Doppel Antibody / PRND (RQ4601)
Catalog No. Formulation Size
RQ4601 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug Bulk quote request
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q9UKY0
Localization Cytoplasm, plasma membrane
Applications Western blot : 0.5-1ug/ml IHC (FFPE) : 1-2ug/ml
Western blot testing of 1) human SHG-44, 2) rat testis, 3) rat kidney, 4) mouse testis, 5) mouse kidney and 6) mouse brain lysate with Doppel antibody at 0.5ug/ml. Predicted molecular weight ~20 kDa. IHC staining of FFPE human testis with Doppel antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse testis with Doppel antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Description Prion protein 2 (dublet), also known as PRND, or Doppel protein, is a protein which in humans is encoded by the PRND gene. It is mapped to 20p13. This gene is found on chromosome 20, approximately 20 kbp downstream of the gene encoding cellular prion protein, to which it is biochemically and structurally similar. The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that is found predominantly in testis. Mutations in this gene may lead to neurological disorders.
Application Notes Optimal dilution of the Doppel antibody should be determined by the researcher.
Immunogen Amino acids ATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKH were used as the immunogen for the Doppel antibody.
Storage After reconstitution, the Doppel antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Ordering: Phone:858.663.9055 | Fax:1.267.821.0800 | Email:[email protected] Copyright © NSJ Bioreagents. All rights reserved