s use marijuana as well as other aspects of the industry. a delicate balance between enabling producers of the product to still Instead of using the term marijuana, “I only use the botanical conduct business and still exist as they evolve to meet those new name, which is cannabis,” said Letts. “I want people to realize that standards,” Bourque added. this is a benecial herb that got a bad rap. It’s a ‘remedy,’ not a Some news outlets have found that the power of lab testing can be turned to their own advantage. e Cannabist commissioned state-licensed labs to conduct tests on various substances in order to nd out if their contents matched what is on their product labels. “We came up with very big stories, many of which led to substantial regulatory change on a state level. One led to an executive state order from the governor of Colorado,” said Baca. “We need to hold the industry and the regulators accountable. We need to make sure that things like heavy metals and microbials and pesticides are not in these products at a level that would be dangerous — as well as make sure these products are as potent as their labels promise,” Baca added. 6+$521/(776

6 | May 2019 | NewsPro

P006_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C /HDUQLQJWKH&%' /LQJR

By Janet Stilson

To write about medical marijuana eectively, one must have an understanding of some basic terminology — especially as it pertains to cannabidiol, often referred to as CBD. CBD can be extracted in two ways: from industrial hemp and marijuana, two plants that are related, and fall under the overall umbrella of Cannabis Sativa L. CBD is one of over 60 active compounds, known as &%',62/$7($&5<67$//,1(32:'(57+$7&217$,16385(&%' cannabinoids, that can be found in cannabis plants. Another one is tetrahydrocannabinol (THC), which is associated with marijuana’s psychoactive properties. For legality purposes, many CBD products cannabis plant that contribute to its ‰avor and medicinal beneŠts. have very low levels of THC, less than .3%, and don’t get people high. Full spectrum products provide an entourage eect, which is believed Some CBD products are limited to cannabidiol alone, but others to have greater therapeutic beneŠts. are what’s known as full spectrum, because they contain several Information in this sidebar was sourced from CBDistillery’s e other cannabinoids as well as terpenes, which are essential oils in the Ultimate CBD User Guide and heylocannabis.com.

May 2019 | NewsPro | 7

P007_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Hope or Hype? Covering&RYHULQJ1HZ6ROXWLRQV5HTXLUHV+HDOWK\6NHSWLFLVP New Solutions Requires Healthy Skepticism

By Michele Cohen Marill

hen e Washington Post health journalist Laurie have proliferated that o†er unapproved or eveneven dubious “cures” using McGinley met Doris Tyler,Tyler, she understood more than stem cells. Weverever before why people believe they can be cured by the As new technologies emerge, health journalists play a vital role newest breakthrough, e evenven before medical science has proven its in evaluating the claims. WWhetherhether they are writing about arti‹cial worth.worth. intelligence,intelligence, telehealth or the newest surgical robot, rreporterseporters look TylerTyler had been slowly losing her eyesighteyesight to macular degeneration for evidence of bene‹t. when, byby searching the internet, she found a clinic near Atlanta that “I alwaysalways get a little skeptical of things that are heavily marketed,”marketed,” promised a cure: stem cells derived from her own fat cells could be said Gideon Gil, managing editor of Stat, an online publication that injected into her eyeseyes to regenerateregenerate the lost cells she needed for sight. covers new discoveries in health, medicine and science.science. McGinley interviewed Tyler,Tyler, then 77, a afterfter she sued the clinic Stat took a close look at IBM’sIBM’s Watson for Oncology,Oncology, which because the procedure left her totallytotally blind. ““eseese are people who uses a cloud-based supercomputer to analyzeanalyze data and recommend have incurable diseases, and conventional medicine doesn’tdoesn’t have an cancer treatments. It launched with a marketing blitz. AAfterfter talking answer for them,”them,” said McGinley,McGinley, who has written about the U.S.U.S. to doctors, aarti‹cialrti‹cial intelligence experts, customers and eveneven former Food & Drug Administration’sAdministration’s e†orts to halt unapproved stem IBM employees,employees, SStattat reportersreporters found the system was not providing cell practices. “[Now TTyler]yler] talks about how she will never see her the data-centric insights it promised — and had not been evaluated grandchildren. She’llShe’ll never see their faces again.” in independent, peer-reviewed studies. Stem cell research is an exciting and emerging ‹eld, o onene that “Our coverage has led customers to ask a lot of questions they saves lives, p particularlyarticularly of lymphomalymphoma patients receiving stem cells should have asked in the ‹rst place,” Gil said. to restore bone marrow aafterfter high-dose chemotherapy.chemotherapy. But clinics How can you know whether a new technology lives up to its hype?hype? e ‹rst step is to look at the science,science, Gil advised. YouYou should be able to ‹nd studies in peer-reviewed journals that show the e†ectiveness of a new procedure or device, he said. NEJM Proudly at was a major red ™ag at eranos, the Silicon ValleyValley startup Supports Health Journalism that claimed to use a single drop of bloodblood toto runrun dozens of tests. e eranos technology never appeared in a peer-reviewed scienti‹c journal, and eventuallyeventually e WallWall S Streettreet Journal reporterreporter John We support AHCJ members in their commitment Carreyrou revealedrevealed that the hot new technology was faulty.faulty. eranos to quality in medical journalism. founder Elizabeth Holmes is awaiting trial on federal fraud charges. To apply for a free media subscription, please visit BesidesHolmes researching was once touted journals in and major reviews, magazines reporters as would the next be smartSteve our Media Center at nejm.org/media. toJobs, talk visionary with university founder researchers of Apple. Foror Wall a while Street after analysts, the collapse and even of competitors.eranos, Tina ey Reed, should executive also interview editor of independent FierceHealthcare, sources kept that a assess new technology based on evidence. One such organization o f medicine Follow us T h e new england journal is the ECRI Institute, a not-for-pro‹t group that evaluates medical Special Article devices and new technology and evaluates the potential of new Mortality in Puerto Rico after Hurricane Maria TheT new england interventions to improve patient outcome and overall safety. ECRI Nishant Kishore, M.P.H., Domingo Marqués, Ph.D., Ayesha Mahmud, Ph.D., Mathew V. Kiang, M.P.H., Irmary Rodriguez, B.A., Arlan Fuller, J.D., M.A., journaljjou Peggy Ebner, B.A., Cecilia Sorensen, M.D., Fabio Racy, M.D., Jay Lemery, M.D., of Leslie Maas, M.H.S., Jennifer Leaning, M.D., S.M.H., Rafael A. Irizarry, Ph.D., established ini 1812 medicine does not accept any funding from industry groups. Satchit Balsari, M.D., M.P.H., and Caroline O. Buckee, D.Phil. ABSTR ACT November 22, 2018

l for recovery of AR101 Oral Immunotherapy for Peanut Allergyvol. 379 no. 21 “We’re an organization of skeptics,” said Diane Robertson, director

BACKGROUND The PALISADE Group of Clinical Investigators* Quantifying the effect of natural disasters on society is critica public health services and infrastructure. The death toll can be difficult to assess BACKGROUND of health technology assessment for ECRI. “We really know how From the Departments of Epidemiology in the aftermath of a major disaster. In September 2017, Hurricane Maria caused abstr act (N.K., A.M., C.O.B.), Social and Behav- massive infrastructural damage to Puerto Rico, but its effect on mortality remainsPeanut allergy, for whichwh there are no approved treatme ioral Sciences (M.V.K.), and Biostatistics who are at risk for unpredictableich there a and occasionally life-threatening allergic reactions. (R.A.I.) and the Center for Communicable contentious. The official death count is 64. Disease Dynamics (N.K., A.M., C.O.B.) METHODS a nt options, affects patients and the François-Xavier Bagnoud Center METHODS In a phase 3 trial, we screened pparticipants 4 to 55 years of age with peanut allergy to sift through the hype to assess whether there’s scienti‹c validity for Health and Human Rights (A.F., J. Lean- Using a representative, stratified sample, we surveyed 3299 randomly chosenfor allergic house- dose-limiting symptomssympto at a challenge dose of 100 mg or less of peanut The members of the writing committee ing, S.B.), Harvard T.H. Chan School of ar (Brian P. Vickery, M.D., Andrea Vereda, Public Health, Harvard University, the holds across Puerto Rico to produce an independent estimate of all-causeprotein mortality (approximately one third of a peanut kernel) in a double-blind, placebo-con- ms M.D., Ph.D., Thomas B. Casale, M.D., Department of Emergency Medicine, after the hurricane. Respondents were asked about displacement, infrastructuretrolled food challenge. ParticipaParticipants with an allergic response were randomly assigned, of Kirsten Beyer, M.D., George Du Toit, M.B., Beth Israel Deaconess Medical Center loss, and causes of death. We calculated excess deaths by comparingin our a 3:1 estimated ratio, to receive AR101 (a peanut-derived investigational biologic oral immu- B.Ch., Jonathan O. Hourihane, M.D., Stacie and Harvard Medical School (F.R., S.B.), notherapy drug) or placebo in annts escalating-dose w program. Participants who com- M. Jones, M.D., Wayne G. Shreffler, M.D., underlying the claims that are being made about an intervention or and the Department of Biostatistics and post-hurricane mortality rate with official rates for the same period in 2016. s pleted the regimen (i.e., receivereceived(a 300 pe mg per day of the maintenance regimen for Annette Marcantonio, M.B.A., Rezi Za- Computational Biology, Dana–Farber wadzki, Dr.P.H., Stephen G. Dilly, M.B., es Cancer Institute (R.A.I.) — all in Boston; RESULTS approximately 24 weeks) underwent a double-blind, placebo-controlled food challenge B.S., Ph.D., Daniel C. Adelman, M.D., the Department of Psychology, Carlos d 300 and A. Wesley Burks, M.D.) assume re- From the survey data, we estimated a mortality rate of 14.3 deathsat trial (95% exit. confi- The primary efficaefficacy end point was the proportion of participants 4 to Albizu University (D.M., I.R.), and the 17 years of age who could ingest a challa d sponsibility for the overall content and Puerto Rico Science, Technology, and Re- dence interval [CI], 9.8 to 18.9) per 1000 persons from September 20 through cy end integrity of the article. The affiliations of technology.” limiting symptoms. search Trust (L.M.) — both in San Juan; December 31, 2017. This rate yielded a total of 4645 excess deaths during thi the members of the writing committee a chalenge dose of 600 mg or more, without dose- and the full names and degrees of all the Keck School of Medicine, University of RESULTS Southern California, Los Angeles (P.E.); period (95% CI, 793 to 8498), equivalent to a 62% increase in the mortality rate as authors are provided in the Appendix. Of the 551 participants who receivedrecei AR101 or placebo, 496 were 4 to 17 years of age; and the Section of Wilderness and Envi- compared with the same period in 2016. However, this number is likely to be an Address reprint requests to Dr. Adelman of these, 250 of 372 pparticipants (67.2%) who received active treatment, as compared ronmental MedicineMedicine, at Universitythe DepartmentA rora of (C.S., Colo- of underestimate becausember 2017, of survivor and onei ane-relatedbias. third The of mortality themigration deaths rate werewas remained substantial.attributed high to throughdelayedd to at Aimmune Therapeutics, 8000 Marina with 55 of of 1 124 participants (4.0%)ved who AR1 received placebo, were able to ingest a dose of Blvd., Suite 300, Brisbane, CA 94005. Robertson along with her colleague, Karen Schoelles, vice president artici 600 mg or more of peanut protein, without dose-limiting symptoms, at the exit food *A complete list of the members of the challenge (difference, 63.2 percentage points; 95% confidence interval, 53.0 to 73.3; PALISADE Group of Clinical Investiga- P<0.001). During the exit food challenge, the maximum severity of symptoms was tors is provided in the Supplementary Appendix, available at NEJM.org. moderate in 25% of the participants in the active-drug group and 59% f This article was published on November for clinical excellence and safety, remind health journalists not to rely placebo group and severe in 5% and 11%, respectiv l 18, 2018, at NEJM.org. vention period affected more th of 34.7% of th N Engl J Med 2018;379 DO on just one study. “e latest study may give you misinformation if you don’t put it in context of the larger ‹eld,” Schoelles said. e quality of studies may vary, as well. Stem cell clinics sometimes list “studies” on clinicaltrials.gov, a database of the U.S. National Library of Medicine, which are “patient-funded” but not a¢liated with an academic institution. e U.S. government does not evaluate 7,1$5((' the studies in the registry, according to an NLM disclaimer. e 8 | May 2019 | NewsPro

P008_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C independent sources, such as university researchers or Wall Street Internationalanalysts, or even Society from competitors, for Stem Cell Reed Research said. provides a website, closerlookatstemcells.org,One such source is the withECRI information Institute, aabout nonpro‡t current organization research. thatAt assesses the recent medical conference devices, ofn ew the technology Association and of patient Health safety Care andJournalists evaluates in the Baltimore, potential healthof new journalistsinterventions and to medicalimprove expertspatient outcomes.reected onECRI the does potential not accept of transformative any funding from interventions. industry entities. Some are“W thrilling.e’re an For organization example, gene of therapy skeptics, reportedly” said Diane cured Robertson,eight baby directorboys with of health a severe technology immune assessmentdisorder, known for ECRI. as “We the real“bubblely know boy” disorder. how to Some sift throughare heartbreaking the hype — to costing assess whetherpatients tensthere’ ofs thousands scienti‡c validityof dollars without underly ingproviding the claimsrelief. that are being made aboutPeter an Marks, intervention director orof AN$1$+&-&21)(5(1&(6(66,212167(0&(//6)2&86('21 AHCJ CONFERENCE SESSION ON STEM CELLS FOCUSED ON QUESTIONABLE48(67,21$%/(5(6($ RESEARCH.5&+63($.(56,1& SPEAKERS INCLUDED/8'(' /725 (5,1 (L TO R): ERIN  technologthe Centery.” for Biologics ALLD$//'AY$<,6$1)5$1&,6&2&+521,&/(3(7(50$5.686)22' '58* SAN FRANCISCO CHRONICLE; PETER MARKS, U.S. FOOD & DRUG ADMINISTRATION;$'0,1,675$7,216$//<7(03/(1(85$/67(0&(//,167,787($1' SALLY TEMPLE, NEURAL STEM CELL INSTITUTE; AND EvaluationRobertson andalong Researchwith her LAURIE/$85,(0&*,1/( MCGINLEY,< 7+(:$6+,1*7213267THE WASHINGTON POST. colleagueat the , FoodKar en andSc hoelles, Drug viceAdministration, president for said clinical the magazineAN AHCJ CONFERENCE with Holmes SESSION on the cover ON STEM in sight CELLS on herFOCUSED desk as ON a reminder excellenceagency is and taking safety, remind action QUESTIONABLE RESEARCH. SPEAKERS INCLUDED (L TO R): ERIN ALLDAY,of the risks SAN of FRANCISCO writing about CHRONICLE; the “next PETER big thing.”MARKS, ( FU.S.ierceHealthcare, FOOD & DRUG healthagainst journalists “non-science- not to ADMINISTRATION;which aggregatespublishes online SALLYnews fornewsletters TEMPLE, health NEURAL ca forre ehealthxecutives, STEM ca CELLre did executives, INSTITUTE; not write did aboutAND not rebased”ly on stem just one cell studyclinics.. ““
e Fore LAURIE MCGINLEY, THE WASHINGTON POST. writethe
eranos about the device.) eranos device.) latesta broader study admonition, may give you he “If something doesn’t smell right, keep checking. Keep asking misinformationo‡ered an age-old if you adage: don’t questions,” Reed said. “Reporters have to be willing to kill a story, put“If it it in seems context too of the good larger to DIANE',$1( ROBERTSON52%(57621 which is really hard.” Journalists should seek perspective from be true, continued it probably on page is.” 31

Advancing Health in America

The Lifeblood of Your Community The blue and white sign with the big H has always carried the promise of help, hope and healing. At your hospital, you will nd people who work around the clock to provide care for patients in their time of need. The hospital of the future will continue that promise, but in new ways that focus less on the four walls of a building and more on partnerships that advance the health of individuals and communities. Find out more at www.aha.org.

May 2019 | NewsPro | 9

P009_NP_20190520r1.pdfP009_NP_20190520.pdf RunDate: RunDate: 05/20/19 05/20/19 Full Full Page Page Color: Color: 4/C 4/C The Climate Reporting Challenge 'LJJLQJ,QWRWKH,PSDFW:LWKRXW3XVKLQJ+RW%XWWRQV

By Andrew Holtz

bout six years ago, Jane Palmer gave up on writing about a ected a farmer’s land — and how conditions experienced last year climate change and the environment. “I thought, ‘I’m just and this year compare to a decade or two ago. People are much more Adepressing people. ey know not to read these stories,’” likely to share their personal experiences when such questions are said Palmer, an experienced science journalist. But then her outlook asked. She relies on climate scientists to „ll in the big, data-driven changed. “When the public health and climate change connection picture of regional and global changes. started coming out, I thought, ‘is is my niche.’ Not only because it Palmer’s insights were revealed during a session about climate a ects people here and now; it’s in our faces.” change at the annual Association of Health Care Journalists’ conference. She and her fellow panelists noted that the altered weather patterns have caused allergy seasons to expand. And warm- climate diseases are moving north. For example, ticks are carrying “Ticks do not care if you Lyme and other diseases to communities that never saw them. Heat waves not only bring heat stroke and exhaustion to middle latitude are Republican or Democrat, communities, but also spikes in suicide. Hospitals are a ected by extreme weather events as well. John Balbus, M.D., a senior adviser for public health at the National nor does the sun. This could Institutes of Environmental Health Sciences, shared inundation maps of Charleston, S.C., and Miami, Fla., published last fall in the be a unifying issue.” Fourth National Climate Assessment. Depending on the predicted category of a storm, the maps show which hospitals will likely have – Jane Palmer to close their doors and evacuate patients. Medical facilities located thousands of miles from areas of devastation can experience the consequences as well. Aaron Bernstein, M.D., M.P.H, who works at Boston Children’s Hospital, By grounding her stories in communities and individuals — and recalled: “I had a child in front of me who had a garden-variety focusing on concrete, speci„c and personal hooks — Palmer connects gastrointestinal infection, so diarrhea and vomiting, and was pretty with sources and produces stories that keep readers’ attention. severely dehydrated. He couldn’t drink he was so sick. He needed IV Ironically, Palmer has learned not to use the phrase “climate •uids. But I received a warning saying, ‘Don’t do it.’” change” in many instances as she goes about her reporting. Instead, Bernstein, who is also co-director of the Center for Climate, she’s gotten better responses by asking how rainfall or heat has Health and Global Environment at the Harvard T.H. Chan School of

Newsroom

Your most reliable source for expert opinions on the latest news and advances a ecting people with bone, joint or muscle pain.

Contact our Public and Media Relations department at (212) 606-1197 or visit us at news.hss.edu

10 | May 2019 | NewsPro

P010_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Public Health, explained that IV uids were being rationed because of Hurricane Maria. Despite hurricane preparations, a medical manufacturing plant in Puerto Rico was closed for a month, leading to six months of intravenous uid shortages across the United States. Mark A. Mitchell, M.D., at the Center for Climate Change Communication at George Mason University, said that one of the most e€ective ways for reporters to get around partisan battle lines is to use health care providers as key sources, because the public still trusts them. He noted that the Medical Society Consortium on Climate and Health has a growing number of chapters across the country that can help reporters ‚nd local sources. ƒat kind of informational %5$06$%/(60,7+ “ammunition” was welcomed by the climate change session’s attendees. Among them was Stories on wild‚re preparedness by local hospitals and other radio reporter Kerry Klein, who health care institutions are of particular interest to Klein. “I think is based in California’s central there’s a lot going on now to make [institutions] more robust,” she valley, where voters tend to said. Not only are reports like those likely to catch the attention of favor Republican candidates. listeners across the political spectrum, they highlight positive actions She said she plans to avoid that communities can take. the term climate change when Preparedness story ideas also caught the eye of Bram Sable-Smith, .(55<./(,1 seeking interviews. continued on page 31

3XWWLQJ(YLGHQFHLQWR$FWLRQ

3&25ΖKDVDZDUGHGPRUHWKDQELOOLRQLQUHVHDUFKDQGRWKHULQLWLDWLYHVWKDWFDQKHOSSHRSOH PDNHEHWWHULQIRUPHGKHDOWKFDUHGHFLVLRQV7KHVWXGLHVZHIXQGFRPSDUHZKLFKFDUHDSSURDFKHV ZRUNEHVWIRUZKRPWRWUHDWFRQGLWLRQVWKDWLPSRVHDKLJKEXUGHQRQSDWLHQWVWKHLUIDPLOLHVDQG WKHKHDOWKFDUHV\VWHP7RSLFVLQFOXGH

ȏ &RPSDULQJ:D\VWR0DQDJH&KURQLF3DLQ:KLOH5HGXFLQJ/RQJ7HUP2SLRLG8VH ȏ ΖPSURYLQJ6\PSWRP0DQDJHPHQWIRU3DWLHQWVZLWK$GYDQFHGΖOOQHVV ȏ &RPSDULQJWKH(΍HFWLYHQHVVRIWKH0RVW&RPPRQ7\SHVRI%DULDWULF6XUJHU\ ȏ 'HWHUPLQLQJ+RZ2IWHQ3URVWDWH&DQFHU6XUYLYRUV6KRXOG*HW)ROORZXS7HVWLQJ ȏ :KHWKHU6HOI0DQDJHPHQW&DQΖPSURYH&DUHIRU3HRSOHZLWK&23'

3&25ΖZRUNVFORVHO\ZLWKSDWLHQWVDQGRWKHUKHDOWKFDUHVWDNHKROGHUVWKURXJKRXWWKHUHVHDUFK SURFHVVWRHQVXUHWKDWRXUIXQGHGVWXGLHVDGGUHVVWKHTXHVWLRQVWKH\FDUHDERXWDQGSURGXFH UHVXOWVPRUHOLNHO\WREHWDNHQXSLQSUDFWLFH

7RLQWHUYLHZH[SHUWVRQFRPSDUDWLYHFOLQLFDOH΍HFWLYHQHVVUHVHDUFK DQGSDWLHQWFHQWHUHGRXWFRPHVUHVHDUFKSOHDVHFRQWDFW 0DU\0F1DPDUD6HQLRU0HGLD5HODWLRQV6SHFLDOLVWDW ® RUPPFQDPDUD#SFRULRUJ

May 2019 | NewsPro | 11

P011_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C 025(7+$1-2851$/,676$77(1'('7+($118$/$+&-&21)(5(1&(,1%$/7,025( Unequal Care 2YHUFRPLQJ%LDVLQ7UHDWPHQWDQG5HSRUWLQJ

By Michele Cohen Marill

ome Americans are dying because they don’t get the medical adequate care to all Americans,” said Brawley, who is the Bloomberg care they need while others are receiving unnecessary screening distinguished professor of oncology and epidemiology at Johns Sor treatment. Fixing that imbalance, which is inuenced more Hopkins University in Baltimore and a former chief medical and by geography than race, is the scienti c o†cer for the American Cancer Society. most critical challenge facing More than 800 health journalists from every state and several the nation’s health care system, countries gathered in Baltimore — a record turnout — to learn according to cancer expert Otis about health disparities and health reform, medical innovation and Brawley. emerging issues. ­ey also gained skills to hone their craft. During his passionate opening While Brawley focused on geographic disparity as an overriding address at the annual conference issue, there are other health care dividing lines. Rebecca Dineen, of the Association of Health assistant commissioner for the Bureau of Maternal and Child Health Care Journalists, Brawley cited at the Baltimore City Health Department, described racism as a dramatic reductions in mortality stressor that contributes to poor birth outcomes. from breast and colorectal cancer Dineen launched the B’more for Healthy Babies initiative, over the past few decades — but providing care coordination designed to reduce health disparities. great variability from state to From 2009 to 2017, Baltimore City’s infant mortality rate declined state. by 36 percent, and the teen birth rate dropped by 55 percent. 27,6%5$:/(<*,9(6$1 “­e most important question 23(1,1*$''5(6621+($/7+ As she created the program, Dineen was committed to we can ask is how to provide ',63$5,7,(6 counteracting racial bias. ­e Maternal and Child Health sta˜

12 | May 2019 | NewsPro

P012_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C attended workshops on “undoing racism” and the health workers meet monthly in equity working groups. “When infant mortality is higher in one race than another, that tells us there’s an injustice we have to correct,” Dineen said in her luncheon address. Meanwhile, conference panelists urged health journalists to avoid bias in their own work. For example, they should seek diverse sources for stories and reframe the way they look at health disparities among African American women. Too often, the women are implicitly blamed for their health issues, said Darrell Gaskin, director of the Center for Health Disparities Solutions at the Johns 5(%(&&$',1((1$66,67$17&200,66,21(5)257+(%85($82)0$7(51$/$1'&+,/'+($/7+$77+( Hopkins Bloomberg School of %$/7,025(&,7<+($/7+'(3$570(17*$9($1$+&-/81&+(21$''5(66 Public Health. “†e problem isn’t that we have people who are broken. †e problem is that we have systems that are broken,” he consuming. Adam Marshall, Knight Litigation Attorney at the said in a session discussing whether health disparities for minority Reporters Committee for Freedom of the Press, advised journalists women can be changed. to ask sources to share documents, avoiding Œling a Freedom of For freelance writer Elizabeth Marglin of Lyons, Colo., the Information Act (FOIA) request if possible. “†ere’s no requirement sessions provided a reminder to make an extra eŠort to seek diversity, to use FOIA to get records from the government. You can just ask,” including getting perspective from nurses and other non-physician he says. health professionals in addition to doctors. “†e biases we hold If FOIA is necessary, the Œrst step is to know speciŒcally what to inŒltrate every aspect of health care, even the reporting of it,” she ask for and how to frame the request. Online resources help, including said. “[†e issue] showed up in almost every panel, so it was a really iFOIA.org (to generate request letters) and foiamachine.org (to strong mirror that you couldn’t look away from.” generate requests and track their progress). Covering health presents other challenges, including practical Government entities maintain a vast quantity of records that ones. Getting access to public records can be di’cult and time- could prove useful if you know where to look. “If you see a form that someone Œlled out, all that information goes into databases. †ose are databases you can request,” says David Cuillier, associate professor of journalism at the University of Arizona in Tucson. †e conference re›ected the ongoing strength of health journalism even in the midst of shifts in the profession. For the Œrst time, AHCJ’s membership includes more online journalists (32 percent) than newspaper journalists (29 percent). About a quarter of AHCJ members are freelance writers. Five journalists visited from Japan, looking to AHCJ as a model for their organization of medical professionals and journalists, the Association of Medical Journalism. †e session on social media misinformation had a particular relevance. “We do share a common concern,” said Mugifumi Akimoto, executive editor of People’s Medicine. Patricia Carroll, a Œrst-time attendee at the conference from Meriden, Conn., remarked at the “eclectic” group of journalists. “It’s amazing in its diversity,” she said. “But the bottom line is every person here is committed to providing '$9,'&8,//,(5$662&,$7(352)(66252)-2851$/,60$77+(81,9(56,7< 2)$5,=21$*(76)(('%$&.)5203$75,&,$&$552//$1,1'(3(1'(17 clear, accurate information about health to their readers. -2851$/,67)5200(5,'(1&7 †at is the universal thing that ties us all together.

May 2019 | NewsPro | 13

P013_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Podcast Power 7KHUH·V6WLOO3OHQW\RI5RRPIRU5HSRUWHUVWR -XPSLQWKH3RRO

By Debra Kaufman

odcast listening has crossed a major milestone. More than half of all people in the U.S. (51 percent) have heard one or more of Pthem. And there’s a huge number of options available: about Successful podcasts need “a 600,000 podcasts, with over 18.5 million episodes, are currently available, according to Podcast Insights. compelling story, a complex ‚e New York Times has reported that one in three people in the U.S. listen to at least one podcast a month. Edison Research, which character and a charismatic tracks the trends, said 2019 is showing the most signi‹cant growth in podcast consumption since the company began following them in 2006. host,” according to Samantha While they’ve certainly reached critical mass, there still appears to be room for podcast hopefuls to jump into the space — certainly Henig and Lisa Tobin. those who focus on health and medical issues. Reporters and producers who have already ventured into the terrain have much to say about the lessons they’ve learned and why this is such a fertile area for storytelling.“I think there’s a great hunger among listeners for compelling stories that tell a great narrative or a regular series with enough “exibility to draw people in episode after episode,” said Karen Brown, a reporter with New England Public Radio. Last year Brown co-produced, along with Pagan Kennedy, her ‹rst narrative podcast, Do you cover children’s health? ‚e Great God of Depression, a ‹ve-part series released by PRX’s Radiotopia. It focuses on the mental illness of author William Styron &DOOWKH$PHULFDQ$FDGHP\RI3HGLDWULFVWR and the neurologist who tried to help him, Alice Flaherty. Brown said that not much is needed to start podcasting: a decent ‡5HJLVWHUIRUDZHHNO\HPEDUJRHGQHZVDOHUW ‡,GHQWLI\DQH[SHUWWRLQWHUYLHZ ‡/HDUQZKDW$$3UHFRPPHQGVRQWRSLFVIURP GLDSHUUDVKWRWHHQGHSUHVVLRQ

&RQWDFW$$3DWRUFRPPXQ#DDSRU J ZZZDDSRUJQHZVURRP

-8/,(6+$3,52$1'.$5(1%52:1

14 | May 2019 | NewsPro

P014_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C recorder and microphone along with a familiarity with software like Adobe Audition or ProTools. e most important thing, said Brown, is to pick an idea that suits the form: a story too involved for a one-o that would benet from a serialized format. “If you already work for a journalism outlet, the leadership may be willing to support a great podcast idea and grant the time and editors/assistant to work on it,” Brown said. e New York Times was a pioneer in podcasting when it started more than a decade ago, according to editorial director for audio Samantha Henig. e outlet “really invested in building out a full team of audio professionals in early 2016,” she said. Henig and executive producer Lisa Tobin came up with a prole for a successful podcast: “a compelling story, a complex character and a charismatic host.” e Times does not have a podcast devoted to health care. at’s because there’s “a high bar for us to decide to launch an entirely new show or series,” said Henig. “We ask ourselves, ‘Is this a podcast that only e New York Times can make? Is it something that demands to be done in audio? Is this one of the most important topics or stories e Times can tell in audio this year?’” 6$0$17+$+(1,* continued on page 16

6JG(GFGTCVKQPQH#OGTKECP*QURKVCNU Ài«ÀiÃi˜Ìã]ää䳈˜ÛiÃ̜À‡œÜ˜i`œÀ “>˜>}i`Vœ““Õ˜ˆÌÞ œÃ«ˆÌ>Ã>˜` i>Ì  Vi˜ÌiÀÃ>œÛiÀÌ iVœÕ˜ÌÀÞpvÀœ“Lˆ} VˆÌˆiÃ̜Ó>̜ܘð

(#*2TGUKFGPVCPF%'1%JKR-CJP LÀˆ˜}Ã`iV>`iÃœviÝ«iÀˆi˜Vi̜̜`>޽à «>̈i˜Ì‡Vi˜ÌiÀi`«œˆVÞL>Ì̏ið "ÕÀiÝ«iÀ̈Ãiˆ˜VÕ`iÃ\

75(1'6,1+($/7+ &29(5$*($1'&2676 48$/,7<2)&$5( 0(',&$5( 0(',&$,' œ˜Ì>VÌ-i>˜ ÀœÜ˜>ÌƂvœÀޜÕÀ˜iÝÌÃ̜ÀÞ\ ÓäӇÈÓ{‡£xÓÇNÃLÀœÜ˜Jv> °œÀ}Nv> °œÀ}

>ViLœœŽ°Vœ“Éi`Ƃ“œÃ«ˆÌ>Ã Ji`Ƃ“iÀœÃ«ˆÌ> Jvi`>“iÀ œÃ«ˆÌ> 

May 2019 | NewsPro | 15

P015_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Podcasting continued from page 15

A quick search for health care podcasts reveals an endless variety of options that focus on tness, weight loss and body/mind topics. But there’s very little serious discussion of medical or regulatory issues. Still, health care policy and innovation podcasts do exist, run by people who are not journalists but have a passion for the topic. Among them is David Introcaso, a Washington, D.C.-based health care policy consultant who founded his Healthcare Policy podcast in 2012. “D.C. is an echo chamber, and I wanted an excuse to talk directly to people on topics related to my work,” said Introcaso. He takes issue with D.C.-based health care journals that avoid topics like gun violence and climate change, a void he seeks to ll in his podcast. “ˆe health care policy world is stuck in the past,” he said. Introcaso tried and failed to partner with what he considered appropriate publications but persisted on his own, teaching himself audio editing software. Introcaso said that typically one episode of his ad-free podcast garners 1,000 or more downloads. To host his podcast and provide statistics, he has relied on Libsyn, whose services involve an annual investment of between $500 and $1,000. (Other popular providers are Buzzsprout, Transistor, Simplecast, Podbean and Castos.) He encourages health care journalists to podcast, saying it is a good complement to writing. “I think an editor should immediately '$1.(1'$// see the value,” Introcaso said. “ˆe more of these podcasts the better.” A whole di”erent area of health care is covered by Digital Health Today, a podcast out of the U.K. Its founder, Dan Kendall, emphasized that he is not a journalist but rather a member of the The 340B drug discount “health innovation industry.” He described his podcast as “an NEED TO program is critical to the information source for like-minded advocates and in—uencers … to U.S. healthcare safety share stories, knowledge and experience.” net. 340B hospitals When he started Digital Health Today in 2016, Kendall thought KNOW provide 60 percent of all he’d only draw a small niche audience interested in technical solutions uncompensated care and innovations, from arti cial intelligence to virtual reality, genetic THE ABCs and two-thirds of all engineering and robotics. But the podcast’s popularity grew, and Medicaid inpatient care. Kendall began to get inquiries from companies wanting to sponsor Recent legislative and it and people who were willing to pay to be interviewed for various OF 340B? regulatory proposals episodes. could fundamentally Kendall took sponsors, who are listed on the podcast home page, change the program. but declined pay-to-play. Now, his podcast has been downloaded over 100,000 times, and each episode is downloaded “many thousands” of Representing nearly times. Sponsors run ads, but typically aren’t interview subjects. “If I ACCESS OUR 1,400 hospitals in all 50 do speak with them because they have something interesting to say, I MEDIA KIT states, 340B Health is say that I’m talking to a sponsor,” he said. the only national 340bhealth.org/ Having passed his podcast’s third anniversary, Kendall now has his organization focused media sights set on creating a hub for health care-related podcasts, which solely on the 340B he’s dubbed Healthcare Podcast Network. ˆe site will o”er training; GIVE US A CALL program. We have the act as a creative engine for turning articles and videos into podcasts; expertise to help you 202-536-2285 and try to improve discoverability of its podcasts. “By curating it, cover this story. we’re making a kind of Net—ix for podcasts on health,” he explains. He encourages would-be health care podcasters to jump in. “It’s not binary to do it or not do it,” he said. “If you have six things or 10 things you want to talk about, you have to ask if there is a story arc. Whatever the arc is, de ne how you’ll do it. Do that, and you’ve got season one. ˆen it’s evergreen and fairly low cost to maintain. And it can be out there for eternity.” 16 | May 2019 | NewsPro

P016_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Protecting Reporters Under Attack 7KHUH$UH:D\VWR6WHP3RWHQWLDO9LROHQFHDQG+RVWLOLW\

By Dan Shelley

t’s become an open secret among Bay Area journalists that TV press time, 10 have been attacked so far this year. stations often send armed guards to accompany their crews While enhancing security for journalists is essential, it just Iwhen they’re covering events that either might put them at risk addresses the most egregious symptoms of a larger disease — the because of the nature of those events, or because of where they’re public’s lack of trust with the news media. covering the stories. A January Pew Research Center survey showed that “a majority at precaution didn’t stop an attack on San Francisco reporter of Americans believe the news media do not understand people like Joe Vazquez and photojournalist John Anglin back in February. ey them.” Nearly three-quarters of Republicans held such beliefs. were covering a routine On June 27, 2018, an AXIOS/Survey Monkey poll showed news story — an Oakland that more than 90 percent of Republicans thought the “media teachers’ strike — when intentionally reports fake news.” they were robbed of their e very next day, a gunman stormed into the oˆces of the Capital camera at gunpoint. Gazette in Annapolis, Md., and opened Šre, killing four journalists Vazquez and Anglin, and an administrative assistant. In part because of the mass shooting’s who work for CBS- proximity to the AXIOS poll, many in the journalism community owned station KPIX-TV, continued on page 32 were accompanied by an armed security guard, a retired police oˆcer. e guard drew his weapon and exchanged gunŠre with one of the robbers; both were wounded. e gunmen, along with several alleged accomplices, were later arrested. e camera was recovered. Robbery was the motive '$16+(//(< of that incident, as well as another attack on a KPIX news crew in April. But increasingly attacks on U.S. journalists are ideologically motivated, as Americans have become more politically polarized, and as elected leaders and others have decried the press as the “enemy of the American people.” In June 2018, a Florida man whose van was covered with pro-Trump and anti-news media bumper stickers was arrested and charged with sending several pipe bombs through the mail, at least three to news organizations in New York City. Fortunately, none ignited. In February of this year, at a Trump rally in El Paso, Texas, a BBC photojournalist was assaulted by an attendee wearing one of those infamous red baseball caps. e President’s rallies have become particularly precarious events for journalists, because the U.S. Secret Service (for obvious reasons) limits the news media’s use of security guards. According to the U.S. Press Freedom Tracker, the archive of record for threats and assaults on journalists in our country, 48 reporters and photographers were assaulted in 2017; slightly fewer, 43, in 2018. At May 2019 | NewsPro | 17

P017_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Add Solutions and Stir Up Response 5HYHDO1RW2QO\:KDW·V%URNHEXW+RZWR)L[,W

By David Bornstein

ou’re sitting in a doctor’s oce. After spending 30 minutes showing promise, if any? Which intended solutions aren’t working? examining you carefully, your physician tells you in a worried What can we learn from things that are successful, and how might Ytone that you have a potentially serious health problem.
en society build on this knowledge? she stands up and escorts you to the door, bringing the appointment To be sure, journalism must inform the public about threats, crises to a close. and wrongdoings. But the relentless focus on dysfunction in the news, “Wait a minute,” you object frantically. “Isn’t there anything I can without meaningful and do? What are my treatment options?” systematic coverage about Too often the news hits people like this hypothetical doctor’s credible e‡orts to respond appointment. Everyday, we journalists inform society about serious, to society’s ills, creates anxiety-producing problems: violence, unemployment, addiction, a distorted image of the climate change, broken education and health systems, political world. It’s an image that dysfunction. causes emotional distress Most of the time, however, our reports do little to help audiences and leads people to feel understand what might be done about the problems. Is anyone powerless.
ose were two trying to x them? If so, what responses are demonstrating results or of the top complaints cited in a 2017 Reuters Institute Digital News survey, which found that 38% of U.S. respondents sometimes or often avoid the news.
e solution is not to soften journalism, or include more “feel good” '$9,'%25167(,1 news, but to rebalance the hard news: to reveal, more faithfully and with a critical eye, the interplay between problems and e‡orts to advance solutions, whether they work or not, and with a clear sense of their limitations. In the area of health care coverage, this is particularly important: health care remains the No. 1 issue for American voters, according to an NBC News poll last year. Consider the experience of
e Plain Dealer. In 2003, Cleveland had one of the highest infant mortality rates of any major American city.
at year,
e Plain Dealer ran a six-part investigative series that revealed some of the city’s neighborhoods had infant mortality rates as high as Guatemala’s. After the series, Cleveland’s infant mortality rate continued to climb. More than a decade later, it remained among the worst of any American city. In 2015,
e Plain Dealer tried a di‡erent approach. Its series “Saving the Smallest” investigated the problem of infant mortality again, but also looked at e‡orts to stem the tide in Cleveland and other cities like Baltimore and Mans eld, Ohio.
e solutions stories were not soft.
ey increased the pressure on authorities — by taking away excuses and highlighting the city’s negligence. Less than a month after the series ran, Cleveland and Cuyahoga County established a joint task force on infant mortality,

18 | May 2019 | NewsPro

P018_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C which began exploring some of the interventions reported. It led to productive exchanges between Cleveland and Baltimore. Between 2016 and 2017, infant mortality rates in Cleveland dropped by 8 percent. To be sure, the problem has not been solved. But the expectations have shifted by showing that other cities are doing better. At the Solutions Journalism Network (SJN), we demonstrate that reporting on responses to social problems can and should be done with the same rigor as investigative reporting. When integrated into the reporting mix, solutions journalism often leads to meaningful corrections in the public interest. Across the United States, close to 200 news organizations, and thousands of journalists, are integrating solutions journalism into their reporting, supported by training and project support from SJN. 6-1·662/87,2166725<75$&.(5&217$,16$%2876725,(6$%287)2&8621 In western Montana, for example, several 0(17$/+($/7+&$5(,17+(86 news organizations have been collaborating to examine e‰orts to improve mental health in rural areas with relatively limited access to medical services. Similarly, in Of note, the stories that emerge from projects like these are New Hampshire, news organizations have come together to form not just relevant to a few communities, whether in Montana or the Granite State News Collaborative, which is examining potential New Hampshire. Že experiences and insights often prove helpful solutions to the behavioral health crises in the state. continued on page 32

REAL NEWS. REAL POSSIBILITIES.

For any journalist covering the health care beat, getting the facts wrong can be a tough pill to swallow. AARP, the leader in advocating for Americans 50+, has you covered. Our media relations staff is the consummate resource for your health care policy and advocacy queries and research for:

• Prescription Drug Prices • Family Caregiving • Brain Health/Dementia • Medicare • Long-Term Care • Food Insecurity • Medicaid • Healthy Aging • Affordable Care Act • Social Isolation

For the most informed commentary on health care issues affecting older Americans, get the facts, information and expertise you need at: www.aarp.org/press.

Real Possibilities is a trademark of AARP.

May 2019 | NewsPro | 19

P019_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Digging Deeper Into the Health Care Issue 4XHVWLRQV6KRXOG%H([SORUHG&RQFHUQLQJ%RWKWKH 3ROLWLFDO'HEDWHDQGWKH,PSDFW2Q&LWL]HQV

By Mike Cavender

hile the development of a promising drug or the discovery e most ambitious eort of a breakthrough cure are sure to provide news coverage toward providing widespread Was we move forward, there is another very important issue health care access in America that will give lots of opportunity for impactful journalism. at is the was the Aordable Care Act ongoing debate about insuring access to quality, aordable health (ACA) of 2010, otherwise care for all Americans. known as Obamacare. While I have some ideas about how future reporting in that area might the law guarantees access to be conducted. But before I get into that, consider this: the United everyone, it’s only been able to States remains the only wealthy, developed nation without a system do so at prices that many have of universal health care. Our prescription drug prices are among the found anything but aordable. highest in the world. To make matters worse, the ose issues became front and center in the 2018 midterm elections ACA has also been under and will likely be again as we prepare to go to the polls in 2020. attack for years by politicians who, while never able to 0,.(&$9(1'(5 repeal it, have succeeded in substantially weakening it. As a result, millions of Americans are still going without insurance — now estimated as one out of every 10. So where do we go next? A poll from the Kaiser Family Foundation, a health think tank, indicate a slim majority of Americans now favor a “single-payer” system — likely something akin to Medicare. As a result, we see Democratic presidential hopefuls supporting a variety of iterations of that concept including single-payer, Medicare buy-in 0D\R&OLQLF at 55 or tweaking and improving the Aordable Care Act. Meanwhile, as they have in the past, Republicans are likely to 1HZV1HWZRUN brand many of these ideas as too radical and continue the argument 7KHMRXUQDOLVWV· that health care is not a right, but a choice that must remain in each American’s hands and independent of government control. PXOWLPHGLDVRXUFH Beyond the basic insurance questions, there is the related IRUKHDOWKVFLHQFH conundrum of high prescription prices. Why do Americans pay four or ˜ve times the price (or more) for many brand-name and even DQGUHVHDUFK some generic drugs compared to what Canadians or Europeans pay LQIRUPDWLRQ for the same medications? Drug manufacturers say this is largely related to such factors as research and development costs and the practices of pharmacy bene˜ts managers, which act as middlemen between drug makers and insurance companies. Whatever the reasons, politicians on both sides of the aisle say this part of the system is broken and Americans are paying the price. But will any meaningful change come? at’s a question with an answer 5HJLVWHUDW that’s not as clear. All of these issues point to the need for health care journalists to QHZVQHWZRUNPD\RFOLQLFRUJ be on the front lines to report on these debates and their impacts.

20 | May 2019 | NewsPro

P020_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C (healthjournalism.org). Under the “core topics” section, you’ll „nd story ideas, examples and information about subjects that include Teaming up with health reform and insurance. Of particular note is a series of stories by Bloomberg health care reporter and Knight-Bagehot Fellow John Tozzi, “Chronicling journalists at other America’s Uninsured.” In a how-to essay for the AHCJ website, he wrote: “ e people with the most at stake in America’s health-care news organizations can debate often have the smallest voice in it.” Tozzi found people who were uninsured and followed them for a provide stories with a year to show how the a‘ordability crisis in health care impacted their lives. e results were both poignant and revealing as they shed new light on just how serious this problem has become. depth that might not be Stories like these can also lend themselves to cooperative reporting. Teaming up with journalists at other like-minded news organizations otherwise attainable. can provide stories with a depth that might not be otherwise attainable. A gold standard example is the joint investigation done by CBS News’ “60 Minutes” and e Washington Post on the Drug Enforcement Administration and its role in the opioid crisis. ree key questions can be addressed. How do the uninsured live e health care debate is multi-dimensional, complex and too each day while knowing they may only be one illness away from often bitterly partisan. It will not be easily solved. But, as is often the bankruptcy if they or their children get sick? Where do they go for case, these issues are more likely to be addressed when they receive medical treatment, and who ultimately pays for it? How does “living the attention they deserve. Health care reporters can help make sure on the edge” without health insurance impact their psychological and that happens. social health? Mike Cavender is the executive director emeritus of the Radio Reporting resources for these stories are myriad. An excellent Television Digital News Association (RTDNA). He can be reached at place to start is the Association of Health Care Journalists’ website [email protected].

May 2019 | NewsPro | 21

P021_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C 2018 AHCJ AWARDS FOR EXCELLENCE Cream of the Crop 7KH$+&-$ZDUG:LQQHUV3URGXFHG3URYRFDWLYH6WRULHV 7KDW/HGWR&KDQJHVLQ3ROLFLHV3UDFWLFHVDQG$ZDUHQHVV

By Janet Stilson

he ways in which medical and governmental groups are Among those honored is Lesley McClurg of public radio station endangering human lives by insu cient or careless practices KQED San Francisco, recognized in the beat category for her body Twere at the heart of many stories that won this year’s Awards of work. e topics she tackled ranged from the struggles of sex- for Excellence in Health Care Journalism. harassment victims to medical detectives who are cracking the “code” e awards honored stories that emerged in 2018, and they were on undiagnosed conditions. bestowed by the Association of Health Care Journalists during its e information delivered in many stories that were recognized annual conference held this month in Baltimore. Now in its 15th have life-and-death consequences. For example, Kaiser Health year, the awards drew more than 350 entries in 12 categories. News’ Marisa Taylor exposed the practices of a tenured professor at “e contest winners showed how to dig into what’s making Southern Illinois University who did unauthorized, risky research Americans sick, and how pro t motives are distorting their care,” that involved injecting people with a herpes vaccine in the Caribbean said contest co-chair Tony Leys, a Des Moines Register reporter and and in Illinois hotel rooms. AHCJ board member. Another extremely ambitious report centered on the careless oversight of faulty implants. It was a collaboration between some 250 journalists and four main news organizations: the International Consortium of Investigative Journalists, Avrotros, NBC News and the Associated Press. en there’s a series of stories by Rebecca Moss that exposed serious accidents and radiation exposure at the Los Alamos National Laboratory — home of the atomic bomb. ey were published by the Santa Fe New Mexican and ProPublica. is year’s AHCJ honors includes a new category for students. e &KGVCT[UWRRNGOGPVU rst-place award went to three reporters in New York University’s School of Journalism. eir piece, published in the digital magazine ƂNNPWVTKGPVICRU Undark, showed how pharmaceutical companies can tweak the design of clinical studies to help ensure U.S. Food and Drug Administration (FDA) approval. 9GƂNNKPHQTOCVKQPICRU Below is a summary of the rst-place winners in this year’s competition. And a sidebar on page 26 gives a complete rundown of the honors bestowed. iÝÌ`i>`ˆ˜i]`ˆÃVœÛiÀÜ ÞÜi½Ài Ì iÜÕÀVivœÀÃVˆi˜Vi‡L>Ãi` BEAT REPORTING ˆ˜vœÀ“>̈œ˜œ˜`ˆiÌ>ÀÞÃÕ««i“i˜ÌÃ\ Lesley McClurg captured an award for her body of work in 2018. ÜÜÜ°VÀ˜ÕÃ>°œÀ} At KQED San Francisco McClurg reports on medical and mental health, occasionally veering o£ into the realms of the environment, astronomy and food. Many of the stories the judges considered help “>ˆ >˜VÞ\ listeners and readers make smart health decisions. PYGKPFTWEJ"ETPWUCQTI Among them is a report on how immunotherapy is vastly improving the odds of survival for some cancer patients. Another story focused on medical detectives who are able to successfully pinpoint previously undiagnosed diseases. McClurg also tackled the topic of workplace sexual harassment and how the rami cations for victims can manifest years after the

22 | May 2019 | NewsPro

P022_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C 2$%,*$,/%2%2 3+ 27 /(6/(<0&&/85*·6%2'<2):25.,1&/8'('$6725<)($785,1* +(,',/(')25'·66725<)($785('$0%(56$33:+2/($51(' $6+/(<:$/721 3,&785(' :+2)28*+70(/$120$:,7+$1 7+528*+$)$&(%22.32677+$7+(5621*$55(77&28/'127%( ,008127+(5$3<75($70(17 6$9('%<7+(75,$/'58*+(:$67$.,1* events occurred. In addition, she put a spotlight on San Francisco’s a jumping-o point to discuss how that one experience is part of a comprehensive restrictions on e-cigarettes, despite a massive larger trend impacting clinical trials. And it earned her ˆrst-place campaign by tobacco giant R.J. Reynolds. AHCJ honors. e judges noted that McClurg’s stories were creatively reported Ledford learned that trial participants are now using social media through driving narratives and compelling science that’s easy to to trade insights and comfort — sometimes in ways that can threaten understand. “She oers moving personal stories while at the same the integrity of a study. People involved in a trial may band together time seeking out experts who provide needed perspective and to unblind the study, for example, by determining who is receiving caveats,” they commented. the placebo treatment as opposed to the experimental therapy. Ledford explained in her story: “As participants become more TRADE PUBLICATIONS/NEWSLETTERS empowered, the natural tensions between their goals and those of A Heidi Ledford story in Nature focused on a mother who the researchers become more pronounced.” discovered that a trial aimed at reversing her son’s disease, Duchenne muscular dystrophy, had failed. e mother learned this not from INVESTIGATIVE (LARGE) people administering the study, but through the Facebook post of Artiˆcial hips that corrode Žesh and poison blood, spinal-cord another parent whose child was also being tested. stimulators that permanently injure patients and surgical mesh that In the article, “How Facebook and Twitter Could be the Next cuts into tissue causing chronic pain and bleeding — these are but Disruptive Force in Clinical Trials,” Ledford used the anecdote as continued on page 24

2019 AAAS Kavli Science Journalism Awards Since 1945, the awards program has honored distinguished reporting on the sciences, engineering, mathematics and more. Panels of journalists select the winners. With an increased endowment from The Kavli Foundation, the contest is open to journalists from around the world. To learn more, visit sjawards.aaas.org.

Entries for the 2019 contest will be accepted online starting in May.

Deadline: 1 August 2019 ‡ sjawards.aaas.org ‡ Follow us on Twitter @AAASKavli

May 2019 | NewsPro | 23

P023_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C 2018 AHCJ AWARDS FOR EXCELLENCE

continued from page 23

three examples of defective implants that were allowed by the FDA. complications,” the AHCJ judges said. “As inewsource was And they were at the center of a story, “Implant Files,” that earned a completing its story, [the clinics’ founder] was arrested in Alabama rst-place AHCJ award. on related bribery charges. A number of clinics have since closed e International Consortium of Investigative Journalists, or rebranded.” Avrotros, NBC News and the Associated Press collaborated on the extremely ambitious e‚ort, which was published by more than 50 CONSUMER/FEATURE (LARGE) media partners. e year-long investigation showed how regulators It took reporters from the Kentucky Center for Investigative bowed to industry pressure to rush approvals, lower safety standards Reporting, the Ohio Valley ReSource and the Center for Public and cloak critical information. e team working on the story grew Integrity to uncover deep Ÿaws in Kentucky’s worker safety program. to include more than 250 journalists in 36 countries. e story, “Fatal Flaws: How Kentucky Is Failing Its Workers,” “is series did a masterful job of spotlighting gaping holes in the picked up rst-place AHCJ honors. e three journalists who system of regulating medical devices,” the AHCJ judges commented. worked on the report — Eleanor Klibano‚, Je‚ Young and Jim “e series shows how politics and money often overshadow health Morris — showed how the state failed to properly investigate nearly and safety, in the context of the recent weakening of consumer every on-the-job death for two years. e victims included tree protections.” trimmers, public-works employees, construction workers and home- health aides. In almost every case, the state’s Occupational Safety INVESTIGATIVE (SMALL) and Health program didn’t do enough to determine if a business was A seemingly miraculous infusion procedure was the topic of responsible for unsafe conditions and did not hold them accountable. “Hustling Hope,” a rst-place AHCJ award winning story series e AHCJ judges were impressed by the legwork, data journalism reported by Cheryl Clark, Lorie Hearn and Megan Wood for and storytelling. “e audio complemented the stories, making inewsource.org. e stories focused on a national network of Trina this important work accessible to multiple audiences. e graphic Health clinics that claimed they could reverse complications from presentation attached a name and details to each incident, making diabetes. Even erectile dysfunction would allegedly disappear after a each death a person, not just a statistic,” the judges noted. few four-hour weekly sessions. And, the clinics advertised, Medicare and health plans covered it. CONSUMER/FEATURE (SMALL) e three journalists discovered that the Centers for Medicare Vancouver Sun reporter Larry Pynn had very personal reasons for & Medicaid Services had found insu”cient evidence the clinics’ IV writing his rst-place-winning series of stories, “Prostrate Cancer: 1 procedure actually worked and declined to pay for it. at led to claim in 7.” He learned he had the disease, which as the story title indicates, denials by insurance companies, which generally follow Medicare’s a‚ects one in seven men. Like many middle-aged men, he had not rules. Despite that, Trina clinics were operating in 16 states. thought much about prostrate cancer, and knew nothing about the “Cheryl Clark received a tip from a doctor about a network of test or the treatment options at the time he was diagnosed. infusion clinics o‚ering questionable treatments for diabetes e series of stories he wrote was researched and written over ,5 20,&+(//(+$1.6. <& 3+ 27 7+(6725<´)$7$/)/$:6µ)($785('/,6$+2%%63,&785('+(5( 9$1&289(56815(3257(5/$55<3<11:527(+,66(5,(62) +(5+86%$1'*(1(:$6.,//(':+(1$'803758&.%$&.('29(5 6725,(6´352675$7(&$1&(5,1µ$)7(5/($51,1*7+$7+(+$' +,07+(67$7(,668('12&,7$7,21672+,6(03/2<(5 7+(',6($6(

24 | May 2019 | NewsPro

P024_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C 2%5(77'8.(12/$&20_7+(7,0(63,&$<81( 3+ 27 7+(',)),&8/7(;3(5,(1&(62).(9,1 6,77,1* $1'5(**,(6($<:(5('(7$,/(',1$ 5(%(&&$0266,19(67,*$7('21*2,1* 12/$&20$1'7,0(63,&$<81(6725<´$)5$*,/(67$7(µ :25.(5+($/7+$1'6$)(7<,668(6$7 /26$/$0261$7,21$//$%25$725<7+( %,57+3/$&(2)7+($720,&%20%

three months. ey looked at the latest research about the disease investigated Louisiana’s failing mental health system and how that and related the stories of other men at various stages of their illness. has impacted families and communities. e AHCJ judges deemed it “an uninchingly honest look at an e NOLA.com and e Times-Picayune journalists included issue that a
ects many men — and the women with whom they share Katherine Sayre, Jonathan Bullington, Richard Webster, Brett Duke their lives.” As one of the female judges noted: “ere are few topics and Aaron Fisher. Together they followed a series of caregivers and more consumer-oriented than the health and welfare of the penis.” aœicted loved ones. Among them was a father, Reggie Seay and his son, Kevin, who is diagnosed with extreme mental illness. Kevin has HEALTH POLICY (LARGE) gone through repeated hospitalizations and fractured care. It’s the stu
of nightmares, but only too real: hundreds of children “In an occasional series published between September and were trapped in Illinois psychiatric hospitals long after they were December, the sta
of NOLA.com/e Times-Picayune in New cleared for release by doctors. at was the topic of a story by Orleans reported a raft of articles that showed in heartbreaking detail ProPublica’s Duaa Eldeib, which was co-published by e Atlantic some results of the state’s massive cost-cutting in mental health in and honored with a †rst-place AHCJ award. the last decade and beyond,” the judges noted. Eldeib’s story tracked how the children waited for the state’s child Reaction to the stories was substantial, including beefed-up welfare agency to †nd them appropriate homes and were in some training by many law-enforcement agencies; legislative debate on gun cases subjected to sexual assault. ey deteriorated mentally and laws and mental health coverage; establishment of a civil mental health behaviorally, fell far behind in school and were unable to go outside. court in New Orleans; and ongoing forums by concerned citizens. “e reporting project analyzed records and data on nearly 6,000 psychiatric hospitalizations of children and determined that 20 PUBLIC HEALTH (LARGE) percent of them had been held ‘beyond medical necessity,’” noted the Over the course of a year Rebecca Moss investigated ongoing AHCJ judges. worker health and safety issues at Los Alamos National Laboratory, As a result, legislative hearings were held; a special monitor was the birthplace of the atomic bomb. e series of stories she wrote appointed by a federal judge; a lawsuit was †led by the Cook County about it for the Santa Fe New Mexican, called “Half-Life,” reported guardian; and there was an investigation by the Inspector General that lab contractors have amassed more than $110 million in †nes of the Illinois Department of Children and Family Services. Federal and lost performance bonuses for serious accidents, radiation authorities pulled funding for institutions with the greatest levels exposure and other lapses since 2006. at earned her †rst-place of abuse. AHCJ honors. e articles explained that the government has made it di£cult HEALTH POLICY (SMALL) for workers to get compensation for radiation-linked cancers. e A team of †ve developed “A Fragile State,” a series of stories that continued on page 27

May 2019 | NewsPro | 25

P025_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C 2018 AHCJ AWARDS FOR EXCELLENCE

BEAT REPORTING HEALTH POLICY (LARGE)

First: Lesley McClurg, KQED First: Stuck Kids; Duaa Eldeib, ProPublica, co-published by e Second: Sammy Mack, WLRN Atlantic ird: Stacey Burling, e Philadelphia Inquirer Second: Deprived of Care: When ERs Break the Law; Brenda Goodman and Andy Miller, WebMD and Georgia Health News TRADE PUBLICATIONS/NEWSLETTERS ird: What Happens When an Algorithm Cuts Your Health Care; Colin Lecher, e Verge First: How Facebook and Twitter Could Be the Next Disruptive Force in Clinical Trials; Heidi Ledford, Nature HEALTH POLICY (SMALL) Second: At the Intersection of Autism and Trauma; Lauren Gravitz, Spectrum First: A Fragile State; Sta, NOLA.com/ e Times-Picayune ird: Survivors Cast Adrift; Sue Rochman, Cancer Today Second: American Epidemic; Melinda Wenner Moyer, Scientic American INVESTIGATIVE (LARGE) ird: Colombia: After the Violence; Sara Reardon, Greg Kendall-Ball, Adam Levy, Nature First: Implant Files; International Consortium of Investigative Journalists, Avrotros, NBC, AP and partners PUBLIC HEALTH (LARGE) Second: Pain and Prot; J. David McSwane, Andrew Chavez and Leslie Eaton, e Dallas Morning News First: Half-Life; Rebecca Moss, Santa Fe New Mexican ird: Dr. Death; Laura Beil, Wondery and ProPublica Second: Deadly Deliveries; Alison Young, Laura Ungar, John Kelly, USA Today INVESTIGATIVE (SMALL) ird: Cultivating a Community; James E. Causey and Angela Peterson, Milwaukee Journal Sentinel First: Hustling Hope; Cheryl Clark, Lorie Hearn, Megan Wood, inewsource.org PUBLIC HEALTH (SMALL) Second: e Forgotten: An Investigation Into an Assisted Living Facility; Katie O’Connor, e Richmond Times-Dispatch and the First: Malaria’s Ticking Time Bomb; Amy Maxmen, Nature Virginia Mercury Second: Catching Fever; Lois Parshley, Scientic American ird: e Children of Central City; Sta, NOLA.com/ e CONSUMER/FEATURE (LARGE) Times-Picayune

First: Fatal Flaws: How Kentucky Is Failing Its Workers; BUSINESS Eleanor Klibano, Je Young and Jim Morris, Kentucky Center for Investigative Reporting, the Ohio Valley ReSource and the Center First: Rogue Vaccine Series; Marisa A. Taylor, Kaiser Health for Public Integrity News Second: e Treatment Gap; Abby Goodnough, e New York Second: Lifeline Oine: Unreliable Internet, Cell Service Times Hurting Pennsylvania’s Health; Kris Mamula and Jessie ird: Risking It; John Tozzi, Aziza Kasumov, Zach Tracer, Wardarski, Pittsburgh Post-Gazette Bloomberg News ird: Deadly Chinese Fentanyl Is Creating a New Era of Drug Kingpins; Esme’ E. Deprez, Li Hui, Ken Wills, Bloomberg News CONSUMER/FEATURE (SMALL) STUDENT First: Prostate Cancer: 1 in 7; Larry Pynn, e Vancouver Sun Second: Genetic Testing Goes Mainstream; Tina Hesman Saey, First: Tweaking Drug Trial Design in the Hunt for the FDA’s Science News Green Light; Ashley Lyles, Dan Robitzski and Cici Zhang, Undark ird: Alzheimer’s Under Attack; Linda Marsa, Discover Second: Life on the Spectrum; Aviva Okeson-Haberman and Magazine Kyra Haas, KBIA Columbia, Mo. ird: Are Pets Good or Bad for Your Child’s Allergies?; Emiliano Rodriguez Mega, Scienceline

26 | May 2019 | NewsPro

P026_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C continued from page 25 government contends nuclear safety issues were only a Cold War Americans received shots containing the untested vaccine in a house problem, but workers say the lab has not accurately tracked their on a Caribbean island and in U.S. hotel rooms. ere was no o’cial radiation exposure, and they are being denied benets. oversight by the FDA or conventional monitoring by an institutional Moss examined the medical and work records of Chad Walde, review board. a maintenance worker who was diagnosed with glioblastoma brain Although the professor, William Halford, had injected Americans cancer and died in 2017 at age 44. e judges noted the article’s with a live virus without the required oversight, he received support “touching” account of his story. “Moss then turns her sights outward from his university and funding from billionaire and President to give readers well-sourced information on how the government has Trump supporter Peter iel. Taylor revealed the university — which responded to the cancers and related illness seen more frequently in consistently said it had no role in what was private research by a workers like Chad Walde,” they said. professor — shared in the patents on the prospective vaccine. “e persistence and journalistic detective work that went into PUBLIC HEALTH (SMALL) uncovering this scandal were extraordinary,” commented the judges. Malaria is on the rise in northeastern Cambodia,and it’s becoming “e series exposed egregious institutional malpractice that stayed increasingly immune to drugs used to stop it. If resistance to the under the radar until the reporter began asking hard questions.” latest cure for malaria hits Africa, deaths will skyrocket. ose grave concerns are at the core of Amy Maxmen’s story, “Malaria’s Ticking STUDENT Time Bomb” for Nature, which picked up a rst place award. e FDA has approved three drugs based on weak scientic In the article, Maxmen explained that Southeast Asia accounts methodology. at was the conclusion of an article in Undark, which for just 7 percent of malaria cases worldwide, but it has a notorious was written by three students within New York University School of history as the breeding ground for strains of malaria parasites that Journalism’s science, health and environmental reporting program: survive every drug thrown at them. Cambodia, ailand, Vietnam, Ashley Lyles, Dan Robitzski and Cici Zhang. Laos and Myanmar have pledged to eliminate the malaria parasite e article, “Tweaking Drug Trial Design in the Hunt for the Plasmodium falciparum from the region by 2025. FDA’s Green Light,” put the spotlight on three approved drugs: When she traveled to the region, Maxmen grew worried. Tests £ibanserin (brand name Addyi), rofecoxib (Vioxx) and rosiglitazone have revealed that entire populations carried parasites in their blood. (Avandia). e journalists pored over public records and medical Finding and treating these asymptomatic cases will be logistically data from FDA-sponsored experiments and other documents about di’cult and expensive. the drugs. e AHCJ judges deemed it “a truly engaging Nature article that ey also interviewed medical experts, some of whom work at blended enough plain English with scientic jargon to make the the FDA or conducted the clinical trials. It became clear that the concept of vector-borne malaria accessible to the layman.” administration accepted and sometimes insisted on weak scientic methodology and approved the medications even though it knew the BUSINESS drugs were dangerous and might not even work. In her rst-place award story series, “Rogue Vaccine,”Marisa Taylor “is in-depth piece builds a persuasive case that should strike exposed an unethical and illegal vaccine experiment overseen by a fear in the hearts of consumers: that the FDA is more interested in tenured professor with the complicity of Southern Illinois University serving pharmaceutical companies than patient safety,” commented and his company. e articles, for Kaiser Health News, revealed that the judges.

Congratulations to all of the winners of the AHCJ Awards for Excellence in Health Care Journalism

CrainsNewsPro.com

May 2019 | NewsPro | 27

P027_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Always On: Lessons from the CBS News Digital Streaming Playbook $3LRQHHULQJ1HZV&KLHI6KDUHV,QVLJKWV

By Christy Tanner

recently interviewed a reporter who wants to make a switch from sports to hard news. When I asked why, he said, “News just feels Iso important now.” I agree, and our CBS News Digital team Because audience habits shares that sense of purpose as we develop CBSN, our free, 24/7 live news stream. are changing so quickly, our We launched CBSN in 2014 when delivering the news to team is continually testing connected screens was relatively uncharted territory. At ƒrst, we were on three over-the-top (OTT) platforms — Apple TV, Roku and and adopting new methods Amazon Fire TV — along with CBSNews.com and our mobile apps. “e list of distribution partners has grown to include 18 di•erent of storytelling. devices, platforms and services, including Hulu Live, Xbox as well as the streamed on-demand subscription service CBS All Access. Last year, 400 million streams were delivered by an audience with a median age of 37 — far younger and more urban than major TV 1: OUR TEAM REFLECTS OUR AUDIENCE: SMART, channel news audiences. ADAPTABLE AND INCLUSIVE. Here are some of the strategies we’ve developed and the lessons We rely on a deep bench of correspondents who are a mix of we’ve learned: both broadcast and digital natives. Research shows that our target audience — made up of what our research group calls “news omnivores” and “savvy streamers” — values the team’s expertise. Because audience habits are changing so quickly, our team is continually testing and adopting new methods of storytelling and ways to reach our viewers via push notiƒcations, search engine optimization (SEO), social messaging and more. And when we hire new team members, we look for an openness to experimentation, ¡exibility and hybrid skillsets. Inclusiveness in hiring enriches the depth of our team, the stories we tell and our ability to capture viewers in many di•erent circumstances.

2. TEAMWORK IS KEY, ESPECIALLY BETWEEN EDITORIAL AND TECHNOLOGY STAFF MEMBERS. We value both journalistic and technological excellence. Our business depends on being able to seamlessly stream on all platforms — which means we need top talent in engineering and product development. To help develop the spirit of teamwork, we have meetings every morning that include people from editorial, marketing, product development, analytics and public relations. We discuss what worked the day before and lay out strategic priorities for the day ahead of us. Over time, this has led to everyone understanding the roles and responsibilities of their colleagues. Great ideas have come from &+5,67<7$11(5 every department.

28 | May 2019 | NewsPro

P028_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C ()25&%61(:6 2: 20,&+(/(&5 3+ 27 &%61675,9(6723529,'(9,(:(56:,7+81%,$6(',1)250$7,21$021*7+26('(/,9(5,1*7+(1(:6$5($11(0$5,(*5((1$1'9/$' '87+,(56:+2$5(%27+&%61$1&+256$1'&%61(:6&255(6321'(176

Going forward, the advent of 5G will make our hybrid journalism U.S., allowing local experts to report on issues like redistricting in and tech skills even more critical as viewers seek news sources that North Carolina or marijuana laws in Colorado. are both accurate and reliably fast. “Local Matters” has developed strong partnerships with station aŒliates — relationships that allow for standout coverage when news 3. OUR VIEWERS WANT KNOWLEDGE, NOT OPINION. is breaking in their areas. As the 2020 election season begins, look for As the graph on this page shows, what really keeps audiences “Local Matters” to expand. In addition, building on the December coming back is CBSN’s focus on sharing knowledge, not opinion. 2018 launch of the local streamed service CBSN New York, we soon Loyalists come to us for depth, perspective and dialogue — as will launch additional news streams focused on other markets. opposed to disagreement for the sake of entertainment. As one viewer We’ll continue to report on the issues and subjects that matter told us, CBS News journalists “tell you the facts, not what to believe.” most to our viewers — the news that’s “so important now.” We’re Viewers also told us they wanted more climate, privacy and local proud of what we’ve accomplished so far and are looking forward to news. So, we launched the daily segments “Climate Watch” and continuing to innovate as this space grows. “Privacy Watch.” During the 2018 midterm elections, we launched Christy Tanner is executive vice president and general manager of CBS “Local Matters” to go deep on issues driving elections around the News Digital.

May 2019 | NewsPro | 29

P029_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C A ‘Watershed’ Alliance -RXUQDOLVWV7DFNOLQJ0DQ\6XEMHFW$UHDV,QFOXGLQJ +HDOWK&DQ%DQG7RJHWKHURQ'HHSO\$PELWLRXV:RUN

By Stefanie Murray

ecently I was thrilled to hear that the California Reporting Project had grown to 33 news organizations working together Rto collect and analyze internal police misconduct records that were recently released under a new state law. e organizations, including KQED San Francisco, the Bay Area News Group (notably e Mercury News and East Bay Times), the Los Angeles Times, CALMatters, KPCC Los Angeles, the Orange County Register and others, are examining hundreds of cases pulled from more than 1,100 public information requests across the state. As reported in the Los Angeles Times, “e documents provide a glimpse into how California police agencies evaluate misconduct, force and shootings by their o“cers — issues that have dominated a national debate over policing and fueled criticism that law enforcement agencies aren’t transparent enough with the communities they serve.” is is clearly an important project that is able to be tackled much more quickly and comprehensively because it’s a collaborative e˜ort. is is one of the best use cases I’ve seen for collaborative journalism yet in 2019. But it didn’t happen overnight, and it wasn’t easy. I chatted with Ethan Lindsey, executive editor at KQED News, about the project recently. KQED, the Bay Area News Group and Investigative Studios were one group (the northern California set) of original collaborators on the e˜ort. e Los Angeles Times and KPCC led a southern California group. Because everyone in California knew the law shielding these police misconduct records from public view changed at 12:01 a.m. 67()$1,(0855$< on Jan. 1, 2019, it was no secret that multiple news organizations were going after the documents. KQED reporters Alex Emslie and Sukey Lewis had been working on a strategy for weeks, for example, ere were a lot of phone calls, a lot of delicate conversations and others were doing the same. about access to the documents. Eventually, a detailed memorandum Lindsey told me the key for this collaboration to work was all the of understanding was drawn up. news entities openly agreed that these now-public records needed to Under the plan, once someone makes a records request, they tell be in the public domain, and that by working together, they could the entire group, and once they receive the records they are quickly make that happen much more quickly and thoroughly than if they uploaded and shared with everyone. all did it separately. Neil Chase, CEO at CALMatters and former executive editor It also helped that several of the partners had worked together on of the Bay Area News Group, told me via email: “is is, to me, other projects. is is critical: previous collaborations had built trust the watershed moment when we had built enough interest in between some of the journalists, which gave the collaborative the legs collaboration and understanding of its statewide importance, and it needed to scale. enough experience that we had the muscles to do it. So when the It was Megan Garvey, managing editor of Southern California opportunity arose, it just happened. It’s a huge moment.” Public Radio, who helped facilitate some of the early conversations While there are 33 news organizations participating as of this to work with bigger partners including the Los Angeles Times, writing, Lindsey told me they’re considering requests to join from Lindsey said. several others, including some national publications. “We have to “ere was some real walking on eggshells,” Lindsey recalled decide now how to bring other people in,” Lindsey said. “We don’t about some of the conversations. “We all agreed we wanted to work want to be a closed-door group, but we also don’t want to just share together, but what does working together mean?” [the work] without some buy-in.”

30 | May 2019 | NewsPro

P030_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Alliance continued from page 30

Lindsey noted that the project management role that Adriene calls, meeting deliverables and moving the project,” Lindsey said. Hill, senior editor of the California Dream collaborative, played was California is a bit unique in that collaboration has been part of crucial. “She has been doing yeoman’s work, helping out running its ecosystem, in some regards, for a long time. e state is home to initiatives like the Bay Area Media Collaborative and several partnership-oriented entities including the Center for Investigative Reporting/Reveal, the Center for Health Journalism and “There was some real CALMatters. We can look back to 2013’s collaborative e‹ort by nine news walking on eggshells. We all organizations in the state to better cover valley fever, an initiative organized by the Center for Health Journalism (then called Reporting on Health), which regularly runs collaborative reporting agreed we wanted to work projects. A couple weeks ago, I was chatting with another top editor at together, but what does a California newspaper and she told me that this is just the tip of the iceberg — there are several more collaborative initiatives in the working together mean?” works that could be groundbreaking. My response: Keep ’em coming. — Ethan Lindsey, KQED News Stefanie Murray is director of the Center for Cooperative Media at Montclair State University. is is an edited version of an article that originally appeared on Medium.com.

Climate Change continued from page 11 an independent journalist in Madison, Wisc. “It’s kind of like a It’s on the community level that this is going to be solved. solution focus to take, but also a rally-together type of thing that “Ticks do not care if you are Republican or Democrat, nor does seems really ripe for good stories,” he said. “What can we do? What the sun,” Palmer noted. “is could be a unifying issue. I had a quote are others doing? ere is a solutions element to it that I think makes from someone in Puerto Rico saying, ‘is is the best thing that ever it less of a bummer.” happened to us, because we banded together as Puerto Ricans to save O‹ering up information about readiness also lends an element of ourselves from this disaster.’” empowerment. “People hate not being able to do anything, whereas we can prepare for it,” Palmer said. “We can build hospital systems, health systems with the community. It’s communities that are going to help prepare us for climate change. at was the Puerto Rico story.

CrainsNewsPro.com

May 2019 | NewsPro | 31 Protecting Reporters continued from page 17 jumped to the conclusion that the attacker was somehow politically or ideologically motivated. As it turns out, he had a long-running personal vendetta against Is your newsroom reporting the paper after it had covered a court case in which he’d been involved years earlier. But that didn’t make the crime any less tragic. stories that expose problems As I travel around the nation speaking to journalists and journalism executives, I ask them these questions as a way to help them protect themselves and rebuild trust with news consumers: in your community, and then • Is your newsroom reporting stories that expose problems in your community, and then following up with stories following up with stories about potential solutions? • If you’re a n ews director, editor, general manager or about potential solutions? publisher, have you taken steps to protect the safety of your reporters and photojournalists — safety courses, self- defense training and extra physical security precautions in your newsroom, your station or your o­ce? when reporting particular stories and the process through • Do you send one-person multi-media journalist crews into which you’ve gone to resolve them? dangerous areas, or insist they do live shots late at night? If • Do you transmit public service announcements that so, stop. explain the importance of responsible journalism to your • Do you make an e‚ort to speak to the public — on the community? air, online, during speaking engagements and during • Do you provide editorials in which you explain your conversations with inƒuencers in your community — station’s newsgathering philosophy and commitment to about the public service your news organization regularly serve your community? provides? You’d be surprised how much goodwill can be earned when such • If you are a news anchor or reporter, do you explain actions are taken, with other journalists and the public. the process that you go through in order to report news Dan Shelley is executive director of the Radio Television Digital News stories — either on air or in written columns that the Association, which advocates exclusively on behalf of broadcast, cable and public can access on your primary news medium and/or digital journalists. Its Voice of the First Amendment Task Force €ghts social media? threats to press freedom and works to help the public better understand • Do you publicly discuss the ethical dilemmas you face why journalism is essential to their daily lives.

Add Solutions continued from page 19

to others, as well. Audiences appreciate them, particularly those SJN’s Solutions Story Tracker currently contains close to 6,000 in communities that are often stigmatized by traditional news stories. More than 1,200 focus on e‚orts to improve health and coverage. ‡ose ˆndings come from surveys conducted in 2016 well-being in the United States, and about 600 focus just on mental by ‡e Engaging News Project at the University of Texas and the health care. Tow Center for Digital Journalism at the Columbia Journalism ‡at’s a lot of reporting. It shows that journalists can do far more School. And for publishers, SJN’s research has found that solutions than uncover problems. We can help society make sense of, and learn journalism can help pay the bills. from, the emerging, often unknown or underappreciated, e‚orts to One issue that is generating considerable solutions-oriented grapple with them. coverage is mental health. ‡e American Psychological Association David Bornstein is a co-founder and CEO of the Solutions Journalism has found dramatic increases at the national level in teen anxiety, Network. He co-authors the “Fixes” column in ‹e New York Times depression and suicide over the past decade. Many communities are “Opinionator” section. His books include “How to Change the World: grappling with these problems with varying degrees of success. Social Entrepreneurs and the Power of New Ideas.”

32 | May 2019 | NewsPro

P032_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C Every Beat Includes Science Find training, resources, and the network you need through the National Association of Science Writers

For more than 80 years, NASW has set the standards for accurate science reporting, Take Your Science Reporting no matter the medium to the Next Level www.nasw.org/how-join-nasw

17np0052pdf RunDate:10/2/17 Full Page Color: 4/C SIGN-OFF A Writer-Doctor’s Life 7ZR3URIHVVLRQV$UH%HWWHU7KDQ2QHIRU6RPH

By Dr. Marc Siegel

ow is it possible for a hardworking doctor to also be a serious Today and several other outlets. writer and journalist? After all, a doctor writing for the After 9/11, I recognized that the public psyche was punctured, and Hlayman is not simply relating what’s in the medical chart. A we as a society became more susceptible to health scares. My book patient’s story, told in dense medical jargon by his or her physician, “False Alarm:
e Truth About the Epidemic of Fear” investigated does not automatically lend itself to literary unpacking. In fact, in my both the source of our fears and how they govern us. It was published experience the reality is just the opposite. in 2005 and became an Amazon bestseller.
e famed doctor/poet William Carlos Williams wrote in his From 2003 to 2006 I was a health columnist for the New York autobiography about the poetry residing just below the surface of Daily News (“Fact or Fiction”), then moved the column to the Los each patient: “Forget writing, it’s a trivial matter. But day in day out, Angeles Times and changed its name (to “
e Unreal World”). In when the inarticulate patient struggles to lay himself bare for you, or the columns I wrote about the medical accuracy of TV and ¥lm with nothing more than a boil on his back is so caught o€ balance productions, utilizing top medical, TV and ¥lm experts as my sources. that he reveals some secret twist of a whole community’s pathetic way
is reliance on experts became part of my signature style, and of thought, a man is suddenly seized again I continued to use it when I joined Fox with a desire to speak of the underground News as an analyst and later a reporter. I stream which for a moment has come up just struggled to master di€erent formats, from under the surface.” script writing to rapid-¥re, live interviews. It takes a skilled writer, not a hard-core
roughout all there was a common thread. doctor, to bring us there. I began writing at I wasn’t a doctor trying to reach laymen the age of 10, winning a state essay contest with a watered-down version of Latinate with an excursion into “the diligence and medical facts. Rather, I was a writer turned frugality of Benjamin Franklin.” I published doctor turned journalist, unpacking medical two sonnets in an international competition knowledge into a passionate form of at age 15. At the time, my creative writing entertainment while preserving accuracy. teacher was also my track coach. And that Billy Goldberg does this conversion combination gained me entrance into the e€ortlessly in his show on SiriusXM’s deep-thinking Brown University, where I Doctor Radio channel (where I serve as learned that you could do two things well medical director).
e show feels like an in your life. overnight stay in a city hospital ER, with a For thing No. 1, I c hose writing, and mix of zany anecdotes and serious medical my play “Obsolescence” — about a design facts. Goldberg is a natural born storyteller engineer on the moon projects who faces turned doctor turned radio host. 0$5&6,(*(/0' down his own obsolescence — won me a My new book is a novel about a grant and a place in a theatre festival, with contagious outbreak of historical and Kate Burton (who probably doesn’t remember this) playing the mythological proportions. It cuts close to the bone and could only female lead. have been written by a writer with a doctor’s knowledge base, not After Brown, I started on a novel but came to the conclusion that the other way around. And that’s the point. Medical journalism isn’t I had to spend at least part of the day “outside my own head.” Enter a branch of medicine; it’s a branch of journalism. And it takes real thing No. 2, becoming a doctor. At that age I had the energy to writers to write it. Writers with a medical expertise. go through medical school and residency training and keep writing, As my longtime partner on Doctor Radio, an executive producer with the writers Gordon Lish, Philip Roth and E.L. Doctorow as with many years of experience in radio and TV, once said, “
e guides, teachers and friends. challenge is to accurately describe something as seemingly o€- I completed my residency in Internal Medicine at New York putting as a colonoscopy — in an entertaining way.” University and immediately wrote a hallucinatory novel about Dr. Marc Siegel is a book author, a professor of medicine at New the experience, “Bellevue.” I began to practice medicine while York University School of Medicine, a medical director of Doctor Radio simultaneously writing op-eds and investigative medical pieces for (powered by NYU Langone on SiriusXM), a Fox News medical
e New York Times, Wall Street Journal, Washington Post, USA correspondent and a frequent columnist.

34 | May 2019 | NewsPro

P034_NP_20190520.pdf RunDate: 05/20/19 Full Page Color: 4/C NATAS Scholarships are competitive and those who have received this support are making a dierence, upholding the highest standards in the industry. You can make a dierence by encouraging and supporting these gi
ed high school and college students by making a donation to our Foundation that funds our ve major scholarships.

THE NATIONAL ACADEMY OF TELEVISION ARTS AND SCIENCES FOUNDATION e National Academy of Television Arts and Sciences is a professional association dedicated to the advancement of television and related electronic media and best known for its Emmy Awards that recognize excellence in a number of categories. e Academy has 19 local chapters that award Emmys for regional excellence and sponsor programs, seminars and award high school and college scholarships. In addition, the National Organization, through its non-pro‰t Foundation, awards scholarships to outstanding high school seniors who intend to pursue a baccalaureate degree in communications with emphasis on any aspect of the television industry. SCHOLARSHIPS RANDY FALCO SCHOLARSHIP ($10,000) Awarded to a Hispanic or Latino student pursuing a career in any aspect of the television industry. JIM MCKAY MEMORIAL SCHOLARSHIP ($10,000) Awarded to a student pursuing a career in sports television. DOUGLAS W. MUMMERT SCHOLARSHIP
$10,000 Awarded to a student pursuing a career in any aspect of the television industry, who has made a positive impact through community service. MIKE WALLACE MEMORIAL SCHOLARSHIP
$10,000 Awarded to a student pursuing a career in television journalism. NATAS TRUSTEES’ SCHOLARSHIP
$10,000) Awarded to a student pursuing a career in any aspect of the television industry.

MAKE CHECKS PAYABLE TO: e NATAS Foundation SEND TO: NATAS Foundation, 450 Park Avenue South, 3rd Floor, New York, NY 10016 ONLINE CONTRIBUTIONS: scholarapp.emmyonline.org/contributions

19NP0023.pdf RunDate MAY/2019 Full Page Color: 4/C RunDate: Full Page Color: 4/C 2CVKGPVU&GUGTXG 5VTCKIJVHQTYCTF 5EKGPEG$CUGF #PUYGTU#DQWV 6JGKT2TGUETKRVKQP /GFKECVKQPU

,S[HS[IVIEPP]PS[IV HVYKTVMGIW# %VIQ]QIHMGMRIWWEJI# ;LEXMWEFMSWMQMPEV# %6-)0 &EXXPIH FIEXGERGIV[MXL %VIHVYKWQEHIMRXLI97 XLILIPTSJKIRIVMGQIHMGMRIW FIXXIVUYEPMX]#

9RHIVWXERHMRKXLIJEGXWEFSYX*(%ETTVSZIHKIRIVMGERHFMSWMQMPEVQIHMGMRIWERH [LEXHMJJIVIRXMEXIWXLIQJVSQFVERHHVYKWGSYPHRSXFIQSVIMQTSVXERXEWTEXMIRXW ERHTSPMG]QEOIVWXYVRXSXLIQIHMEJSVLIPTQEOMRKMRJSVQIHHIGMWMSRW

8LI%WWSGMEXMSRJSV%GGIWWMFPI1IHMGMRIWMW]SYVVIWSYVGIJSVJEGXWERHHEXEEFSYX KIRIVMGERHFMSWMQMPEVWEZMRKWWEJIX]IJJMGEG]ERHUYEPMX]

'328%'8 6EGLIP7GL[EVX^ (MVIGXSVSJ1IHME6IPEXMSRW VEGLIPWGL[EVX^$EGGIWWMFPIQIHWSVK QIHME$EGGIWWMFPIQIHWSVK  

EGGIWWMFPIQIHW EGGIWWMFPIQIHWSVK

19np0024.pdf RunDate:05/20/19 Full Page Color: 4/C