DOCSLIB.ORG

Prespecified Candidate Biomarkers Identify Follicular Lymphoma Patients Who Achieved Longer Progression-Free Survival with Bortezomib−Rituximab Versus Rituximab

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Prespecified Candidate Biomarkers Identify Follicular Lymphoma Patients Who Achieved Longer Progression-Free Survival with Bortezomib−Rituximab Versus Rituximab Published OnlineFirst April 2, 2013; DOI: 10.1158/1078-0432.CCR-12-3069 Clinical Cancer Predictive Biomarkers and Personalized Medicine Research Prespecified Candidate Biomarkers Identify Follicular Lymphoma Patients Who Achieved Longer Progression-Free Survival with Bortezomib–Rituximab Versus Rituximab Bertrand Coiffier1, Weimin Li2, Erin D. Henitz3, Jayaprakash D. Karkera3, Reyna Favis3, Dana Gaffney3, Alice Shapiro3, Panteli Theocharous6, Yusri A. Elsayed3, Helgi van de Velde9, Michael E. Schaffer2, Evgenii A. Osmanov10, Xiaonan Hong11, Adriana Scheliga12, Jiri Mayer13, Fritz Offner8, Simon Rule7, Adriana Teixeira14, Joanna Romejko-Jarosinska15, Sven de Vos4, Michael Crump16, Ofer Shpilberg17, Pier Luigi Zinzani18, Andrew Cakana6, Dixie-Lee Esseltine5, George Mulligan5, and Deborah Ricci3 Abstract Purpose: Identify subgroups of patients with relapsed/refractory follicular lymphoma deriving substan- tial progression-free survival (PFS) benefit with bortezomib–rituximab versus rituximab in the phase III LYM-3001 study. Experimental Design: A total of 676 patients were randomized to five 5-week cycles of bortezomib– rituximab or rituximab. The primary end point was PFS; this prespecified analysis of candidate protein biomarkers and genes was an exploratory objective. Archived tumor tissue and whole blood samples were collected at baseline. Immunohistochemistry and genetic analyses were completed for 4 proteins and 8 genes. Results: In initial pairwise analyses, using individual single-nucleotide polymorphism genotypes, one biomarker pair (PSMB1 P11A C/G heterozygote, low CD68 expression) was associated with a significant PFS benefit with bortezomib–rituximab versus rituximab, controlling for multiple comparison corrections. The pair was analyzed under dominant, recessive, and additive genetic models, with significant association with PFS seen under the dominant model (G/GþC/G). In patients carrying this biomarker pair [PSMB1 P11A G allele, low CD68 expression (50 CD68-positive cells), population frequency: 43.6%], median PFS was 14.2 months with bortezomib–rituximab versus 9.1 months with rituximab (HR 0.47, P < 0.0001), and there was a significant overall survival benefit (HR 0.49, P ¼ 0.0461). Response rates were higher and time to next antilymphoma therapy was longer in the bortezomib–rituximab group. In biomarker-negative patients, no significant efficacy differences were seen between treatment groups. Similar proportions of patients had high-risk features in the biomarker-positive and biomarker-negative subsets. Conclusions: Patients with PSMB1 P11A (G allele) and low CD68 expression seemed to have signif- icantly longer PFS and greater clinical benefit with bortezomib–rituximab versus rituximab. Clin Cancer Res; 19(9); 2551–61. Ó2013 AACR. Introduction non-Hodgkin lymphoma (NHL; refs. 1, 2), is to prolong The goal of treatment for patients with follicular lym- progression-free survival (PFS) and improve overall survival phoma, a generally incurable, common indolent subtype of (OS). Follicular lymphoma is a highly heterogeneous Authors' Affiliations: 1Hematologie, Hospices Civils de Lyon and Uni- Cancer Centre, Warszawa, Poland; 16Princess Margaret Hospital, versity Lyon 1, Lyon, France; 2Janssen Research and Development, University of Toronto, Toronto, Ontario, Canada; 17Institute of Hema- Spring House, Pennsylvania; 3Janssen Research and Development, tology, Rabin Medical Center, Petah Tikva, Israel; and 18Policlinico S. Raritan, New Jersey; 4David Geffen School of Medicine at the University Orsola,MalpigliIstitutodiEmatologia e Oncologia Medica, Bologna, of California and Translational Oncology Research International, Los Italy Angeles, California; 5Millennium Pharmaceuticals, Inc., Cambridge, Massachusetts; 6Janssen Research and Development, High Wycombe; Note: Supplementary data for this article are available at Clinical Cancer 7Department of Haematology, Derriford Hospital, Plymouth, United Research Online (http://clincancerres.aacrjournals.org/). Kingdom; 8Dienst Hematologie, UZ Gent, Gent, Belgium; 9Janssen fi Research and Development, Beerse, Belgium; 10Cancer Research Cen- Corresponding Author: Bertrand Coif er, Hematologie, Hospices Civils ter, Moscow, Russia; 11Cancer Hospital, FuDan University, Shanghai, de Lyon and University Lyon 1, 69310 Pierre-Benite, Lyon, France. Phone: China; 12Instituto Nacional de Cancer,^ Rio de Janeiro, Brazil; 13CEITEC 33-478-86-4300; Fax: 33-478-86-4355; E-mail: fi Brno, and Department of Internal Medicine, Hematology and Oncology, bertrand.coif [email protected] University Hospital Brno and School of Medicine, Masaryk University, doi: 10.1158/1078-0432.CCR-12-3069 Brno, Czech Republic; 14HospitaisdaUniversidadedeCoimbra,Coim- bra, Portugal; 15The Maria Skłodowska-Curie Memorial Institute and Ó2013 American Association for Cancer Research. www.aacrjournals.org 2551 Downloaded from clincancerres.aacrjournals.org on September 25, 2021. © 2013 American Association for Cancer Research. Published OnlineFirst April 2, 2013; DOI: 10.1158/1078-0432.CCR-12-3069 Coiffier et al. morphisms were specified on the basis of prior studies of Translational Relevance prognostic molecular markers for lymphoma and of target Given the heterogeneity of follicular lymphoma and or response markers for bortezomib or rituximab. Here, we range of possible therapeutic options for patients with present the findings of this exploratory biomarker analysis. relapsed/refractory disease, the use of selected biomar- kers based on mechanistic rationales to identify patient Materials and Methods subgroups most likely to benefit from specific therapies Patients and clinical study design is important. Candidate proteins and target gene poly- The LYM-3001 (ClinicalTrials.gov trial registration ID: morphisms were prespecified as potential prognostic NCT00312845) study design has been reported previously markers for exploratory biomarker analyses in the phase (13). Eligible patients were aged 18 years or more with III LYM-3001 study of bortezomib–rituximab versus relapsed/refractory, rituximab-na€ve, or rituximab-sensitive rituximab in patients with relapsed/refractory follicular (13) grade 1/2 follicular lymphoma. Patients with grade 2 lymphoma. Comprehensive pairwise analyses, with peripheral neuropathy or clinical evidence of transforma- genetic model testing, identified a biomarker pair, tion to aggressive lymphoma were excluded. Patients were PSMB1 P11A (C/GþG/G) plus low CD68 expression, randomized (1:1) to receive five 5-week cycles comprising associated with a significant progression-free survival bortezomib (1.6 mg/m2, days 1, 8, 15, and 22; all cycles) benefit, improved response rates, and longer overall plus rituximab (375 mg/m2, days 1, 8, 15, and 22, cycle 1, survival with bortezomib–rituximab versus rituximab. and day 1, cycles 2–5), or rituximab alone. Randomization The benefit with bortezomib–rituximab was substantial- was stratified according to Follicular Lymphoma Interna- ly greater than seen in the overall, unselected study tional Prognostic Index (FLIPI; ref. 14) score, previous population. The two biomarkers identified, for which rituximab treatment, time since last dose of antilymphoma a mechanistic hypothesis is provided for the reported treatment, and region. efficacy benefit, would be feasible and practical to screen The primary end point was PFS. Secondary efficacy end for in the clinical setting. points included ORR, CR rate, time to progression, and 1 year OS. Response was assessed using modified Interna- tional Working Group response criteria (15). Time to next antilymphoma treatment (TTNT; time from randomization disease, as evidenced by variability in disease course, to first dose of next treatment) was an additional predefined responsiveness to treatment, and outcomes (3–5). There- efficacy end point. fore, to optimize treatment for individual patients, identi- All patients provided written informed consent. Review fication of subgroups that are most likely to benefit from a boards at all participating Institutions approved the study, specific therapy is important. which was conducted according to the provisions of the The anti-CD20 monoclonal antibody rituximab is the Declaration of Helsinki, the International Conference on mainstay of treatment for follicular lymphoma (1). Addi- Harmonization, and the Guidelines for Good Clinical tional treatment options may enhance the activity of ritux- Practice. imab-based therapy in the relapsed setting. The proteasome inhibitor bortezomib has shown single-agent activity in Biomarker analysis study design follicular lymphoma and other indolent NHL subtypes This prespecified focused analysis of potential biomar- (6–8), as well as promising activity in combination with kers of sensitivity to bortezomib–rituximab or rituximab rituximab, with or without other agents, in patients with was an exploratory objective. All patients were required to relapsed/refractory follicular lymphoma (9–12). provide consent for biomarker testing, and were included in Results from the international, multicenter, randomized, the biomarker study if they had evaluable biomarker data phase III LYM-3001 study (13) showed improved PFS with and data for at least one clinical end point. Archived tumor bortezomib–rituximab versus rituximab alone in patients tissue (samples requested from diagnosis) was collected at with relapsed/refractory rituximab-na€ve or rituximab-sen- baseline, and samples were forwarded to a central labora- sitive follicular lymphoma (median 12.8 vs. 11.0 months, tory as paraffin-embedded,
Load more

Recommended publications
  • 32-2748: PSMB1 Recombinant Protein Description Product Info
    9853 Pacific Heights Blvd. Suite D. San Diego, CA 92121, USA Tel: 858-263-4982 Email: [email protected] 32-2748: PSMB1 Recombinant Protein Alternative HC5,PSC5,PMSB1,FLJ25321,KIAA1838,PSMB1,Proteasome subunit beta type-1,Proteasome component Name : C5,Macropain subunit C5,Multicatalytic endopeptidase complex subunit C5,Proteasome gamma chain. Description Source : Escherichia Coli. PSMB1 Human Recombinant fused to 37 amino acid His Tag at N-terminal produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 250 amino acids (30-241) and having a molecular mass of 27.7 kDa. The PSMB1 is purified by proprietary chromatographic techniques. PSMB1 is part of the proteasome B-type family, also identified as the T1B family, that is a 20S core beta subunit. PSMB1 is tightly linked to the TBP (TATA-binding protein) gene in human and in mouse, and is transcribed in the opposite orientation in both species.The main function of PSMB1 is its degradation activity of unnecessary or damaged proteins by proteolysis. PSMB1 is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with arg, phe, tyr, leu, and glu adjacent to the leaving group at neutral or slightly basic ph. the proteasome has an atp-dependent proteolytic activity. Product Info Amount : 10 µg Purification : Greater than 95.0% as determined by SDS-PAGE. Content : The PSMB1 solution contains 20mM Tris-HCl pH-8, 1mM DTT and 10% glycerol. PSMB1 Recombinant Human although stable at 4°C for 30 days, should be stored desiccated Storage condition : below -20°C for periods greater than 30 days.
    [Show full text]
  • An Integrative Analysis of Gene Expression and Molecular
    Muraro and Simmons BMC Bioinformatics (2016) 17:42 DOI 10.1186/s12859-016-0886-z RESEARCH ARTICLE Open Access An integrative analysis of gene expression and molecular interaction data to identify dys-regulated sub-networks in inflammatory bowel disease Daniele Muraro* and Alison Simmons Abstract Background: Inflammatory bowel disease (IBD) consists of two main disease-subtypes, Crohn’s disease (CD) and ulcerative colitis (UC); these subtypes share overlapping genetic and clinical features. Genome-wide microarray data enable unbiased documentation of alterations in gene expression that may be disease-specific. As genetic diseases are believed to be caused by genetic alterations affecting the function of signalling pathways, module-centric optimisation algorithms, whose aim is to identify sub-networks that are dys-regulated in disease, are emerging as promising approaches. Results: In order to account for the topological structure of molecular interaction networks, we developed an optimisation algorithm that integrates databases of known molecular interactions with gene expression data; such integration enables identification of differentially regulated network modules. We verified the performance of our algorithm by testing it on simulated networks; we then applied the same method to study experimental data derived from microarray analysis of CD and UC biopsies and human interactome databases. This analysis allowed the extraction of dys-regulated subnetworks under different experimental conditions (inflamed and uninflamed tissues in CD and UC). Optimisation was performed to highlight differentially expressed network modules that may be common or specific to the disease subtype. Conclusions: We show that the selected subnetworks include genes and pathways of known relevance for IBD; in particular, the solutions found highlight cross-talk among enriched pathways, mainly the JAK/STAT signalling pathway and the EGF receptor signalling pathway.
    [Show full text]
  • King's Research Portal
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by King's Research Portal King’s Research Portal DOI: 10.1016/j.biotechadv.2017.05.004 Document Version Publisher's PDF, also known as Version of record Link to publication record in King's Research Portal Citation for published version (APA): Neville, J. J., Orlando, J., Mann, K., McCloskey, B., & Antoniou, M. N. (2017). Ubiquitous Chromatin-opening Elements (UCOEs): Applications in biomanufacturing and gene therapy. BIOTECHNOLOGY ADVANCES, 557- 564. DOI: 10.1016/j.biotechadv.2017.05.004 Citing this paper Please note that where the full-text provided on King's Research Portal is the Author Accepted Manuscript or Post-Print version this may differ from the final Published version. If citing, it is advised that you check and use the publisher's definitive version for pagination, volume/issue, and date of publication details. And where the final published version is provided on the Research Portal, if citing you are again advised to check the publisher's website for any subsequent corrections. General rights Copyright and moral rights for the publications made accessible in the Research Portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognize and abide by the legal requirements associated with these rights. •Users may download and print one copy of any publication from the Research Portal for the purpose of private study or research. •You may not further distribute the material or use it for any profit-making activity or commercial gain •You may freely distribute the URL identifying the publication in the Research Portal Take down policy If you believe that this document breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Protein Expression Analysis of an in Vitro Murine Model of Prostate Cancer Progression: Towards Identification of High-Potential Therapeutic Targets
    Journal of Personalized Medicine Article Protein Expression Analysis of an In Vitro Murine Model of Prostate Cancer Progression: Towards Identification of High-Potential Therapeutic Targets Hisham F. Bahmad 1,2,3 , Wenjing Peng 4, Rui Zhu 4, Farah Ballout 1, Alissar Monzer 1, 1,5 6, , 1, , 4, , Mohamad K. Elajami , Firas Kobeissy * y , Wassim Abou-Kheir * y and Yehia Mechref * y 1 Department of Anatomy, Cell Biology and Physiological Sciences, Faculty of Medicine, American University of Beirut, Beirut 1107-2020, Lebanon; [email protected] (H.F.B.); [email protected] (F.B.); [email protected] (A.M.); [email protected] (M.K.E.) 2 Arkadi M. Rywlin M.D. Department of Pathology and Laboratory Medicine, Mount Sinai Medical Center, Miami Beach, FL 33140, USA 3 Herbert Wertheim College of Medicine, Florida International University, Miami, FL 33199, USA 4 Department of Chemistry and Biochemistry, Texas Tech University, Lubbock, TX 79409, USA; [email protected] (W.P.); [email protected] (R.Z.) 5 Department of Internal Medicine, Mount Sinai Medical Center, Miami Beach, FL 33140, USA 6 Department of Biochemistry and Molecular Genetics, Faculty of Medicine, American University of Beirut, Beirut 1107-2020, Lebanon * Correspondence: [email protected] (F.K.); [email protected] (W.A.-K.); [email protected] (Y.M.); Tel.: +961-1-350000 (ext. 4805) (F.K.); +961-1-350000 (ext. 4778) (W.A.K.); +1-806-834-8246 (Y.M.); Fax: +1-806-742-1289 (Y.M.); 961-1-744464 (W.A.K.) These authors have contributed equally to this work as joint senior authors.
    [Show full text]
  • Recombinant Human PSMB1 Protein Catalog Number: ATGP0275
    Recombinant human PSMB1 protein Catalog Number: ATGP0275 PRODUCT INPORMATION Expression system E.coli Domain 30-241aa UniProt No. P20618 NCBI Accession No. NP_002784.1 Alternative Names Proteasome subunit beta type-1, Proteasome subunit, beta type-1, PSC5, Proteasome subunit, beta type-1 FLJ25321, HC5, KIAA1838, Macropain subunit C5, Multicatalytic endopeptidase complex subunit C5, Proteasome (prosome macropain) subunit beta type 1, Proteasome beta 1 subunit, Proteasome component C5, Proteasome gamma chain, Proteasome subunit HC5, Proteasome subunit beta type 1, PSMB 1, PSMB1. PRODUCT SPECIFICATION Molecular Weight 27.7 kDa (250aa) confirmed by MALDI-TOF Concentration 1mg/ml (determined by Bradford assay) Formulation Liquid in. 20mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol Purity > 95% by SDS-PAGE Tag His-Tag Application SDS-PAGE Storage Condition Can be stored at +2C to +8C for 1 week. For long term storage, aliquot and store at -20C to -80C. Avoid repeated freezing and thawing cycles. BACKGROUND Description PSMB1 (Proteasome subunit, beta type-1) encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This is tightly linked to the TBP (TATA-binding protein) gene in human and in mouse, and is transcribed in the opposite orientation in both species. The main function of PSMB1 1 Recombinant human PSMB1 protein Catalog Number: ATGP0275 is to degrade unnecessary or damaged proteins by proteolysis. Recombinant human PSMB1 protein, fused to His- tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography. Amino acid Sequence <MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSHM>FS PYVFNGGTIL AIAGEDFAIV ASDTRLSEGF SIHTRDSPKC YKLTDKTVIG CSGFHGDCLT LTKIIEARLK MYKHSNNKAM TTGAIAAMLS TILYSRRFFP YYVYNIIGGL DEEGKGAVYS FDPVGSYQRD SFKAGGSASA MLQPLLDNQV GFKNMQNVEH VPLSLDRAMR LVKDVFISAA ERDVYTGDAL RICIVTKEGI REETVSLRKD General References Coux O., et al.
    [Show full text]
  • PSMB1 Polyclonal Antibody Gene Symbol: PSMB1
    PSMB1 polyclonal antibody Gene Symbol: PSMB1 Gene Alias: FLJ25321, HC5, KIAA1838, PMSB1, PSC5 Catalog Number: PAB22318 Gene Summary: The proteasome is a multicatalytic Regulatory Status: For research use only (RUO) proteinase complex with a highly ordered ring-shaped Product Description: Rabbit polyclonal antibody raised 20S core structure. The core structure is composed of 4 against recombinant PSMB1. rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta Immunogen: Recombinant protein corresponding to subunits. Proteasomes are distributed throughout amino acids of human PSMB1. eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a Sequence: non-lysosomal pathway. An essential function of a YQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVP modified proteasome, the immunoproteasome, is the LSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIR processing of class I MHC peptides. This gene encodes EETVSLRKD a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This Host: Rabbit gene is tightly linked to the TBP (TATA-binding protein) gene in human and in mouse, and is transcribed in the Reactivity: Human,Mouse,Rat opposite orientation in both species. [provided by RefSeq] Applications: IHC-P, WB (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Form: Liquid Purification: Antigen affinity purification Isotype: IgG Recommend Usage: Immunohistochemistry (1:200-1:500) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
    [Show full text]
  • Role of Phytochemicals in Colon Cancer Prevention: a Nutrigenomics Approach
    Role of phytochemicals in colon cancer prevention: a nutrigenomics approach Marjan J van Erk Promotor: Prof. Dr. P.J. van Bladeren Hoogleraar in de Toxicokinetiek en Biotransformatie Wageningen Universiteit Co-promotoren: Dr. Ir. J.M.M.J.G. Aarts Universitair Docent, Sectie Toxicologie Wageningen Universiteit Dr. Ir. B. van Ommen Senior Research Fellow Nutritional Systems Biology TNO Voeding, Zeist Promotiecommissie: Prof. Dr. P. Dolara University of Florence, Italy Prof. Dr. J.A.M. Leunissen Wageningen Universiteit Prof. Dr. J.C. Mathers University of Newcastle, United Kingdom Prof. Dr. M. Müller Wageningen Universiteit Dit onderzoek is uitgevoerd binnen de onderzoekschool VLAG Role of phytochemicals in colon cancer prevention: a nutrigenomics approach Marjan Jolanda van Erk Proefschrift ter verkrijging van graad van doctor op gezag van de rector magnificus van Wageningen Universiteit, Prof.Dr.Ir. L. Speelman, in het openbaar te verdedigen op vrijdag 1 oktober 2004 des namiddags te vier uur in de Aula Title Role of phytochemicals in colon cancer prevention: a nutrigenomics approach Author Marjan Jolanda van Erk Thesis Wageningen University, Wageningen, the Netherlands (2004) with abstract, with references, with summary in Dutch ISBN 90-8504-085-X ABSTRACT Role of phytochemicals in colon cancer prevention: a nutrigenomics approach Specific food compounds, especially from fruits and vegetables, may protect against development of colon cancer. In this thesis effects and mechanisms of various phytochemicals in relation to colon cancer prevention were studied through application of large-scale gene expression profiling. Expression measurement of thousands of genes can yield a more complete and in-depth insight into the mode of action of the compounds.
    [Show full text]
  • Anti-Inflammatory Role of Curcumin in LPS Treated A549 Cells at Global Proteome Level and on Mycobacterial Infection
    Anti-inflammatory Role of Curcumin in LPS Treated A549 cells at Global Proteome level and on Mycobacterial infection. Suchita Singh1,+, Rakesh Arya2,3,+, Rhishikesh R Bargaje1, Mrinal Kumar Das2,4, Subia Akram2, Hossain Md. Faruquee2,5, Rajendra Kumar Behera3, Ranjan Kumar Nanda2,*, Anurag Agrawal1 1Center of Excellence for Translational Research in Asthma and Lung Disease, CSIR- Institute of Genomics and Integrative Biology, New Delhi, 110025, India. 2Translational Health Group, International Centre for Genetic Engineering and Biotechnology, New Delhi, 110067, India. 3School of Life Sciences, Sambalpur University, Jyoti Vihar, Sambalpur, Orissa, 768019, India. 4Department of Respiratory Sciences, #211, Maurice Shock Building, University of Leicester, LE1 9HN 5Department of Biotechnology and Genetic Engineering, Islamic University, Kushtia- 7003, Bangladesh. +Contributed equally for this work. S-1 70 G1 S 60 G2/M 50 40 30 % of cells 20 10 0 CURI LPSI LPSCUR Figure S1: Effect of curcumin and/or LPS treatment on A549 cell viability A549 cells were treated with curcumin (10 µM) and/or LPS or 1 µg/ml for the indicated times and after fixation were stained with propidium iodide and Annexin V-FITC. The DNA contents were determined by flow cytometry to calculate percentage of cells present in each phase of the cell cycle (G1, S and G2/M) using Flowing analysis software. S-2 Figure S2: Total proteins identified in all the three experiments and their distribution betwee curcumin and/or LPS treated conditions. The proteins showing differential expressions (log2 fold change≥2) in these experiments were presented in the venn diagram and certain number of proteins are common in all three experiments.
    [Show full text]
  • Molecular Pathology and Novel Clinical Therapy for Uterine
    ANTICANCER RESEARCH 36 : 4997-5008 (2016) doi:10.21873/anticanres.11068 Review Molecular Pathology and Novel Clinical Therapy for Uterine Leiomyosarcoma TAKUMA HAYASHI 1,2 , MIKI KAWANO 2,3 , TOMOYUKI ICHIMURA 4, KOICHI IDA 1, HIROFUMI ANDO 1, DORIT ZHARHARY 5, YAE KANAI 6, HIROYUKI ABURATANI 7, SUSUMU TONEGAWA 8, TANRI SHIOZAWA 1, NOBUO YAEGASHI 9 and IKUO KONISHI 10 1Department of Obstetrics and Gynecology, Shinshu University School of Medicine, Nagano, Japan; 2Department of Medical Technology, International University of Health and Welfare, Chiba, Japan; 3Department of Health Science, Kyushu University Graduate School of Medicine, Fukuoka, Japan; 4Department of Obstetrics and Gynecology, Osaka City University Graduate School of Medicine, Osaka, Japan; 5SIGMA-Aldrich Israel, Rehovot, Israel; 6Pathology Division, Keio University School of Medicine, Tokyo, Japan; 7The Cancer System Laboratory, Research Center for Advanced Science and Technology, The University of Tokyo, Tokyo, Japan; 8Department of Biology, Massachusetts Institute of Technology, Cambridge, MA, U.S.A.; 9Department of Obstetrics and Gynecology, Tohoku University Graduate School of Medicine, Miyagi, Japan; 10 National Hospital Organization Kyoto Medical Centre, Kyoto, Japan Abstract. Patients with uterine leiomyosarcoma (LMS) disease prevalence of ~37% by 12 months of age. Furthermore, typically present with vaginal bleeding, pain, and a pelvic a recent report showed the loss of ability to induce PSMB9/ β1 i mass, with atypical presentations of hypercalcemia and expression,
    [Show full text]
  • Datasheet: VPA00155 Product Details
    Datasheet: VPA00155 Description: GOAT ANTI PSMB8 Specificity: PSMB8 Format: Purified Product Type: PrecisionAb™ Polyclonal Isotype: Polyclonal IgG Quantity: 100 µl Product Details Applications This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit www.bio-rad-antibodies.com/protocols. Yes No Not Determined Suggested Dilution Western Blotting 1/1000 PrecisionAb antibodies have been extensively validated for the western blot application. The antibody has been validated at the suggested dilution. Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Further optimization may be required dependant on sample type. Target Species Human Species Cross Reacts with: Rat Reactivity N.B. Antibody reactivity and working conditions may vary between species. Product Form Purified IgG - liquid Preparation Goat polyclonal antibody purified by affinity chromatography Buffer Solution TRIS buffered saline Preservative 0.02% Sodium Azide (NaN ) 0.5 % BSA Stabilisers 3 Immunogen Peptide with the sequence C-DVSDLLHQYREANQ, from the C terminus of the protein sequence External Database Links UniProt: P28062 Related reagents Entrez Gene: 5696 PSMB8 Related reagents Synonyms LMP7, PSMB5i, RING10, Y2 Page 1 of 2 Specificity Goat anti Human PSMB8 antibody recognizes proteasome subunit beta type-8, also known as Low molecular mass protein 7, macropain subunit C13, multicatalytic endopeptidase complex subunit C13, proteasome component C13, and proteasome subunit beta-5i. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure.
    [Show full text]
  • Proteasome Immunosubunits Protect Against the Development of CD8 T Cell-Mediated Autoimmune Diseases
    Proteasome Immunosubunits Protect against the Development of CD8 T Cell-Mediated Autoimmune Diseases This information is current as Dietmar M. W. Zaiss, Cornelis P. J. Bekker, Andrea Gröne, of September 29, 2021. Benedicte A. Lie and Alice J. A. M. Sijts J Immunol published online 29 July 2011 http://www.jimmunol.org/content/early/2011/07/29/jimmun ol.1101003 Downloaded from Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision http://www.jimmunol.org/ • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: by guest on September 29, 2021 http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2011 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published July 29, 2011, doi:10.4049/jimmunol.1101003 The Journal of Immunology Proteasome Immunosubunits Protect against the Development of CD8 T Cell-Mediated Autoimmune Diseases Dietmar M. W. Zaiss,* Cornelis P. J. Bekker,* Andrea Gro¨ne,† Benedicte A. Lie,‡ and Alice J. A. M. Sijts* Exposure of cells to inflammatory cytokines induces the expression of three proteasome immunosubunits, two of which are encoded in the MHC class II region.
    [Show full text]